F479056

General Info

Members Datasets Scaffolds Average Seq Length
750 267 1500 191

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0047099|Ga0395905_0047099_413_988
Length 191
Sequence LNAIALPAHAALKEGDVAPEFNAPASLNGKTFTFSLRDALAKGPVVIYFFPSAYTSGCNIQAHEFAVNHDKFAAANAAIIGVSLDSIQRLNSFSADPNYCAGKVPVASDSDGKIAKSYDLSIWAASSWINSWIKDTRGEPIGHGFAERTTFIVTQDGRIAATIGGLAPQANVEKALEVVQRLAVGKAGKSP

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 4.27
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0047099 3300037471 Unclassified 4042
2 JGI25154J39366_1001051 3300002738 Bacteria 10962
3 Ga0055526_1000096 3300003771 Bacteria 80897
4 Ga0065712_10068423 3300005290 Bacteria 10760
5 Ga0065715_10123944 3300005293 Bacteria 2150
6 Ga0070658_10006171 3300005327 Bacteria 9717
7 Ga0070658_10019394 3300005327 Bacteria 5447
8 Ga0070658_10027035 3300005327 Bacteria 4606
9 Ga0070658_10180848 3300005327 Bacteria 1774
10 Ga0070676_10005962 3300005328 Bacteria 6506
11 Ga0070676_10006479 3300005328 Bacteria 6255
12 Ga0070676_10012439 3300005328 Unclassified 4646
13 Ga0070676_10023171 3300005328 Bacteria 3488
14 Ga0070676_10156583 3300005328 Bacteria 1463
15 Ga0070676_10227940 3300005328 Bacteria 1234
16 Ga0070683_100023119 3300005329 Bacteria 5558
17 Ga0070683_100076257 3300005329 Bacteria 3134
18 Ga0070683_100174541 3300005329 Bacteria 2040
19 Ga0070690_100005995 3300005330 Bacteria 6865
20 Ga0070690_100007120 3300005330 Bacteria 6391
21 Ga0070690_100023355 3300005330 Bacteria 3793
22 Ga0070670_100045210 3300005331 Bacteria 3784
23 Ga0070670_100062193 3300005331 Bacteria 3205
24 Ga0070670_100080084 3300005331 Bacteria 2807
25 Ga0070670_100101251 3300005331 Bacteria 2480
26 Ga0070670_100101647 3300005331 Bacteria 2475
27 Ga0070670_100210530 3300005331 Bacteria 1690
28 Ga0070670_100387101 3300005331 Bacteria 1232
29 Ga0070670_100491926 3300005331 Bacteria 1090
30 Ga0070677_10003964 3300005333 Bacteria 4808
31 Ga0070677_10011663 3300005333 Bacteria 3037
32 Ga0070677_10092371 3300005333 Bacteria 1319
33 Ga0070677_10094618 3300005333 Bacteria 1306
34 Ga0070677_10127538 3300005333 Bacteria 1157
35 Ga0070677_10181462 3300005333 Bacteria 1003
36 Ga0070677_10353892 3300005333 Bacteria 761
37 Ga0068869_100025109 3300005334 Bacteria 4134
38 Ga0068869_100183461 3300005334 Bacteria 1642
39 Ga0068869_100235800 3300005334 Bacteria 1456
40 Ga0070666_10001894 3300005335 Bacteria 12731
41 Ga0070666_10029829 3300005335 Bacteria 3589
42 Ga0070666_10038549 3300005335 Bacteria 3180
43 Ga0070666_10107359 3300005335 Bacteria 1929
44 Ga0070680_100402042 3300005336 Bacteria 1167
45 Ga0070680_100604539 3300005336 Unclassified 941
46 Ga0070680_100814219 3300005336 Bacteria 805
47 Ga0068868_100009490 3300005338 Bacteria 7007
48 Ga0068868_100018924 3300005338 Bacteria 5155
49 Ga0068868_100046902 3300005338 Bacteria 3383
50 Ga0068868_100072652 3300005338 Bacteria 2745
51 Ga0068868_100081048 3300005338 Bacteria 2601
52 Ga0068868_100691571 3300005338 Unclassified 912
53 Ga0070660_100158017 3300005339 Bacteria 1826
54 Ga0070660_100373919 3300005339 Unclassified 1176
55 Ga0070660_100575311 3300005339 Bacteria 941
56 Ga0070689_100088769 3300005340 Bacteria 2434
57 Ga0070689_100114249 3300005340 Bacteria 2151
58 Ga0070687_100003640 3300005343 Bacteria 6020
59 Ga0070687_100035262 3300005343 Bacteria 2483
60 Ga0070687_100651553 3300005343 Unclassified 730
61 Ga0070661_100002816 3300005344 Bacteria 11950
62 Ga0070661_100007147 3300005344 Bacteria 7697
63 Ga0070661_100029339 3300005344 Bacteria 3970
64 Ga0070661_100095157 3300005344 Bacteria 2209
65 Ga0070661_100155744 3300005344 Bacteria 1729
66 Ga0070661_100328610 3300005344 Bacteria 1195
67 Ga0070692_10193369 3300005345 Bacteria 1187
68 Ga0070692_10334657 3300005345 Unclassified 936
69 Ga0070692_10486991 3300005345 Bacteria 797
70 Ga0070668_100006308 3300005347 Bacteria 8782
71 Ga0070668_100024365 3300005347 Bacteria 4584
72 Ga0070668_100070462 3300005347 Bacteria 2722
73 Ga0070668_100118739 3300005347 Bacteria 2111
74 Ga0070668_100265798 3300005347 Bacteria 1428
75 Ga0070669_100001930 3300005353 Bacteria 14961
76 Ga0070669_100035028 3300005353 Unclassified 3636
77 Ga0070669_100065607 3300005353 Bacteria 2675
78 Ga0070669_100276688 3300005353 Bacteria 1344
79 Ga0070669_100409138 3300005353 Bacteria 1111
80 Ga0070669_100824007 3300005353 Bacteria 789
81 Ga0070675_100001176 3300005354 Bacteria 18986
82 Ga0070675_100010618 3300005354 Bacteria 7199
83 Ga0070675_100014052 3300005354 Bacteria 6306
84 Ga0070675_100033225 3300005354 Bacteria 4181
85 Ga0070675_100034446 3300005354 Bacteria 4110
86 Ga0070675_100036777 3300005354 Bacteria 3985
87 Ga0070675_100164067 3300005354 Bacteria 1913
88 Ga0070675_100211077 3300005354 Bacteria 1687
89 Ga0070675_100269910 3300005354 Bacteria 1493
90 Ga0070675_100368556 3300005354 Bacteria 1277
91 Ga0070675_100770589 3300005354 Bacteria 878
92 Ga0070671_100012077 3300005355 Bacteria 6948
93 Ga0070671_100016912 3300005355 Bacteria 5899
94 Ga0070671_100095170 3300005355 Bacteria 2496
95 Ga0070671_100139314 3300005355 Bacteria 2047
96 Ga0070671_100334719 3300005355 Bacteria 1291
97 Ga0070674_100008210 3300005356 Bacteria 6201
98 Ga0070674_100063057 3300005356 Bacteria 2593
99 Ga0070674_100113347 3300005356 Bacteria 1994
100 Ga0070674_100115915 3300005356 Bacteria 1976
101 Ga0070673_100002554 3300005364 Bacteria 11108
102 Ga0070673_100009673 3300005364 Bacteria 6484
103 Ga0070673_100032222 3300005364 Bacteria 3943
104 Ga0070673_100061777 3300005364 Bacteria 2974
105 Ga0070673_100101191 3300005364 Bacteria 2374
106 Ga0070673_100106139 3300005364 Bacteria 2322
107 Ga0070673_100187279 3300005364 Bacteria 1775
108 Ga0070673_100261901 3300005364 Bacteria 1511
109 Ga0070673_100407744 3300005364 Unclassified 1216
110 Ga0070688_100111110 3300005365 Bacteria 1823
111 Ga0070688_100313006 3300005365 Bacteria 1138
112 Ga0070688_100406409 3300005365 Bacteria 1009
113 Ga0070659_100015991 3300005366 Bacteria 5628
114 Ga0070659_100057885 3300005366 Bacteria 3057
115 Ga0070659_100084372 3300005366 Bacteria 2540
116 Ga0070659_100097877 3300005366 Bacteria 2358
117 Ga0070659_100246075 3300005366 Bacteria 1481
118 Ga0070667_100007889 3300005367 Bacteria 8833
119 Ga0070667_100027330 3300005367 Bacteria 4746
120 Ga0070667_100093553 3300005367 Bacteria 2589
121 Ga0070667_100540170 3300005367 Bacteria 1071
122 Ga0070709_10002864 3300005434 Bacteria 9317
123 Ga0070701_10117964 3300005438 Bacteria 1491
124 Ga0070700_100049328 3300005441 Bacteria 2613
125 Ga0070700_100439849 3300005441 Bacteria 990
126 Ga0070678_100030416 3300005456 Bacteria 3712
127 Ga0070678_100051457 3300005456 Bacteria 2986
128 Ga0070678_100055418 3300005456 Bacteria 2894
129 Ga0070678_100118657 3300005456 Bacteria 2082
130 Ga0070678_100133451 3300005456 Bacteria 1976
131 Ga0070678_100304915 3300005456 Bacteria 1354
132 Ga0070678_100314319 3300005456 Unclassified 1336
133 Ga0070678_100375372 3300005456 Bacteria 1229
134 Ga0070662_100003354 3300005457 Bacteria 9985
135 Ga0070662_100005934 3300005457 Bacteria 7837
136 Ga0070662_100214975 3300005457 Bacteria 1531
137 Ga0070662_100259581 3300005457 Bacteria 1399
138 Ga0070662_100337678 3300005457 Bacteria 1232
139 Ga0070662_100394167 3300005457 Bacteria 1142
140 Ga0070662_100529194 3300005457 Unclassified 986
141 Ga0070681_10002332 3300005458 Bacteria 17354
142 Ga0070681_10245485 3300005458 Bacteria 1703
143 Ga0068867_100018416 3300005459 Bacteria 4963
144 Ga0068867_100031143 3300005459 Bacteria 3850
145 Ga0068867_100070011 3300005459 Bacteria 2621
146 Ga0068867_100344917 3300005459 Bacteria 1241
147 Ga0068867_100405854 3300005459 Bacteria 1150
148 Ga0070685_10082165 3300005466 Bacteria 1933
149 Ga0070685_10379493 3300005466 Bacteria 974
150 Ga0070679_100028309 3300005530 Bacteria 5523
151 Ga0070684_100039840 3300005535 Bacteria 4043
152 Ga0070684_100068182 3300005535 Bacteria 3126
153 Ga0070684_100324270 3300005535 Bacteria 1415
154 Ga0070684_100441089 3300005535 Bacteria 1203
155 Ga0070684_100838654 3300005535 Bacteria 860
156 Ga0068853_100050235 3300005539 Bacteria 3587
157 Ga0068853_100050380 3300005539 Bacteria 3582
158 Ga0068853_100361883 3300005539 Bacteria 1351
159 Ga0068853_100380685 3300005539 Bacteria 1318
160 Ga0068853_100955109 3300005539 Bacteria 824
161 Ga0070672_100000938 3300005543 Bacteria 17520
162 Ga0070672_100009263 3300005543 Bacteria 6780
163 Ga0070672_100027267 3300005543 Bacteria 4260
164 Ga0070672_100037672 3300005543 Bacteria 3691
165 Ga0070672_100062333 3300005543 Bacteria 2942
166 Ga0070672_100121137 3300005543 Bacteria 2141
167 Ga0070672_100163985 3300005543 Bacteria 1845
168 Ga0070672_100178932 3300005543 Bacteria 1766
169 Ga0070672_100211229 3300005543 Bacteria 1625
170 Ga0070672_100401813 3300005543 Bacteria 1174
171 Ga0070672_101234102 3300005543 Bacteria 666
172 Ga0070686_100052535 3300005544 Bacteria 2599
173 Ga0070686_100118725 3300005544 Bacteria 1813
174 Ga0070686_100288586 3300005544 Bacteria 1213
175 Ga0070695_100022024 3300005545 Bacteria 3905
176 Ga0070693_100011776 3300005547 Bacteria 4411
177 Ga0070693_100022414 3300005547 Bacteria 3358
178 Ga0070693_100197810 3300005547 Bacteria 1303
179 Ga0070693_100500082 3300005547 Bacteria 862
180 Ga0070665_100034729 3300005548 Bacteria 5071
181 Ga0070665_100051590 3300005548 Bacteria 4125
182 Ga0070665_100060162 3300005548 Bacteria 3808
183 Ga0070665_100093445 3300005548 Unclassified 3013
184 Ga0070665_100676809 3300005548 Bacteria 1045
185 Ga0070704_100329572 3300005549 Bacteria 1282
186 Ga0068855_100173632 3300005563 Bacteria 2440
187 Ga0068855_100582145 3300005563 Bacteria 1209
188 Ga0070664_100023731 3300005564 Bacteria 5066
189 Ga0070664_100065770 3300005564 Bacteria 3094
190 Ga0070664_100086319 3300005564 Bacteria 2711
191 Ga0070664_100099142 3300005564 Bacteria 2532
192 Ga0070664_100112706 3300005564 Bacteria 2375
193 Ga0070664_100115125 3300005564 Bacteria 2350
194 Ga0070664_100177776 3300005564 Bacteria 1890
195 Ga0068857_100148769 3300005577 Bacteria 2120
196 Ga0068857_100165718 3300005577 Bacteria 2007
197 Ga0068854_100020832 3300005578 Bacteria 4442
198 Ga0068856_100185959 3300005614 Bacteria 2091
199 Ga0068856_101422499 3300005614 Unclassified 708
200 Ga0070702_100003108 3300005615 Bacteria 7353
201 Ga0070702_100008222 3300005615 Bacteria 5040
202 Ga0068852_100007768 3300005616 Bacteria 7852
203 Ga0068852_100021050 3300005616 Bacteria 5196
204 Ga0068852_100021896 3300005616 Bacteria 5114
205 Ga0068852_100263920 3300005616 Bacteria 1654
206 Ga0068852_100567948 3300005616 Bacteria 1136
207 Ga0068852_100637777 3300005616 Bacteria 1072
208 Ga0068852_100947900 3300005616 Unclassified 879
209 Ga0068859_100023535 3300005617 Bacteria 6181
210 Ga0068859_100026646 3300005617 Bacteria 5797
211 Ga0068859_100050989 3300005617 Bacteria 4159
212 Ga0068859_100097161 3300005617 Bacteria 2998
213 Ga0068864_100002715 3300005618 Bacteria 14579
214 Ga0068864_100008666 3300005618 Bacteria 8391
215 Ga0068864_100010635 3300005618 Bacteria 7606
216 Ga0068864_100032109 3300005618 Bacteria 4459
217 Ga0068864_100038009 3300005618 Bacteria 4109
218 Ga0068864_100067375 3300005618 Bacteria 3108
219 Ga0068864_100642695 3300005618 Bacteria 1032
220 Ga0068866_10007813 3300005718 Bacteria 4488
221 Ga0068861_100002733 3300005719 Bacteria 11559
222 Ga0068861_100010492 3300005719 Bacteria 6430
223 Ga0068861_100032785 3300005719 Bacteria 3827
224 Ga0068861_100345899 3300005719 Unclassified 1303
225 Ga0068861_100350611 3300005719 Unclassified 1295
226 Ga0068861_100455362 3300005719 Bacteria 1147
227 Ga0068851_10010255 3300005834 Bacteria 4370
228 Ga0068851_10058337 3300005834 Bacteria 1972
229 Ga0068851_10066019 3300005834 Bacteria 1864
230 Ga0068851_10316303 3300005834 Bacteria 901
231 Ga0068851_10330303 3300005834 Bacteria 883
232 Ga0068870_10079774 3300005840 Bacteria 1807
233 Ga0068870_10240716 3300005840 Bacteria 1117
234 Ga0068863_100003603 3300005841 Bacteria 15292
235 Ga0068863_100032574 3300005841 Bacteria 4967
236 Ga0068863_100047003 3300005841 Bacteria 4096
237 Ga0068863_100048863 3300005841 Bacteria 4011
238 Ga0068863_100435998 3300005841 Bacteria 1284
239 Ga0068858_100000706 3300005842 Bacteria 34864
240 Ga0068858_100006509 3300005842 Bacteria 11371
241 Ga0068858_100113258 3300005842 Bacteria 2533
242 Ga0068860_100001120 3300005843 Bacteria 29509
243 Ga0068860_100003193 3300005843 Bacteria 16915
244 Ga0068860_100287971 3300005843 Bacteria 1607
245 Ga0068862_100003221 3300005844 Bacteria 14133
246 Ga0068862_100030817 3300005844 Bacteria 4522
247 Ga0070715_10035495 3300006163 Bacteria 2051
248 Ga0097621_100001636 3300006237 Bacteria 15349
249 Ga0097621_100013418 3300006237 Bacteria 6107
250 Ga0097621_100018327 3300006237 Bacteria 5343
251 Ga0097621_100101955 3300006237 Bacteria 2416
252 Ga0097621_100192721 3300006237 Bacteria 1766
253 Ga0097621_100520452 3300006237 Unclassified 1080
254 Ga0097621_100687831 3300006237 Bacteria 941
255 Ga0068871_100020437 3300006358 Bacteria 5073
256 Ga0068871_100036458 3300006358 Bacteria 3916
257 Ga0068871_100037956 3300006358 Bacteria 3844
258 Ga0068871_100163842 3300006358 Bacteria 1902
259 Ga0068871_100177596 3300006358 Bacteria 1828
260 Ga0068871_100202142 3300006358 Bacteria 1716
261 Ga0068871_100216113 3300006358 Bacteria 1659
262 Ga0068871_100488428 3300006358 Bacteria 1108
263 Ga0068871_100879489 3300006358 Bacteria 829
264 Ga0075428_100069625 3300006844 Bacteria 3846
265 Ga0075430_100179756 3300006846 Bacteria 1760
266 Ga0075430_100578789 3300006846 Unclassified 926
267 Ga0075430_100876098 3300006846 Bacteria 740
268 Ga0075431_100190304 3300006847 Bacteria 2102
269 Ga0075433_10226926 3300006852 Bacteria 1659
270 Ga0075429_100015568 3300006880 Bacteria 6590
271 Ga0068865_100026644 3300006881 Bacteria 3813
272 Ga0068865_100041458 3300006881 Bacteria 3133
273 Ga0068865_100284952 3300006881 Bacteria 1317
274 Ga0068865_100405415 3300006881 Bacteria 1117
275 Ga0097620_100023534 3300006931 Bacteria 6181
276 Ga0097620_100026646 3300006931 Bacteria 5797
277 Ga0097620_100050987 3300006931 Bacteria 4159
278 Ga0097620_100097159 3300006931 Bacteria 2998
279 Ga0099795_10000006 3300007788 Bacteria 107533
280 Ga0105240_10013616 3300009093 Bacteria 11157
281 Ga0105240_10044669 3300009093 Bacteria 5627
282 Ga0105240_10211645 3300009093 Bacteria 2265
283 Ga0111539_10078588 3300009094 Bacteria 3881
284 Ga0111539_10282691 3300009094 Unclassified 1931
285 Ga0111539_10290795 3300009094 Bacteria 1901
286 Ga0105245_10032747 3300009098 Bacteria 4602
287 Ga0105245_10385020 3300009098 Bacteria 1397
288 Ga0105245_10834790 3300009098 Bacteria 961
289 Ga0105247_10006658 3300009101 Bacteria 7133
290 Ga0114129_10334039 3300009147 Bacteria 2011
291 Ga0114129_11721113 3300009147 Bacteria 764
292 Ga0105243_10007140 3300009148 Bacteria 8588
293 Ga0105243_10032070 3300009148 Bacteria 4056
294 Ga0105243_10110601 3300009148 Bacteria 2298
295 Ga0105243_10485965 3300009148 Bacteria 1166
296 Ga0105241_10236822 3300009174 Bacteria 1541
297 Ga0105241_10644894 3300009174 Bacteria 961
298 Ga0105242_10011996 3300009176 Bacteria 6673
299 Ga0105242_10379549 3300009176 Bacteria 1313
300 Ga0105248_10001553 3300009177 Bacteria 25567
301 Ga0105248_10027988 3300009177 Bacteria 6277
302 Ga0105248_10040078 3300009177 Bacteria 5250
303 Ga0105248_10052440 3300009177 Bacteria 4577
304 Ga0105248_10058842 3300009177 Bacteria 4315
305 Ga0105248_10813815 3300009177 Bacteria 1054
306 Ga0105248_11022252 3300009177 Bacteria 934
307 Ga0105237_10145027 3300009545 Unclassified 2369
308 Ga0105237_10371448 3300009545 Bacteria 1435
309 Ga0105238_10018009 3300009551 Bacteria 7181
310 Ga0105238_10062506 3300009551 Bacteria 3724
311 Ga0105238_10086551 3300009551 Bacteria 3121
312 Ga0105238_10293578 3300009551 Bacteria 1608
313 Ga0105249_10002429 3300009553 Bacteria 16169
314 Ga0105249_10028091 3300009553 Bacteria 5078
315 Ga0105249_10048731 3300009553 Bacteria 3862
316 Ga0105249_10086026 3300009553 Bacteria 2931
317 Ga0099796_10000002 3300010159 Bacteria 105502
318 Ga0105239_10069311 3300010375 Bacteria 3875
319 Ga0105239_10152213 3300010375 Bacteria 2582
320 Ga0105239_10189179 3300010375 Unclassified 2304
321 Ga0105239_10326044 3300010375 Bacteria 1732
322 Ga0105246_10028329 3300011119 Bacteria 3679
323 Ga0105246_10110358 3300011119 Unclassified 2020
324 Ga0105246_10162928 3300011119 Bacteria 1700
325 Ga0157373_10048900 3300013100 Bacteria 3015
326 Ga0157371_10199113 3300013102 Bacteria 1435
327 Ga0157371_10225124 3300013102 Bacteria 1347
328 Ga0157370_10699026 3300013104 Bacteria 925
329 Ga0157369_10006458 3300013105 Bacteria 13592
330 Ga0157374_10043374 3300013296 Bacteria 4155
331 Ga0157374_10047423 3300013296 Bacteria 3984
332 Ga0157374_10105626 3300013296 Bacteria 2705
333 Ga0157374_11362820 3300013296 Bacteria 732
334 Ga0157378_10079109 3300013297 Bacteria 2968
335 Ga0157378_10211249 3300013297 Bacteria 1840
336 Ga0157378_11123775 3300013297 Unclassified 823
337 Ga0163162_10001736 3300013306 Bacteria 20427
338 Ga0163162_10006479 3300013306 Bacteria 11334
339 Ga0163162_10045241 3300013306 Bacteria 4410
340 Ga0163162_10205594 3300013306 Bacteria 2098
341 Ga0163162_10252530 3300013306 Bacteria 1895
342 Ga0163162_10262950 3300013306 Bacteria 1857
343 Ga0163162_11041591 3300013306 Bacteria 926
344 Ga0157372_10004311 3300013307 Bacteria 15205
345 Ga0157372_10239158 3300013307 Bacteria 2107
346 Ga0157372_10913276 3300013307 Bacteria 1018
347 Ga0157372_11231901 3300013307 Bacteria 864
348 Ga0157375_10038848 3300013308 Bacteria 4574
349 Ga0157375_10044007 3300013308 Bacteria 4333
350 Ga0157375_10049760 3300013308 Bacteria 4108
351 Ga0157375_10050576 3300013308 Bacteria 4077
352 Ga0157375_10068703 3300013308 Bacteria 3546
353 Ga0157375_10122308 3300013308 Bacteria 2714
354 Ga0163163_10025084 3300014325 Bacteria 5680
355 Ga0163163_10256911 3300014325 Bacteria 1798
356 Ga0163163_10290711 3300014325 Bacteria 1686
357 Ga0163163_11247739 3300014325 Bacteria 806
358 Ga0157380_10001599 3300014326 Bacteria 14904
359 Ga0157380_10050482 3300014326 Bacteria 3286
360 Ga0157380_10147223 3300014326 Bacteria 2031
361 Ga0157380_10209588 3300014326 Bacteria 1735
362 Ga0157380_10714788 3300014326 Bacteria 1009
363 Ga0157377_10085457 3300014745 Bacteria 1853
364 Ga0157379_10003128 3300014968 Bacteria 14017
365 Ga0157379_10008663 3300014968 Bacteria 8859
366 Ga0157379_10044966 3300014968 Bacteria 3941
367 Ga0157379_10147174 3300014968 Bacteria 2124
368 Ga0157379_10371486 3300014968 Bacteria 1311
369 Ga0157379_10386938 3300014968 Bacteria 1284
370 Ga0157379_10702184 3300014968 Bacteria 949
371 Ga0157376_10007545 3300014969 Bacteria 7775
372 Ga0157376_10011251 3300014969 Bacteria 6587
373 Ga0157376_10217578 3300014969 Bacteria 1767
374 Ga0182005_1063295 3300015265 Bacteria 1011
375 Ga0163161_10005670 3300017792 Bacteria 8654
376 Ga0163161_10010685 3300017792 Bacteria 6356
377 Ga0163161_10229284 3300017792 Bacteria 1441
378 Ga0163161_10367232 3300017792 Bacteria 1147
379 Ga0213872_10005893 3300021361 Bacteria 6217
380 Ga0213876_10227232 3300021384 Bacteria 992
381 Ga0209646_1000036 3300025246 Bacteria 358864
382 Ga0209564_1000060 3300025295 Bacteria 325890
383 Ga0207697_10034710 3300025315 Bacteria 2065
384 Ga0207656_10013515 3300025321 Bacteria 3123
385 Ga0207656_10033925 3300025321 Bacteria 2128
386 Ga0207656_10057160 3300025321 Bacteria 1702
387 Ga0207682_10011095 3300025893 Bacteria 3527
388 Ga0207682_10016998 3300025893 Bacteria 2841
389 Ga0207682_10037315 3300025893 Bacteria 1968
390 Ga0207682_10055002 3300025893 Bacteria 1654
391 Ga0207682_10121372 3300025893 Bacteria 1159
392 Ga0207642_10000866 3300025899 Bacteria 9433
393 Ga0207710_10064516 3300025900 Bacteria 1668
394 Ga0207688_10031743 3300025901 Bacteria 2917
395 Ga0207688_10060996 3300025901 Bacteria 2125
396 Ga0207688_10074719 3300025901 Bacteria 1928
397 Ga0207680_10003366 3300025903 Bacteria 7533
398 Ga0207680_10021441 3300025903 Bacteria 3496
399 Ga0207680_10033491 3300025903 Bacteria 2931
400 Ga0207680_10098543 3300025903 Bacteria 1874
401 Ga0207685_10093237 3300025905 Bacteria 1272
402 Ga0207699_10219752 3300025906 Bacteria 1296
403 Ga0207645_10007187 3300025907 Bacteria 7894
404 Ga0207645_10014105 3300025907 Bacteria 5355
405 Ga0207645_10031132 3300025907 Bacteria 3434
406 Ga0207645_10170865 3300025907 Bacteria 1425
407 Ga0207645_10267895 3300025907 Bacteria 1132
408 Ga0207645_10299996 3300025907 Bacteria 1069
409 Ga0207643_10043981 3300025908 Bacteria 2521
410 Ga0207643_10280804 3300025908 Bacteria 1032
411 Ga0207705_10021140 3300025909 Bacteria 4642
412 Ga0207705_10110840 3300025909 Bacteria 2028
413 Ga0207705_10140905 3300025909 Bacteria 1801
414 Ga0207705_10514307 3300025909 Bacteria 930
415 Ga0207654_10382660 3300025911 Bacteria 975
416 Ga0207707_10002267 3300025912 Bacteria 17404
417 Ga0207707_10063548 3300025912 Bacteria 3213
418 Ga0207707_10317569 3300025912 Bacteria 1345
419 Ga0207695_10180741 3300025913 Bacteria 2030
420 Ga0207695_10221692 3300025913 Bacteria 1798
421 Ga0207695_10261500 3300025913 Unclassified 1628
422 Ga0207662_10008276 3300025918 Bacteria 5693
423 Ga0207662_10147754 3300025918 Bacteria 1493
424 Ga0207662_10577557 3300025918 Unclassified 780
425 Ga0207657_10015200 3300025919 Bacteria 7469
426 Ga0207657_10124888 3300025919 Bacteria 2114
427 Ga0207657_10196441 3300025919 Bacteria 1625
428 Ga0207657_10333700 3300025919 Bacteria 1197
429 Ga0207657_10454563 3300025919 Bacteria 1005
430 Ga0207657_10896725 3300025919 Unclassified 683
431 Ga0207649_10009233 3300025920 Bacteria 5392
432 Ga0207649_10107200 3300025920 Bacteria 1860
433 Ga0207649_10278359 3300025920 Bacteria 1215
434 Ga0207649_10309546 3300025920 Bacteria 1157
435 Ga0207652_10020480 3300025921 Bacteria 5447
436 Ga0207681_10000171 3300025923 Bacteria 54094
437 Ga0207681_10018882 3300025923 Unclassified 4348
438 Ga0207681_10216904 3300025923 Unclassified 1478
439 Ga0207681_10301089 3300025923 Bacteria 1269
440 Ga0207694_10043794 3300025924 Bacteria 3455
441 Ga0207694_10188829 3300025924 Bacteria 1673
442 Ga0207694_11226878 3300025924 Bacteria 634
443 Ga0207650_10007367 3300025925 Bacteria 7487
444 Ga0207650_10027370 3300025925 Bacteria 4081
445 Ga0207650_10176818 3300025925 Bacteria 1699
446 Ga0207650_10186763 3300025925 Bacteria 1654
447 Ga0207650_10204731 3300025925 Bacteria 1582
448 Ga0207650_10427994 3300025925 Bacteria 1099
449 Ga0207659_10013463 3300025926 Bacteria 5240
450 Ga0207659_10014800 3300025926 Bacteria 5041
451 Ga0207659_10023363 3300025926 Bacteria 4125
452 Ga0207659_10124384 3300025926 Bacteria 1981
453 Ga0207659_10130935 3300025926 Bacteria 1936
454 Ga0207659_10146664 3300025926 Bacteria 1838
455 Ga0207659_10408841 3300025926 Bacteria 1136
456 Ga0207687_10012355 3300025927 Bacteria 5583
457 Ga0207687_10051263 3300025927 Bacteria 2876
458 Ga0207687_10077095 3300025927 Bacteria 2396
459 Ga0207687_10295187 3300025927 Bacteria 1304
460 Ga0207687_10428778 3300025927 Bacteria 1093
461 Ga0207644_10031579 3300025931 Bacteria 3691
462 Ga0207644_10065198 3300025931 Bacteria 2648
463 Ga0207644_10066677 3300025931 Bacteria 2621
464 Ga0207644_10178088 3300025931 Bacteria 1665
465 Ga0207644_10241484 3300025931 Bacteria 1438
466 Ga0207690_10071251 3300025932 Bacteria 2396
467 Ga0207690_10156824 3300025932 Unclassified 1693
468 Ga0207690_10212306 3300025932 Bacteria 1476
469 Ga0207690_10299171 3300025932 Bacteria 1258
470 Ga0207706_10010501 3300025933 Bacteria 8463
471 Ga0207706_10061328 3300025933 Bacteria 3312
472 Ga0207706_10112925 3300025933 Bacteria 2390
473 Ga0207706_10168132 3300025933 Bacteria 1927
474 Ga0207706_10286157 3300025933 Unclassified 1437
475 Ga0207706_10331286 3300025933 Bacteria 1324
476 Ga0207686_10037216 3300025934 Bacteria 2935
477 Ga0207686_10175634 3300025934 Bacteria 1515
478 Ga0207686_10209767 3300025934 Bacteria 1400
479 Ga0207686_10502980 3300025934 Bacteria 940
480 Ga0207709_10006175 3300025935 Bacteria 6747
481 Ga0207709_10340996 3300025935 Bacteria 1128
482 Ga0207709_10386798 3300025935 Bacteria 1066
483 Ga0207670_10007811 3300025936 Bacteria 6002
484 Ga0207670_10105161 3300025936 Bacteria 2023
485 Ga0207670_10189251 3300025936 Bacteria 1556
486 Ga0207670_10236042 3300025936 Bacteria 1406
487 Ga0207669_10002887 3300025937 Bacteria 7371
488 Ga0207669_10018562 3300025937 Bacteria 3599
489 Ga0207669_10023334 3300025937 Bacteria 3303
490 Ga0207669_10318432 3300025937 Bacteria 1189
491 Ga0207704_10025551 3300025938 Bacteria 3224
492 Ga0207704_10029525 3300025938 Bacteria 3060
493 Ga0207704_10053603 3300025938 Unclassified 2453
494 Ga0207704_10230418 3300025938 Bacteria 1377
495 Ga0207704_10723516 3300025938 Bacteria 826
496 Ga0207665_10289659 3300025939 Bacteria 1221
497 Ga0207691_10006925 3300025940 Bacteria 10933
498 Ga0207691_10007999 3300025940 Bacteria 10167
499 Ga0207691_10008398 3300025940 Bacteria 9924
500 Ga0207691_10054100 3300025940 Bacteria 3662
501 Ga0207691_10063052 3300025940 Bacteria 3362
502 Ga0207691_10067308 3300025940 Bacteria 3238
503 Ga0207691_10095765 3300025940 Bacteria 2654
504 Ga0207691_10137151 3300025940 Bacteria 2157
505 Ga0207691_10265130 3300025940 Bacteria 1480
506 Ga0207691_10285647 3300025940 Bacteria 1419
507 Ga0207691_10369541 3300025940 Bacteria 1225
508 Ga0207711_10008247 3300025941 Bacteria 8723
509 Ga0207711_10017527 3300025941 Bacteria 5950
510 Ga0207711_10028959 3300025941 Bacteria 4667
511 Ga0207711_10029218 3300025941 Bacteria 4647
512 Ga0207711_10214589 3300025941 Bacteria 1758
513 Ga0207711_10267096 3300025941 Bacteria 1573
514 Ga0207689_10015077 3300025942 Bacteria 6552
515 Ga0207689_10024306 3300025942 Bacteria 5084
516 Ga0207689_10028063 3300025942 Bacteria 4708
517 Ga0207661_10536286 3300025944 Bacteria 1071
518 Ga0207679_10212655 3300025945 Bacteria 1622
519 Ga0207679_10353722 3300025945 Unclassified 1281
520 Ga0207679_10426049 3300025945 Bacteria 1172
521 Ga0207667_10679931 3300025949 Bacteria 1033
522 Ga0207651_10010246 3300025960 Bacteria 5184
523 Ga0207651_10160253 3300025960 Bacteria 1763
524 Ga0207651_10178474 3300025960 Bacteria 1682
525 Ga0207712_10027382 3300025961 Bacteria 3806
526 Ga0207712_10031394 3300025961 Bacteria 3578
527 Ga0207712_10033244 3300025961 Unclassified 3485
528 Ga0207712_10059422 3300025961 Bacteria 2706
529 Ga0207712_10327627 3300025961 Unclassified 1266
530 Ga0207668_10006130 3300025972 Bacteria 7095
531 Ga0207668_10049696 3300025972 Bacteria 2884
532 Ga0207640_10187382 3300025981 Bacteria 1557
533 Ga0207640_10401200 3300025981 Unclassified 1117
534 Ga0207658_10002612 3300025986 Bacteria 13087
535 Ga0207658_10016767 3300025986 Bacteria 5041
536 Ga0207658_10138670 3300025986 Bacteria 1965
537 Ga0207658_10532565 3300025986 Unclassified 1049
538 Ga0207677_10010303 3300026023 Bacteria 5287
539 Ga0207677_10031594 3300026023 Bacteria 3393
540 Ga0207677_10032849 3300026023 Bacteria 3340
541 Ga0207677_10035935 3300026023 Bacteria 3223
542 Ga0207677_10061326 3300026023 Bacteria 2604
543 Ga0207677_10277007 3300026023 Bacteria 1375
544 Ga0207677_10707492 3300026023 Bacteria 894
545 Ga0207703_10003546 3300026035 Bacteria 13050
546 Ga0207703_10050435 3300026035 Bacteria 3368
547 Ga0207703_10298156 3300026035 Bacteria 1469
548 Ga0207639_10287373 3300026041 Bacteria 1449
549 Ga0207678_10183935 3300026067 Bacteria 1785
550 Ga0207678_10261291 3300026067 Bacteria 1484
551 Ga0207708_10008786 3300026075 Bacteria 7478
552 Ga0207708_10089890 3300026075 Unclassified 2367
553 Ga0207708_10249580 3300026075 Bacteria 1430
554 Ga0207708_10387341 3300026075 Bacteria 1153
555 Ga0207702_10540309 3300026078 Bacteria 1139
556 Ga0207702_10551612 3300026078 Bacteria 1127
557 Ga0207641_10000796 3300026088 Bacteria 33682
558 Ga0207641_10026958 3300026088 Bacteria 4745
559 Ga0207641_10068865 3300026088 Bacteria 3035
560 Ga0207641_10212776 3300026088 Bacteria 1788
561 Ga0207641_10513208 3300026088 Bacteria 1165
562 Ga0207648_10022733 3300026089 Bacteria 5627
563 Ga0207648_10033175 3300026089 Bacteria 4554
564 Ga0207648_10062987 3300026089 Bacteria 3233
565 Ga0207648_10105813 3300026089 Bacteria 2468
566 Ga0207648_10128117 3300026089 Bacteria 2233
567 Ga0207648_10154299 3300026089 Bacteria 2027
568 Ga0207648_10255583 3300026089 Bacteria 1562
569 Ga0207676_10003531 3300026095 Bacteria 11065
570 Ga0207676_10006670 3300026095 Bacteria 8163
571 Ga0207676_10038062 3300026095 Bacteria 3669
572 Ga0207676_10048021 3300026095 Bacteria 3311
573 Ga0207676_10058494 3300026095 Bacteria 3041
574 Ga0207676_10278638 3300026095 Bacteria 1517
575 Ga0207676_10814469 3300026095 Bacteria 912
576 Ga0207674_10005982 3300026116 Bacteria 14402
577 Ga0207674_10066071 3300026116 Bacteria 3644
578 Ga0207674_10074222 3300026116 Bacteria 3414
579 Ga0207674_10466081 3300026116 Bacteria 1221
580 Ga0207675_100001182 3300026118 Bacteria 25984
581 Ga0207675_100022597 3300026118 Bacteria 5855
582 Ga0207675_100185235 3300026118 Bacteria 1995
583 Ga0207675_100358122 3300026118 Bacteria 1431
584 Ga0207675_100590679 3300026118 Bacteria 1113
585 Ga0207683_10000909 3300026121 Bacteria 27226
586 Ga0207683_10033526 3300026121 Bacteria 4461
587 Ga0207683_10053357 3300026121 Bacteria 3544
588 Ga0207683_10074102 3300026121 Bacteria 3012
589 Ga0207683_10087142 3300026121 Bacteria 2776
590 Ga0207683_10095227 3300026121 Bacteria 2654
591 Ga0207683_10129869 3300026121 Bacteria 2266
592 Ga0207683_10244876 3300026121 Bacteria 1635
593 Ga0207683_10363660 3300026121 Bacteria 1329
594 Ga0207698_10001718 3300026142 Bacteria 12770
595 Ga0207698_10445640 3300026142 Bacteria 1248
596 Ga0209179_1000004 3300027512 Bacteria 115114
597 Ga0207428_10176797 3300027907 Unclassified 1614
598 Ga0207428_10333476 3300027907 Bacteria 1118
599 Ga0268266_10009125 3300028379 Bacteria 8750
600 Ga0268266_10015150 3300028379 Bacteria 6620
601 Ga0268265_10001215 3300028380 Bacteria 22391
602 Ga0268265_10001640 3300028380 Bacteria 18334
603 Ga0268265_10027480 3300028380 Bacteria 4062
604 Ga0268265_10292350 3300028380 Bacteria 1463
605 Ga0268264_10008504 3300028381 Bacteria 8531
606 Ga0268264_10018941 3300028381 Bacteria 5628
607 Ga0268264_10271918 3300028381 Bacteria 1583
608 Ga0268264_10367253 3300028381 Bacteria 1374
609 Ga0307405_10002742 3300031731 Bacteria 7892
610 Ga0307413_10199397 3300031824 Bacteria 1444
611 Ga0307412_10031016 3300031911 Bacteria 3372
612 Ga0307409_100002835 3300031995 Bacteria 9169
613 Ga0307416_100000242 3300032002 Bacteria 29019
614 Ga0307411_10019900 3300032005 Bacteria 3889
615 Ga0307415_100009666 3300032126 Bacteria 5422
616 Ga0307510_10047560 3300033180 Bacteria 4594
617 Ga0373958_0052842 3300034819 Bacteria 862
618 Ga0373960_0101841 3300035121 Bacteria 932
619 Ga0373955_0010347 3300035172 Bacteria 4401
620 Ga0373924_0326344 3300035410 Bacteria 683
621 Ga0373931_0033409 3300035691 Bacteria 2666
622 Ga0373935_0039876 3300035692 Bacteria 2945
623 Ga0373935_0184737 3300035692 Bacteria 1433
624 Ga0373947_0040033 3300035725 Bacteria 2791
625 Ga0373937_0005598 3300036401 Bacteria 10783
626 Ga0373937_0070101 3300036401 Bacteria 3233
627 Ga0373937_0090182 3300036401 Bacteria 2839
628 Ga0373925_0052198 3300037068 Bacteria 3055
629 Ga0395900_0701217 3300037418 Unclassified 946
630 Ga0395905_0004772 3300037471 Bacteria 14010
631 Ga0436365_1791604 3300039437 Bacteria 2125
632 Ga0436361_0457442 3300039447 Bacteria 41321
633 Ga0436361_0790016 3300039447 Bacteria 69776
634 Ga0436361_1008864 3300039447 Bacteria 1482
635 Ga0451800_0311007 3300041459 Unclassified 677
636 Ga0439449_0006995 3300042007 Bacteria 4299
637 Ga0439450_076521 3300042008 Unclassified 827
638 Ga0439459_0050124 3300042438 Unclassified 914
639 Ga0466972_0001345 3300044658 Bacteria 11909
640 Ga0466965_0054292 3300044683 Bacteria 1992
641 Ga0466966_0020646 3300044684 Bacteria 4328
642 Ga0466966_0082476 3300044684 Bacteria 2001
643 Ga0466961_0148887 3300044693 Bacteria 1462
644 Ga0466957_0034909 3300044842 Bacteria 3017
645 Ga0451576_0455957 3300045051 Bacteria 1342
646 Ga0466958_0295494 3300045836 Unclassified 1039
647 Ga0466967_0409302 3300045976 Bacteria 1321
648 Ga0495592_0045977 3300046454 Bacteria 3255
649 Ga0495603_0121617 3300046455 Bacteria 1521
650 Ga0495603_0346943 3300046455 Bacteria 852
651 Ga0495629_0033043 3300046459 Bacteria 3661
652 Ga0495653_0080493 3300046463 Bacteria 2410
653 Ga0495605_0001520 3300046474 Bacteria 15053
654 Ga0495664_0093210 3300046477 Bacteria 1812
655 Ga0495594_0369832 3300046499 Bacteria 816
656 Ga0495607_0001098 3300046501 Bacteria 24621
657 Ga0495610_0001937 3300046512 Bacteria 17835
658 Ga0495610_0009178 3300046512 Bacteria 6283
659 Ga0495616_0000198 3300046513 Bacteria 49991
660 Ga0495618_0257688 3300046514 Bacteria 1093
661 Ga0495618_0301999 3300046514 Bacteria 995
662 Ga0495628_0032900 3300046516 Bacteria 4182
663 Ga0495628_0749470 3300046516 Bacteria 686
664 Ga0495630_0550185 3300046517 Bacteria 885
665 Ga0495630_0799989 3300046517 Bacteria 720
666 Ga0495643_0000420 3300046522 Bacteria 55396
667 Ga0495598_0006314 3300046537 Bacteria 2673
668 Ga0495609_0000046 3300046538 Bacteria 158102
669 Ga0495609_0019678 3300046538 Bacteria 3121
670 Ga0495621_0042688 3300046539 Bacteria 1597
671 Ga0495621_0065173 3300046539 Bacteria 1330
672 Ga0495645_0011480 3300046543 Bacteria 6234
673 Ga0495645_0020949 3300046543 Bacteria 4724
674 Ga0495633_0001876 3300046558 Bacteria 15349
675 Ga0495667_0013247 3300046559 Bacteria 5584
676 Ga0495656_0009909 3300046615 Bacteria 3445
677 Ga0495625_0083676 3300046660 Bacteria 2217
678 Ga0495635_0088332 3300046663 Bacteria 2121
679 Ga0495635_0234366 3300046663 Bacteria 1239
680 Ga0495635_0663929 3300046663 Bacteria 678
681 Ga0495661_0000393 3300046665 Bacteria 46663
682 Ga0495661_0039787 3300046665 Bacteria 2919
683 Ga0495657_0041973 3300046675 Bacteria 3127
684 Ga0495599_0000714 3300046678 Bacteria 18751
685 Ga0495623_0021518 3300046679 Bacteria 4164
686 Ga0495658_0004319 3300046683 Bacteria 7001
687 Ga0495658_0184706 3300046683 Bacteria 1294
688 Ga0495658_0194600 3300046683 Bacteria 1262
689 Ga0495670_0205851 3300046691 Bacteria 1043
690 Ga0495649_0001668 3300046694 Bacteria 16496
691 Ga0495589_0000039 3300046794 Bacteria 148833
692 Ga0495600_0053303 3300046809 Bacteria 2642
693 Ga0495600_0059866 3300046809 Bacteria 2487
694 Ga0495600_0146262 3300046809 Bacteria 1532
695 Ga0495636_0106062 3300047318 Bacteria 1232
696 Ga0495672_0000483 3300047320 Bacteria 47007
697 Ga0495680_0109385 3300047322 Bacteria 2050
698 Ga0495687_000008 3300047443 Bacteria 546666
699 Ga0495675_0130066 3300047444 Bacteria 1565
700 Ga0495677_0000008 3300047445 Bacteria 175183
701 Ga0495684_0065180 3300047471 Bacteria 2769
702 Ga0495626_0002359 3300048091 Bacteria 13270
703 Ga0496100_0068009 3300048903 Bacteria 2368
704 Ga0496104_0023575 3300048907 Bacteria 5659
705 Ga0496104_0290522 3300048907 Bacteria 1547
706 Ga0496104_0356027 3300048907 Bacteria 1376
707 Ga0496104_0366790 3300048907 Bacteria 1352
708 Ga0496105_0042325 3300048908 Bacteria 3754
709 Ga0496105_0333791 3300048908 Bacteria 1213
710 Ga0496106_0177892 3300048909 Bacteria 1688
711 Ga0496106_0257933 3300048909 Bacteria 1395
712 Ga0496106_0399770 3300048909 Bacteria 1104
713 Ga0496106_0445511 3300048909 Bacteria 1040
714 Ga0496107_0008126 3300048910 Bacteria 7255
715 Ga0496107_0451657 3300048910 Bacteria 955
716 Ga0496107_0938310 3300048910 Bacteria 630
717 Ga0496108_0093603 3300048911 Bacteria 2557
718 Ga0496108_0151242 3300048911 Bacteria 2003
719 Ga0496108_0155725 3300048911 Bacteria 1973
720 Ga0496108_0306007 3300048911 Bacteria 1385
721 Ga0496108_0496117 3300048911 Bacteria 1066
722 Ga0496109_0073910 3300048912 Bacteria 3133
723 Ga0496109_0208141 3300048912 Bacteria 1839
724 Ga0496109_0242166 3300048912 Bacteria 1697
725 Ga0496109_0506801 3300048912 Bacteria 1139
726 Ga0496109_0844877 3300048912 Bacteria 853
727 Ga0496110_0080945 3300048913 Bacteria 2895
728 Ga0496110_1065534 3300048913 Bacteria 716
729 Ga0496112_0019530 3300048915 Bacteria 6397
730 Ga0496112_0308677 3300048915 Bacteria 1527
731 Ga0496113_0025673 3300048916 Bacteria 4203
732 Ga0496114_0042220 3300048917 Bacteria 3780
733 Ga0496115_0243576 3300048918 Bacteria 1482
734 Ga0495678_000347 3300049459 Bacteria 48195
735 nmdc:mga09592_13511_c1 3300050508 Bacteria 6669
736 nmdc:mga0qj67_51370_c1 3300050509 Bacteria 3260
737 nmdc:mga0qj67_540433_c1 3300050509 Unclassified 935
738 nmdc:mga0qj67_665425_c1 3300050509 Bacteria 830
739 nmdc:mga08y16_109547_c1 3300050511 Unclassified 2875
740 nmdc:mga08y16_190598_c1 3300050511 Bacteria 2127
741 nmdc:mga0n895_1221364_c1 3300050512 Bacteria 725
742 nmdc:mga0a205_179342_c1 3300050515 Bacteria 2012
743 nmdc:mga0a205_93135_c1 3300050515 Bacteria 2130
744 Ga0495601_0055081 3300053077 Bacteria 2517
745 Ga0495612_0101437 3300053078 Bacteria 1226
746 Ga0495619_0012812 3300053085 Bacteria 5281
747 Ga0495619_0041567 3300053085 Bacteria 3008
748 Ga0500618_025419 3300053125 Bacteria 1420
749 Ga0500559_0393883 3300053136 Bacteria 645
750 Ga0500586_000110 3300053145 Bacteria 14509
751 Ga0395905_0047099
752 JGI25154J39366_1001051
753 Ga0055526_1000096
754 Ga0065712_10068423
755 Ga0065715_10123944
756 Ga0070658_10006171
757 Ga0070658_10019394
758 Ga0070658_10027035
759 Ga0070658_10180848
760 Ga0070676_10005962
761 Ga0070676_10006479
762 Ga0070676_10012439
763 Ga0070676_10023171
764 Ga0070676_10156583
765 Ga0070676_10227940
766 Ga0070683_100023119
767 Ga0070683_100076257
768 Ga0070683_100174541
769 Ga0070690_100005995
770 Ga0070690_100007120
771 Ga0070690_100023355
772 Ga0070670_100045210
773 Ga0070670_100062193
774 Ga0070670_100080084
775 Ga0070670_100101251
776 Ga0070670_100101647
777 Ga0070670_100210530
778 Ga0070670_100387101
779 Ga0070670_100491926
780 Ga0070677_10003964
781 Ga0070677_10011663
782 Ga0070677_10092371
783 Ga0070677_10094618
784 Ga0070677_10127538
785 Ga0070677_10181462
786 Ga0070677_10353892
787 Ga0068869_100025109
788 Ga0068869_100183461
789 Ga0068869_100235800
790 Ga0070666_10001894
791 Ga0070666_10029829
792 Ga0070666_10038549
793 Ga0070666_10107359
794 Ga0070680_100402042
795 Ga0070680_100604539
796 Ga0070680_100814219
797 Ga0068868_100009490
798 Ga0068868_100018924
799 Ga0068868_100046902
800 Ga0068868_100072652
801 Ga0068868_100081048
802 Ga0068868_100691571
803 Ga0070660_100158017
804 Ga0070660_100373919
805 Ga0070660_100575311
806 Ga0070689_100088769
807 Ga0070689_100114249
808 Ga0070687_100003640
809 Ga0070687_100035262
810 Ga0070687_100651553
811 Ga0070661_100002816
812 Ga0070661_100007147
813 Ga0070661_100029339
814 Ga0070661_100095157
815 Ga0070661_100155744
816 Ga0070661_100328610
817 Ga0070692_10193369
818 Ga0070692_10334657
819 Ga0070692_10486991
820 Ga0070668_100006308
821 Ga0070668_100024365
822 Ga0070668_100070462
823 Ga0070668_100118739
824 Ga0070668_100265798
825 Ga0070669_100001930
826 Ga0070669_100035028
827 Ga0070669_100065607
828 Ga0070669_100276688
829 Ga0070669_100409138
830 Ga0070669_100824007
831 Ga0070675_100001176
832 Ga0070675_100010618
833 Ga0070675_100014052
834 Ga0070675_100033225
835 Ga0070675_100034446
836 Ga0070675_100036777
837 Ga0070675_100164067
838 Ga0070675_100211077
839 Ga0070675_100269910
840 Ga0070675_100368556
841 Ga0070675_100770589
842 Ga0070671_100012077
843 Ga0070671_100016912
844 Ga0070671_100095170
845 Ga0070671_100139314
846 Ga0070671_100334719
847 Ga0070674_100008210
848 Ga0070674_100063057
849 Ga0070674_100113347
850 Ga0070674_100115915
851 Ga0070673_100002554
852 Ga0070673_100009673
853 Ga0070673_100032222
854 Ga0070673_100061777
855 Ga0070673_100101191
856 Ga0070673_100106139
857 Ga0070673_100187279
858 Ga0070673_100261901
859 Ga0070673_100407744
860 Ga0070688_100111110
861 Ga0070688_100313006
862 Ga0070688_100406409
863 Ga0070659_100015991
864 Ga0070659_100057885
865 Ga0070659_100084372
866 Ga0070659_100097877
867 Ga0070659_100246075
868 Ga0070667_100007889
869 Ga0070667_100027330
870 Ga0070667_100093553
871 Ga0070667_100540170
872 Ga0070709_10002864
873 Ga0070701_10117964
874 Ga0070700_100049328
875 Ga0070700_100439849
876 Ga0070678_100030416
877 Ga0070678_100051457
878 Ga0070678_100055418
879 Ga0070678_100118657
880 Ga0070678_100133451
881 Ga0070678_100304915
882 Ga0070678_100314319
883 Ga0070678_100375372
884 Ga0070662_100003354
885 Ga0070662_100005934
886 Ga0070662_100214975
887 Ga0070662_100259581
888 Ga0070662_100337678
889 Ga0070662_100394167
890 Ga0070662_100529194
891 Ga0070681_10002332
892 Ga0070681_10245485
893 Ga0068867_100018416
894 Ga0068867_100031143
895 Ga0068867_100070011
896 Ga0068867_100344917
897 Ga0068867_100405854
898 Ga0070685_10082165
899 Ga0070685_10379493
900 Ga0070679_100028309
901 Ga0070684_100039840
902 Ga0070684_100068182
903 Ga0070684_100324270
904 Ga0070684_100441089
905 Ga0070684_100838654
906 Ga0068853_100050235
907 Ga0068853_100050380
908 Ga0068853_100361883
909 Ga0068853_100380685
910 Ga0068853_100955109
911 Ga0070672_100000938
912 Ga0070672_100009263
913 Ga0070672_100027267
914 Ga0070672_100037672
915 Ga0070672_100062333
916 Ga0070672_100121137
917 Ga0070672_100163985
918 Ga0070672_100178932
919 Ga0070672_100211229
920 Ga0070672_100401813
921 Ga0070672_101234102
922 Ga0070686_100052535
923 Ga0070686_100118725
924 Ga0070686_100288586
925 Ga0070695_100022024
926 Ga0070693_100011776
927 Ga0070693_100022414
928 Ga0070693_100197810
929 Ga0070693_100500082
930 Ga0070665_100034729
931 Ga0070665_100051590
932 Ga0070665_100060162
933 Ga0070665_100093445
934 Ga0070665_100676809
935 Ga0070704_100329572
936 Ga0068855_100173632
937 Ga0068855_100582145
938 Ga0070664_100023731
939 Ga0070664_100065770
940 Ga0070664_100086319
941 Ga0070664_100099142
942 Ga0070664_100112706
943 Ga0070664_100115125
944 Ga0070664_100177776
945 Ga0068857_100148769
946 Ga0068857_100165718
947 Ga0068854_100020832
948 Ga0068856_100185959
949 Ga0068856_101422499
950 Ga0070702_100003108
951 Ga0070702_100008222
952 Ga0068852_100007768
953 Ga0068852_100021050
954 Ga0068852_100021896
955 Ga0068852_100263920
956 Ga0068852_100567948
957 Ga0068852_100637777
958 Ga0068852_100947900
959 Ga0068859_100023535
960 Ga0068859_100026646
961 Ga0068859_100050989
962 Ga0068859_100097161
963 Ga0068864_100002715
964 Ga0068864_100008666
965 Ga0068864_100010635
966 Ga0068864_100032109
967 Ga0068864_100038009
968 Ga0068864_100067375
969 Ga0068864_100642695
970 Ga0068866_10007813
971 Ga0068861_100002733
972 Ga0068861_100010492
973 Ga0068861_100032785
974 Ga0068861_100345899
975 Ga0068861_100350611
976 Ga0068861_100455362
977 Ga0068851_10010255
978 Ga0068851_10058337
979 Ga0068851_10066019
980 Ga0068851_10316303
981 Ga0068851_10330303
982 Ga0068870_10079774
983 Ga0068870_10240716
984 Ga0068863_100003603
985 Ga0068863_100032574
986 Ga0068863_100047003
987 Ga0068863_100048863
988 Ga0068863_100435998
989 Ga0068858_100000706
990 Ga0068858_100006509
991 Ga0068858_100113258
992 Ga0068860_100001120
993 Ga0068860_100003193
994 Ga0068860_100287971
995 Ga0068862_100003221
996 Ga0068862_100030817
997 Ga0070715_10035495
998 Ga0097621_100001636
999 Ga0097621_100013418
1000 Ga0097621_100018327
1001 Ga0097621_100101955
1002 Ga0097621_100192721
1003 Ga0097621_100520452
1004 Ga0097621_100687831
1005 Ga0068871_100020437
1006 Ga0068871_100036458
1007 Ga0068871_100037956
1008 Ga0068871_100163842
1009 Ga0068871_100177596
1010 Ga0068871_100202142
1011 Ga0068871_100216113
1012 Ga0068871_100488428
1013 Ga0068871_100879489
1014 Ga0075428_100069625
1015 Ga0075430_100179756
1016 Ga0075430_100578789
1017 Ga0075430_100876098
1018 Ga0075431_100190304
1019 Ga0075433_10226926
1020 Ga0075429_100015568
1021 Ga0068865_100026644
1022 Ga0068865_100041458
1023 Ga0068865_100284952
1024 Ga0068865_100405415
1025 Ga0097620_100023534
1026 Ga0097620_100026646
1027 Ga0097620_100050987
1028 Ga0097620_100097159
1029 Ga0099795_10000006
1030 Ga0105240_10013616
1031 Ga0105240_10044669
1032 Ga0105240_10211645
1033 Ga0111539_10078588
1034 Ga0111539_10282691
1035 Ga0111539_10290795
1036 Ga0105245_10032747
1037 Ga0105245_10385020
1038 Ga0105245_10834790
1039 Ga0105247_10006658
1040 Ga0114129_10334039
1041 Ga0114129_11721113
1042 Ga0105243_10007140
1043 Ga0105243_10032070
1044 Ga0105243_10110601
1045 Ga0105243_10485965
1046 Ga0105241_10236822
1047 Ga0105241_10644894
1048 Ga0105242_10011996
1049 Ga0105242_10379549
1050 Ga0105248_10001553
1051 Ga0105248_10027988
1052 Ga0105248_10040078
1053 Ga0105248_10052440
1054 Ga0105248_10058842
1055 Ga0105248_10813815
1056 Ga0105248_11022252
1057 Ga0105237_10145027
1058 Ga0105237_10371448
1059 Ga0105238_10018009
1060 Ga0105238_10062506
1061 Ga0105238_10086551
1062 Ga0105238_10293578
1063 Ga0105249_10002429
1064 Ga0105249_10028091
1065 Ga0105249_10048731
1066 Ga0105249_10086026
1067 Ga0099796_10000002
1068 Ga0105239_10069311
1069 Ga0105239_10152213
1070 Ga0105239_10189179
1071 Ga0105239_10326044
1072 Ga0105246_10028329
1073 Ga0105246_10110358
1074 Ga0105246_10162928
1075 Ga0157373_10048900
1076 Ga0157371_10199113
1077 Ga0157371_10225124
1078 Ga0157370_10699026
1079 Ga0157369_10006458
1080 Ga0157374_10043374
1081 Ga0157374_10047423
1082 Ga0157374_10105626
1083 Ga0157374_11362820
1084 Ga0157378_10079109
1085 Ga0157378_10211249
1086 Ga0157378_11123775
1087 Ga0163162_10001736
1088 Ga0163162_10006479
1089 Ga0163162_10045241
1090 Ga0163162_10205594
1091 Ga0163162_10252530
1092 Ga0163162_10262950
1093 Ga0163162_11041591
1094 Ga0157372_10004311
1095 Ga0157372_10239158
1096 Ga0157372_10913276
1097 Ga0157372_11231901
1098 Ga0157375_10038848
1099 Ga0157375_10044007
1100 Ga0157375_10049760
1101 Ga0157375_10050576
1102 Ga0157375_10068703
1103 Ga0157375_10122308
1104 Ga0163163_10025084
1105 Ga0163163_10256911
1106 Ga0163163_10290711
1107 Ga0163163_11247739
1108 Ga0157380_10001599
1109 Ga0157380_10050482
1110 Ga0157380_10147223
1111 Ga0157380_10209588
1112 Ga0157380_10714788
1113 Ga0157377_10085457
1114 Ga0157379_10003128
1115 Ga0157379_10008663
1116 Ga0157379_10044966
1117 Ga0157379_10147174
1118 Ga0157379_10371486
1119 Ga0157379_10386938
1120 Ga0157379_10702184
1121 Ga0157376_10007545
1122 Ga0157376_10011251
1123 Ga0157376_10217578
1124 Ga0182005_1063295
1125 Ga0163161_10005670
1126 Ga0163161_10010685
1127 Ga0163161_10229284
1128 Ga0163161_10367232
1129 Ga0213872_10005893
1130 Ga0213876_10227232
1131 Ga0209646_1000036
1132 Ga0209564_1000060
1133 Ga0207697_10034710
1134 Ga0207656_10013515
1135 Ga0207656_10033925
1136 Ga0207656_10057160
1137 Ga0207682_10011095
1138 Ga0207682_10016998
1139 Ga0207682_10037315
1140 Ga0207682_10055002
1141 Ga0207682_10121372
1142 Ga0207642_10000866
1143 Ga0207710_10064516
1144 Ga0207688_10031743
1145 Ga0207688_10060996
1146 Ga0207688_10074719
1147 Ga0207680_10003366
1148 Ga0207680_10021441
1149 Ga0207680_10033491
1150 Ga0207680_10098543
1151 Ga0207685_10093237
1152 Ga0207699_10219752
1153 Ga0207645_10007187
1154 Ga0207645_10014105
1155 Ga0207645_10031132
1156 Ga0207645_10170865
1157 Ga0207645_10267895
1158 Ga0207645_10299996
1159 Ga0207643_10043981
1160 Ga0207643_10280804
1161 Ga0207705_10021140
1162 Ga0207705_10110840
1163 Ga0207705_10140905
1164 Ga0207705_10514307
1165 Ga0207654_10382660
1166 Ga0207707_10002267
1167 Ga0207707_10063548
1168 Ga0207707_10317569
1169 Ga0207695_10180741
1170 Ga0207695_10221692
1171 Ga0207695_10261500
1172 Ga0207662_10008276
1173 Ga0207662_10147754
1174 Ga0207662_10577557
1175 Ga0207657_10015200
1176 Ga0207657_10124888
1177 Ga0207657_10196441
1178 Ga0207657_10333700
1179 Ga0207657_10454563
1180 Ga0207657_10896725
1181 Ga0207649_10009233
1182 Ga0207649_10107200
1183 Ga0207649_10278359
1184 Ga0207649_10309546
1185 Ga0207652_10020480
1186 Ga0207681_10000171
1187 Ga0207681_10018882
1188 Ga0207681_10216904
1189 Ga0207681_10301089
1190 Ga0207694_10043794
1191 Ga0207694_10188829
1192 Ga0207694_11226878
1193 Ga0207650_10007367
1194 Ga0207650_10027370
1195 Ga0207650_10176818
1196 Ga0207650_10186763
1197 Ga0207650_10204731
1198 Ga0207650_10427994
1199 Ga0207659_10013463
1200 Ga0207659_10014800
1201 Ga0207659_10023363
1202 Ga0207659_10124384
1203 Ga0207659_10130935
1204 Ga0207659_10146664
1205 Ga0207659_10408841
1206 Ga0207687_10012355
1207 Ga0207687_10051263
1208 Ga0207687_10077095
1209 Ga0207687_10295187
1210 Ga0207687_10428778
1211 Ga0207644_10031579
1212 Ga0207644_10065198
1213 Ga0207644_10066677
1214 Ga0207644_10178088
1215 Ga0207644_10241484
1216 Ga0207690_10071251
1217 Ga0207690_10156824
1218 Ga0207690_10212306
1219 Ga0207690_10299171
1220 Ga0207706_10010501
1221 Ga0207706_10061328
1222 Ga0207706_10112925
1223 Ga0207706_10168132
1224 Ga0207706_10286157
1225 Ga0207706_10331286
1226 Ga0207686_10037216
1227 Ga0207686_10175634
1228 Ga0207686_10209767
1229 Ga0207686_10502980
1230 Ga0207709_10006175
1231 Ga0207709_10340996
1232 Ga0207709_10386798
1233 Ga0207670_10007811
1234 Ga0207670_10105161
1235 Ga0207670_10189251
1236 Ga0207670_10236042
1237 Ga0207669_10002887
1238 Ga0207669_10018562
1239 Ga0207669_10023334
1240 Ga0207669_10318432
1241 Ga0207704_10025551
1242 Ga0207704_10029525
1243 Ga0207704_10053603
1244 Ga0207704_10230418
1245 Ga0207704_10723516
1246 Ga0207665_10289659
1247 Ga0207691_10006925
1248 Ga0207691_10007999
1249 Ga0207691_10008398
1250 Ga0207691_10054100
1251 Ga0207691_10063052
1252 Ga0207691_10067308
1253 Ga0207691_10095765
1254 Ga0207691_10137151
1255 Ga0207691_10265130
1256 Ga0207691_10285647
1257 Ga0207691_10369541
1258 Ga0207711_10008247
1259 Ga0207711_10017527
1260 Ga0207711_10028959
1261 Ga0207711_10029218
1262 Ga0207711_10214589
1263 Ga0207711_10267096
1264 Ga0207689_10015077
1265 Ga0207689_10024306
1266 Ga0207689_10028063
1267 Ga0207661_10536286
1268 Ga0207679_10212655
1269 Ga0207679_10353722
1270 Ga0207679_10426049
1271 Ga0207667_10679931
1272 Ga0207651_10010246
1273 Ga0207651_10160253
1274 Ga0207651_10178474
1275 Ga0207712_10027382
1276 Ga0207712_10031394
1277 Ga0207712_10033244
1278 Ga0207712_10059422
1279 Ga0207712_10327627
1280 Ga0207668_10006130
1281 Ga0207668_10049696
1282 Ga0207640_10187382
1283 Ga0207640_10401200
1284 Ga0207658_10002612
1285 Ga0207658_10016767
1286 Ga0207658_10138670
1287 Ga0207658_10532565
1288 Ga0207677_10010303
1289 Ga0207677_10031594
1290 Ga0207677_10032849
1291 Ga0207677_10035935
1292 Ga0207677_10061326
1293 Ga0207677_10277007
1294 Ga0207677_10707492
1295 Ga0207703_10003546
1296 Ga0207703_10050435
1297 Ga0207703_10298156
1298 Ga0207639_10287373
1299 Ga0207678_10183935
1300 Ga0207678_10261291
1301 Ga0207708_10008786
1302 Ga0207708_10089890
1303 Ga0207708_10249580
1304 Ga0207708_10387341
1305 Ga0207702_10540309
1306 Ga0207702_10551612
1307 Ga0207641_10000796
1308 Ga0207641_10026958
1309 Ga0207641_10068865
1310 Ga0207641_10212776
1311 Ga0207641_10513208
1312 Ga0207648_10022733
1313 Ga0207648_10033175
1314 Ga0207648_10062987
1315 Ga0207648_10105813
1316 Ga0207648_10128117
1317 Ga0207648_10154299
1318 Ga0207648_10255583
1319 Ga0207676_10003531
1320 Ga0207676_10006670
1321 Ga0207676_10038062
1322 Ga0207676_10048021
1323 Ga0207676_10058494
1324 Ga0207676_10278638
1325 Ga0207676_10814469
1326 Ga0207674_10005982
1327 Ga0207674_10066071
1328 Ga0207674_10074222
1329 Ga0207674_10466081
1330 Ga0207675_100001182
1331 Ga0207675_100022597
1332 Ga0207675_100185235
1333 Ga0207675_100358122
1334 Ga0207675_100590679
1335 Ga0207683_10000909
1336 Ga0207683_10033526
1337 Ga0207683_10053357
1338 Ga0207683_10074102
1339 Ga0207683_10087142
1340 Ga0207683_10095227
1341 Ga0207683_10129869
1342 Ga0207683_10244876
1343 Ga0207683_10363660
1344 Ga0207698_10001718
1345 Ga0207698_10445640
1346 Ga0209179_1000004
1347 Ga0207428_10176797
1348 Ga0207428_10333476
1349 Ga0268266_10009125
1350 Ga0268266_10015150
1351 Ga0268265_10001215
1352 Ga0268265_10001640
1353 Ga0268265_10027480
1354 Ga0268265_10292350
1355 Ga0268264_10008504
1356 Ga0268264_10018941
1357 Ga0268264_10271918
1358 Ga0268264_10367253
1359 Ga0307405_10002742
1360 Ga0307413_10199397
1361 Ga0307412_10031016
1362 Ga0307409_100002835
1363 Ga0307416_100000242
1364 Ga0307411_10019900
1365 Ga0307415_100009666
1366 Ga0307510_10047560
1367 Ga0373958_0052842
1368 Ga0373960_0101841
1369 Ga0373955_0010347
1370 Ga0373924_0326344
1371 Ga0373931_0033409
1372 Ga0373935_0039876
1373 Ga0373935_0184737
1374 Ga0373947_0040033
1375 Ga0373937_0005598
1376 Ga0373937_0070101
1377 Ga0373937_0090182
1378 Ga0373925_0052198
1379 Ga0395900_0701217
1380 Ga0395905_0004772
1381 Ga0436365_1791604
1382 Ga0436361_0457442
1383 Ga0436361_0790016
1384 Ga0436361_1008864
1385 Ga0451800_0311007
1386 Ga0439449_0006995
1387 Ga0439450_076521
1388 Ga0439459_0050124
1389 Ga0466972_0001345
1390 Ga0466965_0054292
1391 Ga0466966_0020646
1392 Ga0466966_0082476
1393 Ga0466961_0148887
1394 Ga0466957_0034909
1395 Ga0451576_0455957
1396 Ga0466958_0295494
1397 Ga0466967_0409302
1398 Ga0495592_0045977
1399 Ga0495603_0121617
1400 Ga0495603_0346943
1401 Ga0495629_0033043
1402 Ga0495653_0080493
1403 Ga0495605_0001520
1404 Ga0495664_0093210
1405 Ga0495594_0369832
1406 Ga0495607_0001098
1407 Ga0495610_0001937
1408 Ga0495610_0009178
1409 Ga0495616_0000198
1410 Ga0495618_0257688
1411 Ga0495618_0301999
1412 Ga0495628_0032900
1413 Ga0495628_0749470
1414 Ga0495630_0550185
1415 Ga0495630_0799989
1416 Ga0495643_0000420
1417 Ga0495598_0006314
1418 Ga0495609_0000046
1419 Ga0495609_0019678
1420 Ga0495621_0042688
1421 Ga0495621_0065173
1422 Ga0495645_0011480
1423 Ga0495645_0020949
1424 Ga0495633_0001876
1425 Ga0495667_0013247
1426 Ga0495656_0009909
1427 Ga0495625_0083676
1428 Ga0495635_0088332
1429 Ga0495635_0234366
1430 Ga0495635_0663929
1431 Ga0495661_0000393
1432 Ga0495661_0039787
1433 Ga0495657_0041973
1434 Ga0495599_0000714
1435 Ga0495623_0021518
1436 Ga0495658_0004319
1437 Ga0495658_0184706
1438 Ga0495658_0194600
1439 Ga0495670_0205851
1440 Ga0495649_0001668
1441 Ga0495589_0000039
1442 Ga0495600_0053303
1443 Ga0495600_0059866
1444 Ga0495600_0146262
1445 Ga0495636_0106062
1446 Ga0495672_0000483
1447 Ga0495680_0109385
1448 Ga0495687_000008
1449 Ga0495675_0130066
1450 Ga0495677_0000008
1451 Ga0495684_0065180
1452 Ga0495626_0002359
1453 Ga0496100_0068009
1454 Ga0496104_0023575
1455 Ga0496104_0290522
1456 Ga0496104_0356027
1457 Ga0496104_0366790
1458 Ga0496105_0042325
1459 Ga0496105_0333791
1460 Ga0496106_0177892
1461 Ga0496106_0257933
1462 Ga0496106_0399770
1463 Ga0496106_0445511
1464 Ga0496107_0008126
1465 Ga0496107_0451657
1466 Ga0496107_0938310
1467 Ga0496108_0093603
1468 Ga0496108_0151242
1469 Ga0496108_0155725
1470 Ga0496108_0306007
1471 Ga0496108_0496117
1472 Ga0496109_0073910
1473 Ga0496109_0208141
1474 Ga0496109_0242166
1475 Ga0496109_0506801
1476 Ga0496109_0844877
1477 Ga0496110_0080945
1478 Ga0496110_1065534
1479 Ga0496112_0019530
1480 Ga0496112_0308677
1481 Ga0496113_0025673
1482 Ga0496114_0042220
1483 Ga0496115_0243576
1484 Ga0495678_000347
1485 nmdc:mga09592_13511_c1
1486 nmdc:mga0qj67_51370_c1
1487 nmdc:mga0qj67_540433_c1
1488 nmdc:mga0qj67_665425_c1
1489 nmdc:mga08y16_109547_c1
1490 nmdc:mga08y16_190598_c1
1491 nmdc:mga0n895_1221364_c1
1492 nmdc:mga0a205_179342_c1
1493 nmdc:mga0a205_93135_c1
1494 Ga0495601_0055081
1495 Ga0495612_0101437
1496 Ga0495619_0012812
1497 Ga0495619_0041567
1498 Ga0500618_025419
1499 Ga0500559_0393883
1500 Ga0500586_000110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

15

162

0.95

PF08534

Redoxin

Redoxin

13

178

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9011 22 188
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8961 22 188
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8873 22 191
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.8849 26 196
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8767 22 191
ID Description Score Start End Superfamily
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9041 22 187 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9011 22 188 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9001 22 191 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8971 26 190 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8961 22 188 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X0J0U8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.993 22 187 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A418RQD4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.983 47 193 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A370X6L9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9714 14 189 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A317IDL9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9673 16 187 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A7X0J0U8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.953 22 187 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Map