F479032

General Info

Members Datasets Scaffolds Average Seq Length
750 249 750 181

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100382226|Ga0070713_1003822263
Length 198
Sequence MAARRKEKFAAPKRMRGQRPQAPGSAAKDDIEAMIRVDHAGEYGAVRIYEGQLAVLSARPGSARAAAAIKRMSDQEQRHLARFDALVNERRVRPTALEPVWRLAGFTLGAVTALLGEKSAMACTAAVEQVIDEHYASQLERLAHDKDLQKTIEDFRKDEVAHRDEALSHGAAEAPGFKIMSEAIKAGCRLAIKLSERI

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 0.93
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10001002 3300003215 Bacteria 17171
3 Ga0070658_10013783 3300005327 Bacteria 6487
4 Ga0070658_10081381 3300005327 Bacteria 2660
5 Ga0070658_10160702 3300005327 Bacteria 1884
6 Ga0070658_10180592 3300005327 Bacteria 1775
7 Ga0070676_10001376 3300005328 Bacteria 12257
8 Ga0070683_100067412 3300005329 Bacteria 3334
9 Ga0070683_100093250 3300005329 Bacteria 2829
10 Ga0068869_100002394 3300005334 Bacteria 11301
11 Ga0068869_100557039 3300005334 Bacteria 964
12 Ga0070666_10006536 3300005335 Bacteria 7162
13 Ga0070666_10064283 3300005335 Bacteria 2488
14 Ga0070666_10234152 3300005335 Bacteria 1297
15 Ga0070680_100000870 3300005336 Bacteria 21436
16 Ga0070680_100019997 3300005336 Bacteria 5308
17 Ga0070680_100160327 3300005336 Bacteria 1890
18 Ga0070680_100389688 3300005336 Bacteria 1187
19 Ga0068868_100074643 3300005338 Bacteria 2709
20 Ga0068868_100400203 3300005338 Bacteria 1185
21 Ga0070660_100018798 3300005339 Bacteria 5056
22 Ga0070660_100026293 3300005339 Bacteria 4332
23 Ga0070689_100141098 3300005340 Bacteria 1938
24 Ga0070691_10000082 3300005341 Bacteria 26541
25 Ga0070691_10005590 3300005341 Bacteria 5721
26 Ga0070661_100026806 3300005344 Bacteria 4147
27 Ga0070661_100037883 3300005344 Bacteria 3509
28 Ga0070661_100054716 3300005344 Bacteria 2923
29 Ga0070661_100608826 3300005344 Bacteria 884
30 Ga0070668_101075887 3300005347 Bacteria 725
31 Ga0070675_100338256 3300005354 Bacteria 1333
32 Ga0070671_100071315 3300005355 Bacteria 2899
33 Ga0070673_100185669 3300005364 Bacteria 1782
34 Ga0070659_100018711 3300005366 Bacteria 5229
35 Ga0070659_100072331 3300005366 Bacteria 2743
36 Ga0070659_100995023 3300005366 Bacteria 736
37 Ga0070667_100012865 3300005367 Bacteria 6914
38 Ga0070667_100338864 3300005367 Bacteria 1359
39 Ga0070709_10000238 3300005434 Bacteria 35500
40 Ga0070709_10062345 3300005434 Bacteria 2377
41 Ga0070714_100031391 3300005435 Bacteria 4432
42 Ga0070714_100102534 3300005435 Bacteria 2523
43 Ga0070714_100844900 3300005435 Bacteria 888
44 Ga0070713_100000011 3300005436 Bacteria 146314
45 Ga0070713_100382226 3300005436 Bacteria 1312
46 Ga0070713_101299615 3300005436 Bacteria 705
47 Ga0070711_100103191 3300005439 Bacteria 2078
48 Ga0070711_100574128 3300005439 Bacteria 938
49 Ga0070663_100077387 3300005455 Bacteria 2435
50 Ga0070678_100002013 3300005456 Bacteria 10984
51 Ga0070678_100031753 3300005456 Bacteria 3648
52 Ga0070678_100851611 3300005456 Bacteria 831
53 Ga0070662_100125309 3300005457 Bacteria 1974
54 Ga0070681_10000002 3300005458 Bacteria 821814
55 Ga0070681_10030628 3300005458 Bacteria 5400
56 Ga0070681_10151923 3300005458 Bacteria 2242
57 Ga0070681_10550473 3300005458 Bacteria 1068
58 Ga0070681_10759929 3300005458 Bacteria 886
59 Ga0068867_100014884 3300005459 Bacteria 5513
60 Ga0068867_100347906 3300005459 Unclassified 1236
61 Ga0068867_100935507 3300005459 Bacteria 782
62 Ga0070679_100000569 3300005530 Bacteria 31286
63 Ga0070679_100111217 3300005530 Bacteria 2725
64 Ga0070679_100257225 3300005530 Bacteria 1701
65 Ga0070679_100615794 3300005530 Bacteria 1029
66 Ga0070679_100744142 3300005530 Bacteria 923
67 Ga0070679_101198240 3300005530 Bacteria 705
68 Ga0070684_100041676 3300005535 Bacteria 3960
69 Ga0070684_100089015 3300005535 Bacteria 2743
70 Ga0070684_100413204 3300005535 Bacteria 1245
71 Ga0068853_100038034 3300005539 Bacteria 4098
72 Ga0068853_100070770 3300005539 Bacteria 3037
73 Ga0068853_100108211 3300005539 Bacteria 2466
74 Ga0068853_100426349 3300005539 Bacteria 1244
75 Ga0068853_101171351 3300005539 Bacteria 742
76 Ga0068853_101199680 3300005539 Bacteria 733
77 Ga0070696_100028174 3300005546 Bacteria 3832
78 Ga0070693_100395766 3300005547 Bacteria 956
79 Ga0070665_100002597 3300005548 Bacteria 19721
80 Ga0070665_100018871 3300005548 Bacteria 6916
81 Ga0070665_100049419 3300005548 Bacteria 4220
82 Ga0070665_100057758 3300005548 Bacteria 3890
83 Ga0070665_100292094 3300005548 Bacteria 1632
84 Ga0070665_100706971 3300005548 Bacteria 1021
85 Ga0068855_100000106 3300005563 Bacteria 103864
86 Ga0068855_100201419 3300005563 Bacteria 2241
87 Ga0068855_100758870 3300005563 Bacteria 1034
88 Ga0068855_101203256 3300005563 Bacteria 788
89 Ga0070664_100833273 3300005564 Bacteria 863
90 Ga0068857_100005182 3300005577 Bacteria 11087
91 Ga0068857_100088072 3300005577 Bacteria 2777
92 Ga0068857_100145231 3300005577 Bacteria 2146
93 Ga0068857_100184306 3300005577 Bacteria 1900
94 Ga0068857_100220298 3300005577 Bacteria 1733
95 Ga0068856_100000964 3300005614 Bacteria 30705
96 Ga0068856_100003424 3300005614 Bacteria 16037
97 Ga0068856_100133424 3300005614 Bacteria 2488
98 Ga0068856_100210874 3300005614 Bacteria 1958
99 Ga0068856_100252726 3300005614 Bacteria 1778
100 Ga0068856_100254860 3300005614 Bacteria 1770
101 Ga0068856_100344713 3300005614 Bacteria 1508
102 Ga0068856_100489925 3300005614 Bacteria 1250
103 Ga0068856_100711434 3300005614 Bacteria 1025
104 Ga0068852_100002997 3300005616 Bacteria 11733
105 Ga0068852_100003598 3300005616 Bacteria 10848
106 Ga0068852_100005013 3300005616 Bacteria 9416
107 Ga0068852_100005817 3300005616 Bacteria 8853
108 Ga0068852_100244694 3300005616 Bacteria 1716
109 Ga0068859_100202702 3300005617 Bacteria 2069
110 Ga0068866_10026254 3300005718 Bacteria 2748
111 Ga0068861_100581765 3300005719 Bacteria 1025
112 Ga0068851_10058114 3300005834 Bacteria 1976
113 Ga0068863_100201536 3300005841 Bacteria 1914
114 Ga0068858_100004578 3300005842 Bacteria 13542
115 Ga0068858_100132435 3300005842 Bacteria 2338
116 Ga0068862_100701224 3300005844 Bacteria 981
117 Ga0070716_100514844 3300006173 Bacteria 885
118 Ga0070712_100000014 3300006175 Bacteria 108668
119 Ga0097621_100002964 3300006237 Bacteria 11650
120 Ga0097621_100011176 3300006237 Bacteria 6607
121 Ga0097621_100019884 3300006237 Bacteria 5164
122 Ga0097621_100222939 3300006237 Bacteria 1643
123 Ga0097621_100335572 3300006237 Bacteria 1341
124 Ga0097621_100566111 3300006237 Bacteria 1036
125 Ga0097621_100578230 3300006237 Bacteria 1025
126 Ga0068871_100001250 3300006358 Bacteria 16986
127 Ga0068871_100076324 3300006358 Bacteria 2767
128 Ga0068871_100117583 3300006358 Bacteria 2242
129 Ga0068871_100143736 3300006358 Bacteria 2030
130 Ga0068871_100403905 3300006358 Unclassified 1217
131 Ga0068871_100637050 3300006358 Bacteria 972
132 Ga0068865_100025832 3300006881 Bacteria 3867
133 Ga0075436_100000047 3300006914 Bacteria 72907
134 Ga0075436_100031385 3300006914 Bacteria 3658
135 Ga0097620_100202706 3300006931 Bacteria 2069
136 Ga0075435_100095705 3300007076 Bacteria 2456
137 Ga0105240_10000055 3300009093 Bacteria 225380
138 Ga0105240_10000355 3300009093 Bacteria 86025
139 Ga0105240_10028212 3300009093 Bacteria 7335
140 Ga0105240_10038465 3300009093 Bacteria 6137
141 Ga0105240_10080726 3300009093 Bacteria 3999
142 Ga0105240_10158446 3300009093 Bacteria 2691
143 Ga0105240_10179345 3300009093 Bacteria 2501
144 Ga0105240_10187103 3300009093 Bacteria 2438
145 Ga0105240_10212523 3300009093 Bacteria 2259
146 Ga0105240_10274319 3300009093 Bacteria 1940
147 Ga0105240_10280267 3300009093 Bacteria 1915
148 Ga0105240_10318352 3300009093 Bacteria 1774
149 Ga0105240_10369042 3300009093 Bacteria 1623
150 Ga0105240_10539060 3300009093 Bacteria 1292
151 Ga0105240_11587609 3300009093 Bacteria 685
152 Ga0105245_10070841 3300009098 Bacteria 3165
153 Ga0105245_10133433 3300009098 Bacteria 2331
154 Ga0105247_10005627 3300009101 Bacteria 7863
155 Ga0105243_10006780 3300009148 Bacteria 8830
156 Ga0105241_10016353 3300009174 Bacteria 5440
157 Ga0105241_10022531 3300009174 Bacteria 4666
158 Ga0105241_10028509 3300009174 Bacteria 4162
159 Ga0105241_10039288 3300009174 Bacteria 3569
160 Ga0105241_10213252 3300009174 Bacteria 1619
161 Ga0105241_11026461 3300009174 Bacteria 773
162 Ga0105242_10208294 3300009176 Bacteria 1741
163 Ga0105248_10000001 3300009177 Bacteria 1881304
164 Ga0105248_10031038 3300009177 Bacteria 5971
165 Ga0105248_10109932 3300009177 Bacteria 3108
166 Ga0105248_10860054 3300009177 Unclassified 1024
167 Ga0105248_11499575 3300009177 Bacteria 763
168 Ga0105237_10008237 3300009545 Bacteria 11319
169 Ga0105237_10014301 3300009545 Bacteria 8307
170 Ga0105237_10015763 3300009545 Bacteria 7860
171 Ga0105237_10019700 3300009545 Bacteria 6965
172 Ga0105237_10070274 3300009545 Bacteria 3497
173 Ga0105237_10126897 3300009545 Bacteria 2546
174 Ga0105237_10167542 3300009545 Bacteria 2196
175 Ga0105237_11183289 3300009545 Bacteria 771
176 Ga0105238_10003708 3300009551 Bacteria 15199
177 Ga0105238_10011779 3300009551 Bacteria 8814
178 Ga0105238_10011985 3300009551 Bacteria 8733
179 Ga0105238_10026575 3300009551 Bacteria 5902
180 Ga0105238_10127064 3300009551 Bacteria 2528
181 Ga0105238_10171582 3300009551 Bacteria 2145
182 Ga0105238_10171636 3300009551 Bacteria 2145
183 Ga0105238_10183728 3300009551 Bacteria 2068
184 Ga0105238_10819796 3300009551 Bacteria 947
185 Ga0105238_10996179 3300009551 Bacteria 859
186 Ga0105249_10017761 3300009553 Bacteria 6319
187 Ga0105239_10034655 3300010375 Bacteria 5545
188 Ga0105239_10068805 3300010375 Bacteria 3891
189 Ga0105239_10072584 3300010375 Bacteria 3784
190 Ga0105239_10087689 3300010375 Bacteria 3431
191 Ga0105239_10150764 3300010375 Bacteria 2595
192 Ga0105239_10221464 3300010375 Bacteria 2122
193 Ga0105239_10383015 3300010375 Bacteria 1590
194 Ga0105239_10384132 3300010375 Bacteria 1588
195 Ga0105239_10471047 3300010375 Bacteria 1426
196 Ga0105239_10532578 3300010375 Bacteria 1337
197 Ga0105239_10921580 3300010375 Bacteria 1003
198 Ga0105239_11022513 3300010375 Bacteria 950
199 Ga0105239_11134998 3300010375 Bacteria 900
200 Ga0105246_10009904 3300011119 Bacteria 5878
201 Ga0105246_10039465 3300011119 Bacteria 3181
202 Ga0157373_10003903 3300013100 Bacteria 11264
203 Ga0157370_10000280 3300013104 Bacteria 64677
204 Ga0157370_10004453 3300013104 Bacteria 16057
205 Ga0157370_10280808 3300013104 Bacteria 1539
206 Ga0157370_10372649 3300013104 Unclassified 1315
207 Ga0157370_11111260 3300013104 Bacteria 714
208 Ga0157369_10004867 3300013105 Bacteria 15757
209 Ga0157369_10010911 3300013105 Bacteria 10345
210 Ga0157369_10023221 3300013105 Bacteria 6910
211 Ga0157369_10218750 3300013105 Bacteria 1994
212 Ga0157369_10378540 3300013105 Bacteria 1469
213 Ga0157369_10444185 3300013105 Bacteria 1343
214 Ga0157369_10603419 3300013105 Unclassified 1133
215 Ga0157374_10025468 3300013296 Bacteria 5312
216 Ga0157374_10028010 3300013296 Bacteria 5088
217 Ga0157374_10119881 3300013296 Bacteria 2538
218 Ga0157378_10116865 3300013297 Bacteria 2453
219 Ga0157378_10324537 3300013297 Bacteria 1496
220 Ga0157378_10369347 3300013297 Bacteria 1406
221 Ga0157378_11075679 3300013297 Bacteria 841
222 Ga0157378_12127855 3300013297 Unclassified 612
223 Ga0163162_10044647 3300013306 Bacteria 4439
224 Ga0163162_10051883 3300013306 Bacteria 4117
225 Ga0163162_10084081 3300013306 Bacteria 3257
226 Ga0163162_10129225 3300013306 Bacteria 2635
227 Ga0163162_10585205 3300013306 Bacteria 1243
228 Ga0163162_11201726 3300013306 Bacteria 860
229 Ga0157372_10008076 3300013307 Bacteria 11194
230 Ga0157372_10018787 3300013307 Bacteria 7435
231 Ga0157372_10067384 3300013307 Bacteria 4022
232 Ga0157372_10071967 3300013307 Bacteria 3895
233 Ga0157372_11310842 3300013307 Bacteria 835
234 Ga0157375_10022440 3300013308 Bacteria 5809
235 Ga0157375_10358402 3300013308 Bacteria 1624
236 Ga0157375_10490806 3300013308 Bacteria 1393
237 Ga0163163_10000012 3300014325 Bacteria 257369
238 Ga0163163_10533937 3300014325 Bacteria 1235
239 Ga0157380_10139607 3300014326 Bacteria 2080
240 Ga0157379_10001126 3300014968 Bacteria 21842
241 Ga0157379_10001288 3300014968 Bacteria 20426
242 Ga0157379_10002345 3300014968 Bacteria 15799
243 Ga0157379_10014522 3300014968 Bacteria 6912
244 Ga0157379_10098254 3300014968 Bacteria 2628
245 Ga0157379_10102466 3300014968 Bacteria 2569
246 Ga0157379_10139661 3300014968 Bacteria 2184
247 Ga0157379_10155032 3300014968 Bacteria 2066
248 Ga0157376_10002383 3300014969 Bacteria 12692
249 Ga0157376_10215293 3300014969 Bacteria 1776
250 Ga0157376_10231906 3300014969 Bacteria 1715
251 Ga0157376_10239375 3300014969 Bacteria 1690
252 Ga0163161_10003599 3300017792 Bacteria 10865
253 Ga0213874_10011832 3300021377 Bacteria 2222
254 Ga0213874_10022498 3300021377 Bacteria 1750
255 Ga0213876_10000274 3300021384 Bacteria 47640
256 Ga0213876_10000349 3300021384 Bacteria 39867
257 Ga0207427_104408 3300025231 Bacteria 2385
258 Ga0209233_1000006 3300025261 Bacteria 1473685
259 Ga0209758_1000008 3300025297 Bacteria 1215263
260 Ga0207656_10105605 3300025321 Bacteria 1296
261 Ga0207642_10042316 3300025899 Bacteria 2001
262 Ga0207642_10713787 3300025899 Unclassified 632
263 Ga0207680_10005414 3300025903 Bacteria 6099
264 Ga0207680_10016508 3300025903 Bacteria 3878
265 Ga0207680_10288154 3300025903 Bacteria 1142
266 Ga0207699_10000233 3300025906 Bacteria 31418
267 Ga0207699_10050030 3300025906 Bacteria 2463
268 Ga0207699_10216354 3300025906 Bacteria 1306
269 Ga0207645_10005584 3300025907 Bacteria 9097
270 Ga0207705_10000058 3300025909 Bacteria 155967
271 Ga0207705_10004973 3300025909 Bacteria 9971
272 Ga0207705_10013975 3300025909 Bacteria 5788
273 Ga0207705_10253476 3300025909 Bacteria 1342
274 Ga0207654_10011752 3300025911 Bacteria 4469
275 Ga0207654_10019838 3300025911 Bacteria 3555
276 Ga0207654_10022256 3300025911 Bacteria 3380
277 Ga0207654_10028143 3300025911 Bacteria 3062
278 Ga0207654_10051395 3300025911 Bacteria 2372
279 Ga0207654_10135167 3300025911 Bacteria 1565
280 Ga0207654_10154266 3300025911 Bacteria 1477
281 Ga0207707_10000002 3300025912 Bacteria 1142054
282 Ga0207707_10001851 3300025912 Bacteria 19343
283 Ga0207707_10131316 3300025912 Bacteria 2190
284 Ga0207707_10132852 3300025912 Bacteria 2177
285 Ga0207707_10367173 3300025912 Bacteria 1239
286 Ga0207695_10000012 3300025913 Bacteria 840961
287 Ga0207695_10003622 3300025913 Bacteria 21591
288 Ga0207695_10016906 3300025913 Bacteria 8513
289 Ga0207695_10022595 3300025913 Bacteria 7135
290 Ga0207695_10023131 3300025913 Bacteria 7032
291 Ga0207695_10084002 3300025913 Bacteria 3215
292 Ga0207695_10111558 3300025913 Bacteria 2714
293 Ga0207695_10130973 3300025913 Bacteria 2466
294 Ga0207695_10135676 3300025913 Bacteria 2414
295 Ga0207695_10161510 3300025913 Bacteria 2172
296 Ga0207695_10203598 3300025913 Bacteria 1892
297 Ga0207695_10210009 3300025913 Bacteria 1858
298 Ga0207695_10219053 3300025913 Bacteria 1811
299 Ga0207695_10652270 3300025913 Bacteria 933
300 Ga0207671_10032398 3300025914 Bacteria 3891
301 Ga0207671_10041489 3300025914 Bacteria 3406
302 Ga0207671_10054219 3300025914 Bacteria 2971
303 Ga0207671_10074643 3300025914 Bacteria 2535
304 Ga0207671_10121079 3300025914 Bacteria 2000
305 Ga0207693_10000018 3300025915 Bacteria 138365
306 Ga0207693_10161513 3300025915 Bacteria 1763
307 Ga0207693_10197238 3300025915 Bacteria 1583
308 Ga0207663_10075064 3300025916 Bacteria 2193
309 Ga0207660_10000296 3300025917 Bacteria 32942
310 Ga0207660_10003913 3300025917 Bacteria 9706
311 Ga0207660_10059809 3300025917 Bacteria 2737
312 Ga0207657_10001163 3300025919 Bacteria 27950
313 Ga0207657_10004729 3300025919 Bacteria 14373
314 Ga0207657_10048575 3300025919 Bacteria 3704
315 Ga0207657_10076217 3300025919 Bacteria 2830
316 Ga0207649_10000026 3300025920 Bacteria 177395
317 Ga0207649_10017732 3300025920 Bacteria 4036
318 Ga0207649_10060208 3300025920 Bacteria 2385
319 Ga0207652_10010383 3300025921 Bacteria 7498
320 Ga0207652_10017999 3300025921 Bacteria 5789
321 Ga0207652_10020028 3300025921 Bacteria 5509
322 Ga0207694_10000006 3300025924 Bacteria 631109
323 Ga0207694_10014783 3300025924 Bacteria 5886
324 Ga0207694_10021944 3300025924 Bacteria 4841
325 Ga0207694_10044508 3300025924 Bacteria 3427
326 Ga0207694_10048560 3300025924 Bacteria 3284
327 Ga0207694_10119641 3300025924 Bacteria 2101
328 Ga0207687_10058623 3300025927 Bacteria 2709
329 Ga0207687_11345223 3300025927 Bacteria 614
330 Ga0207700_10000005 3300025928 Bacteria 394836
331 Ga0207700_10225704 3300025928 Bacteria 1590
332 Ga0207700_10317230 3300025928 Bacteria 1350
333 Ga0207664_10014515 3300025929 Bacteria 5692
334 Ga0207664_10016200 3300025929 Bacteria 5431
335 Ga0207644_10066078 3300025931 Bacteria 2632
336 Ga0207644_10556631 3300025931 Bacteria 950
337 Ga0207690_10012687 3300025932 Bacteria 5049
338 Ga0207690_10151761 3300025932 Bacteria 1718
339 Ga0207706_10141251 3300025933 Bacteria 2119
340 Ga0207686_10020821 3300025934 Bacteria 3753
341 Ga0207686_10118851 3300025934 Bacteria 1796
342 Ga0207709_10014211 3300025935 Bacteria 4394
343 Ga0207709_10970243 3300025935 Bacteria 694
344 Ga0207670_10480591 3300025936 Bacteria 1006
345 Ga0207669_10371373 3300025937 Bacteria 1112
346 Ga0207704_10069864 3300025938 Bacteria 2221
347 Ga0207704_10596202 3300025938 Bacteria 904
348 Ga0207711_10000001 3300025941 Bacteria 1325674
349 Ga0207711_10013219 3300025941 Bacteria 6858
350 Ga0207711_10776377 3300025941 Unclassified 893
351 Ga0207689_10026374 3300025942 Bacteria 4865
352 Ga0207689_10172354 3300025942 Bacteria 1784
353 Ga0207689_10195534 3300025942 Bacteria 1669
354 Ga0207661_10317265 3300025944 Bacteria 1400
355 Ga0207661_10330758 3300025944 Bacteria 1371
356 Ga0207661_10505439 3300025944 Bacteria 1104
357 Ga0207661_10511385 3300025944 Bacteria 1098
358 Ga0207679_10327116 3300025945 Bacteria 1329
359 Ga0207667_10000026 3300025949 Bacteria 343713
360 Ga0207667_10002838 3300025949 Bacteria 21514
361 Ga0207667_10007703 3300025949 Bacteria 12887
362 Ga0207667_10034264 3300025949 Bacteria 5454
363 Ga0207667_10035769 3300025949 Bacteria 5327
364 Ga0207667_10037635 3300025949 Bacteria 5171
365 Ga0207667_10963687 3300025949 Unclassified 842
366 Ga0207651_10074676 3300025960 Bacteria 2415
367 Ga0207712_10014867 3300025961 Bacteria 5012
368 Ga0207712_10317962 3300025961 Bacteria 1283
369 Ga0207640_10040754 3300025981 Bacteria 2949
370 Ga0207640_10492173 3300025981 Bacteria 1019
371 Ga0207658_10023373 3300025986 Bacteria 4314
372 Ga0207677_10004318 3300026023 Bacteria 7614
373 Ga0207677_10079685 3300026023 Bacteria 2343
374 Ga0207677_10235130 3300026023 Bacteria 1479
375 Ga0207677_10764053 3300026023 Bacteria 862
376 Ga0207703_10017787 3300026035 Bacteria 5551
377 Ga0207703_10017934 3300026035 Bacteria 5528
378 Ga0207703_10108592 3300026035 Bacteria 2363
379 Ga0207639_10001556 3300026041 Bacteria 15378
380 Ga0207639_10159886 3300026041 Bacteria 1897
381 Ga0207639_10229617 3300026041 Bacteria 1608
382 Ga0207639_10338157 3300026041 Bacteria 1341
383 Ga0207639_10589740 3300026041 Bacteria 1024
384 Ga0207639_10606378 3300026041 Bacteria 1010
385 Ga0207639_11024687 3300026041 Unclassified 773
386 Ga0207678_10038547 3300026067 Bacteria 4152
387 Ga0207678_10605430 3300026067 Bacteria 961
388 Ga0207678_10895762 3300026067 Bacteria 784
389 Ga0207708_11099144 3300026075 Bacteria 693
390 Ga0207702_10000173 3300026078 Bacteria 77458
391 Ga0207702_10001080 3300026078 Bacteria 27929
392 Ga0207702_10186477 3300026078 Bacteria 1913
393 Ga0207702_10266776 3300026078 Bacteria 1614
394 Ga0207702_10283906 3300026078 Bacteria 1566
395 Ga0207702_10541169 3300026078 Bacteria 1138
396 Ga0207702_10570803 3300026078 Bacteria 1108
397 Ga0207702_10785095 3300026078 Bacteria 941
398 Ga0207702_10967097 3300026078 Bacteria 844
399 Ga0207702_11332994 3300026078 Bacteria 712
400 Ga0207702_11721360 3300026078 Bacteria 620
401 Ga0207648_10009495 3300026089 Bacteria 9309
402 Ga0207648_10115605 3300026089 Bacteria 2358
403 Ga0207674_10000112 3300026116 Bacteria 94220
404 Ga0207674_10087310 3300026116 Bacteria 3113
405 Ga0207674_10125019 3300026116 Bacteria 2538
406 Ga0207674_10155915 3300026116 Bacteria 2239
407 Ga0207674_10217525 3300026116 Bacteria 1859
408 Ga0207675_100597325 3300026118 Bacteria 1106
409 Ga0207683_10003082 3300026121 Bacteria 14565
410 Ga0207683_10049440 3300026121 Bacteria 3681
411 Ga0207698_10001893 3300026142 Bacteria 12258
412 Ga0207698_10007028 3300026142 Bacteria 7050
413 Ga0207698_10017662 3300026142 Bacteria 4847
414 Ga0207698_10025195 3300026142 Bacteria 4185
415 Ga0207698_10896152 3300026142 Bacteria 894
416 Ga0268266_10000463 3300028379 Bacteria 59089
417 Ga0268266_10079718 3300028379 Bacteria 2851
418 Ga0268266_10156033 3300028379 Bacteria 2061
419 Ga0268266_10172741 3300028379 Bacteria 1962
420 Ga0268266_10524252 3300028379 Bacteria 1133
421 Ga0268266_10551484 3300028379 Bacteria 1104
422 Ga0268266_10637491 3300028379 Bacteria 1025
423 Ga0268266_11027791 3300028379 Bacteria 797
424 Ga0268266_11192895 3300028379 Unclassified 736
425 Ga0268266_11517902 3300028379 Bacteria 645
426 Ga0265318_10000444 3300028577 Bacteria 31172
427 Ga0265338_10000011 3300028800 Bacteria 433370
428 Ga0265338_10001087 3300028800 Bacteria 45161
429 Ga0265338_10051307 3300028800 Bacteria 3715
430 Ga0265338_10072489 3300028800 Bacteria 2940
431 Ga0265338_10072660 3300028800 Bacteria 2936
432 Ga0265330_10009167 3300031235 Bacteria 4716
433 Ga0265330_10067547 3300031235 Bacteria 1549
434 Ga0265332_10195710 3300031238 Unclassified 841
435 Ga0265332_10250540 3300031238 Unclassified 733
436 Ga0265328_10022854 3300031239 Bacteria 2375
437 Ga0265328_10078788 3300031239 Bacteria 1214
438 Ga0265320_10003153 3300031240 Bacteria 11187
439 Ga0265325_10000009 3300031241 Bacteria 184273
440 Ga0265325_10000094 3300031241 Bacteria 62066
441 Ga0265325_10002373 3300031241 Bacteria 12725
442 Ga0265325_10002474 3300031241 Bacteria 12447
443 Ga0265325_10002838 3300031241 Bacteria 11552
444 Ga0265325_10033081 3300031241 Bacteria 2757
445 Ga0265329_10049528 3300031242 Bacteria 1338
446 Ga0265340_10000159 3300031247 Bacteria 34106
447 Ga0265340_10000562 3300031247 Bacteria 20607
448 Ga0265340_10004479 3300031247 Bacteria 7800
449 Ga0265340_10006207 3300031247 Bacteria 6588
450 Ga0265340_10180493 3300031247 Bacteria 954
451 Ga0265339_10002153 3300031249 Bacteria 14321
452 Ga0265339_10007160 3300031249 Bacteria 7238
453 Ga0265339_10008384 3300031249 Bacteria 6581
454 Ga0265339_10026142 3300031249 Bacteria 3344
455 Ga0265339_10048309 3300031249 Bacteria 2334
456 Ga0265339_10128734 3300031249 Unclassified 1296
457 Ga0265339_10133571 3300031249 Bacteria 1267
458 Ga0265339_10239321 3300031249 Unclassified 882
459 Ga0265331_10000008 3300031250 Bacteria 324311
460 Ga0265331_10000009 3300031250 Bacteria 314950
461 Ga0265331_10002453 3300031250 Bacteria 12567
462 Ga0265331_10199879 3300031250 Bacteria 900
463 Ga0265327_10000036 3300031251 Bacteria 312827
464 Ga0265316_10004977 3300031344 Bacteria 13046
465 Ga0265316_10020381 3300031344 Bacteria 5644
466 Ga0265316_10025982 3300031344 Bacteria 4879
467 Ga0265316_10093425 3300031344 Bacteria 2292
468 Ga0265316_10118156 3300031344 Bacteria 2004
469 Ga0265316_10186012 3300031344 Bacteria 1545
470 Ga0265316_10388159 3300031344 Bacteria 1007
471 Ga0265313_10001052 3300031595 Bacteria 26852
472 Ga0265313_10002778 3300031595 Bacteria 14762
473 Ga0265313_10043318 3300031595 Bacteria 2204
474 Ga0265313_10100612 3300031595 Bacteria 1284
475 Ga0265313_10137862 3300031595 Bacteria 1052
476 Ga0307508_10321667 3300031616 Bacteria 1139
477 Ga0265314_10001062 3300031711 Bacteria 31939
478 Ga0265314_10004805 3300031711 Bacteria 12366
479 Ga0265314_10004872 3300031711 Bacteria 12269
480 Ga0265314_10031751 3300031711 Bacteria 3894
481 Ga0265314_10051883 3300031711 Bacteria 2855
482 Ga0265314_10057403 3300031711 Bacteria 2673
483 Ga0265314_10085255 3300031711 Bacteria 2072
484 Ga0265314_10086371 3300031711 Bacteria 2054
485 Ga0265314_10098623 3300031711 Bacteria 1884
486 Ga0265314_10119429 3300031711 Unclassified 1662
487 Ga0265314_10126486 3300031711 Bacteria 1600
488 Ga0265314_10133311 3300031711 Bacteria 1546
489 Ga0265314_10161231 3300031711 Bacteria 1364
490 Ga0265314_10231503 3300031711 Bacteria 1071
491 Ga0265342_10007158 3300031712 Bacteria 8211
492 Ga0265342_10013703 3300031712 Bacteria 5421
493 Ga0265342_10042692 3300031712 Bacteria 2739
494 Ga0265342_10160731 3300031712 Bacteria 1242
495 Ga0265342_10218665 3300031712 Unclassified 1027
496 Ga0307516_10061230 3300031730 Bacteria 3653
497 Ga0307516_10071158 3300031730 Bacteria 3339
498 Ga0373934_0060273 3300035086 Bacteria 1511
499 Ga0373944_0023315 3300035089 Bacteria 1805
500 Ga0373952_0156240 3300035092 Bacteria 643
501 Ga0373923_0026149 3300035111 Bacteria 2320
502 Ga0373932_0109557 3300035112 Unclassified 908
503 Ga0373936_0127490 3300035113 Bacteria 1091
504 Ga0373954_0249841 3300035118 Bacteria 873
505 Ga0373943_0399499 3300035170 Bacteria 793
506 Ga0373924_0068382 3300035410 Bacteria 1495
507 Ga0373935_0205258 3300035692 Bacteria 1363
508 Ga0373935_0230956 3300035692 Bacteria 1288
509 Ga0373933_0222632 3300035724 Bacteria 1211
510 Ga0373933_0352929 3300035724 Bacteria 955
511 Ga0373947_0005370 3300035725 Bacteria 7479
512 Ga0373947_0082089 3300035725 Bacteria 1997
513 Ga0373937_0006814 3300036401 Bacteria 9858
514 Ga0373937_0300931 3300036401 Bacteria 1516
515 Ga0373925_0012671 3300037068 Bacteria 6105
516 Ga0373925_0050470 3300037068 Bacteria 3103
517 Ga0395899_0016522 3300037312 Bacteria 5630
518 Ga0395900_0088308 3300037418 Bacteria 3187
519 Ga0395900_0555517 3300037418 Unclassified 1092
520 Ga0395898_0009858 3300037466 Bacteria 10012
521 Ga0395898_0026131 3300037466 Bacteria 5877
522 Ga0395901_0743540 3300038443 Bacteria 974
523 Ga0395901_1920239 3300038443 Bacteria 539
524 Ga0436365_0257402 3300039437 Bacteria 164674
525 Ga0436365_0298223 3300039437 Bacteria 74249
526 Ga0436365_0483034 3300039437 Bacteria 2554
527 Ga0436365_0570483 3300039437 Unclassified 998
528 Ga0436365_1065516 3300039437 Bacteria 1311
529 Ga0436365_1223073 3300039437 Bacteria 984
530 Ga0436360_0650771 3300039438 Bacteria 909
531 Ga0436360_1347255 3300039438 Bacteria 1879
532 Ga0436363_0325134 3300039450 Bacteria 2251
533 Ga0436363_0444918 3300039450 Unclassified 1134
534 Ga0436363_1255904 3300039450 Bacteria 6631
535 Ga0436363_1432904 3300039450 Unclassified 1935
536 Ga0436362_0130343 3300039453 Bacteria 3755
537 Ga0451793_0085511 3300041452 Bacteria 1217
538 Ga0451798_0040364 3300041458 Bacteria 955
539 Ga0451853_0112512 3300041512 Bacteria 759
540 Ga0466966_0457464 3300044684 Bacteria 767
541 Ga0466957_0318629 3300044842 Bacteria 1049
542 Ga0466967_0249353 3300045976 Bacteria 1696
543 Ga0466967_0268247 3300045976 Bacteria 1635
544 Ga0495592_0240183 3300046454 Bacteria 1202
545 Ga0495592_0635441 3300046454 Bacteria 648
546 Ga0495580_0056424 3300046472 Bacteria 2766
547 Ga0495580_0076015 3300046472 Bacteria 2343
548 Ga0495664_0016439 3300046477 Bacteria 4215
549 Ga0495664_0280748 3300046477 Bacteria 1006
550 Ga0495585_0281721 3300046492 Bacteria 821
551 Ga0495606_0224960 3300046507 Bacteria 1055
552 Ga0495628_0245709 3300046516 Bacteria 1337
553 Ga0495628_0506971 3300046516 Bacteria 871
554 Ga0495652_0212461 3300046529 Bacteria 1459
555 Ga0495652_0692939 3300046529 Bacteria 686
556 Ga0495587_0066469 3300046536 Bacteria 2103
557 Ga0495587_0115867 3300046536 Bacteria 1537
558 Ga0495587_0448709 3300046536 Bacteria 715
559 Ga0495609_0017425 3300046538 Bacteria 3335
560 Ga0495645_0013632 3300046543 Bacteria 5757
561 Ga0495645_0039080 3300046543 Bacteria 3461
562 Ga0495622_0002344 3300046557 Bacteria 9210
563 Ga0495622_0417614 3300046557 Bacteria 577
564 Ga0495656_0159491 3300046615 Bacteria 1095
565 Ga0495635_0238754 3300046663 Bacteria 1227
566 Ga0495599_0278917 3300046678 Bacteria 1013
567 Ga0495623_0244724 3300046679 Bacteria 1011
568 Ga0495658_0001623 3300046683 Bacteria 11704
569 Ga0495669_0325374 3300046684 Bacteria 742
570 Ga0495670_0511848 3300046691 Bacteria 652
571 Ga0495589_0027867 3300046794 Bacteria 2855
572 Ga0495604_0537737 3300047317 Bacteria 755
573 Ga0495604_0598589 3300047317 Bacteria 707
574 Ga0495636_0032689 3300047318 Bacteria 2135
575 Ga0495674_0269717 3300047319 Bacteria 1397
576 Ga0495674_0455199 3300047319 Bacteria 1028
577 Ga0495672_0158171 3300047320 Bacteria 1168
578 Ga0495672_0213630 3300047320 Bacteria 957
579 Ga0495676_0156074 3300047321 Bacteria 1619
580 Ga0496102_0356471 3300048905 Unclassified 1377
581 Ga0496107_0700792 3300048910 Bacteria 745
582 Ga0496110_1186935 3300048913 Unclassified 672
583 Ga0496112_0224736 3300048915 Bacteria 1833
584 Ga0496115_0728451 3300048918 Bacteria 777
585 Ga0496121_0000987 3300048924 Bacteria 50954
586 Ga0495682_0001351 3300049460 Bacteria 13529
587 Ga0501031_0003423 3300049568 Bacteria 10182
588 Ga0501031_0098537 3300049568 Bacteria 1907
589 Ga0501031_0442113 3300049568 Bacteria 840
590 Ga0501032_0007623 3300049569 Bacteria 7891
591 Ga0501032_0028493 3300049569 Bacteria 3838
592 Ga0501032_0066844 3300049569 Bacteria 2402
593 Ga0501032_0208330 3300049569 Bacteria 1275
594 Ga0501032_0219006 3300049569 Bacteria 1239
595 Ga0501032_0287080 3300049569 Bacteria 1065
596 Ga0501032_0690600 3300049569 Unclassified 647
597 Ga0501032_0710041 3300049569 Bacteria 637
598 Ga0501033_0002118 3300049570 Bacteria 17169
599 Ga0501033_0003652 3300049570 Bacteria 12550
600 Ga0501033_0008546 3300049570 Bacteria 7921
601 Ga0501033_0018864 3300049570 Bacteria 5215
602 Ga0501033_0065358 3300049570 Bacteria 2676
603 Ga0501033_0074498 3300049570 Bacteria 2492
604 Ga0501033_0194356 3300049570 Bacteria 1451
605 Ga0501033_0386954 3300049570 Bacteria 976
606 Ga0501033_0486653 3300049570 Bacteria 854
607 Ga0501033_0496343 3300049570 Unclassified 845
608 Ga0501034_0035157 3300049571 Bacteria 5081
609 Ga0501034_0146603 3300049571 Bacteria 2337
610 Ga0501034_0158532 3300049571 Bacteria 2236
611 Ga0501034_0181610 3300049571 Bacteria 2069
612 Ga0501034_0810797 3300049571 Bacteria 828
613 Ga0501036_0006658 3300049572 Bacteria 9394
614 Ga0501036_0140420 3300049572 Bacteria 2039
615 Ga0501036_0255246 3300049572 Bacteria 1469
616 Ga0501036_0294377 3300049572 Bacteria 1358
617 Ga0501036_0349169 3300049572 Bacteria 1235
618 Ga0501036_0918149 3300049572 Unclassified 718
619 Ga0501037_0008387 3300049573 Bacteria 7577
620 Ga0501037_0042300 3300049573 Bacteria 3348
621 Ga0501037_0042558 3300049573 Bacteria 3337
622 Ga0501037_0083160 3300049573 Bacteria 2319
623 Ga0501037_0209907 3300049573 Bacteria 1374
624 Ga0501037_0395810 3300049573 Bacteria 948
625 Ga0501038_0070728 3300049574 Bacteria 2961
626 Ga0501038_0093566 3300049574 Bacteria 2514
627 Ga0501038_0359204 3300049574 Unclassified 1133
628 Ga0501038_0380807 3300049574 Bacteria 1094
629 Ga0501038_0436386 3300049574 Unclassified 1009
630 Ga0501038_0498142 3300049574 Bacteria 932
631 Ga0501038_0681875 3300049574 Bacteria 771
632 Ga0501038_0746217 3300049574 Unclassified 730
633 Ga0501039_0265636 3300049575 Bacteria 1349
634 Ga0501039_0269245 3300049575 Bacteria 1339
635 Ga0501040_0144033 3300049576 Bacteria 1679
636 Ga0501041_0609078 3300049577 Unclassified 697
637 Ga0501042_0013189 3300049578 Bacteria 5626
638 Ga0501042_0035014 3300049578 Bacteria 3562
639 Ga0501043_0086281 3300049579 Bacteria 2467
640 Ga0501043_0092419 3300049579 Bacteria 2379
641 Ga0501043_0174589 3300049579 Bacteria 1676
642 Ga0501043_0230319 3300049579 Bacteria 1431
643 Ga0501043_0234094 3300049579 Bacteria 1418
644 Ga0501043_0334197 3300049579 Bacteria 1153
645 Ga0501046_0007202 3300049580 Bacteria 9781
646 Ga0501046_0007227 3300049580 Bacteria 9762
647 Ga0501046_0041162 3300049580 Bacteria 3688
648 Ga0501046_0259564 3300049580 Bacteria 1277
649 Ga0501046_0402827 3300049580 Bacteria 988
650 Ga0501046_0444396 3300049580 Bacteria 933
651 Ga0501046_0477407 3300049580 Bacteria 895
652 Ga0501047_0004469 3300049581 Bacteria 13159
653 Ga0501047_0010064 3300049581 Bacteria 8941
654 Ga0501047_0010754 3300049581 Bacteria 8651
655 Ga0501047_0019694 3300049581 Bacteria 6475
656 Ga0501047_0028145 3300049581 Bacteria 5417
657 Ga0501047_0132988 3300049581 Bacteria 2367
658 Ga0501047_0194528 3300049581 Bacteria 1890
659 Ga0501047_0208383 3300049581 Bacteria 1814
660 Ga0501047_0333068 3300049581 Bacteria 1356
661 Ga0501047_0434060 3300049581 Unclassified 1144
662 Ga0501047_0590674 3300049581 Bacteria 933
663 Ga0501047_1101545 3300049581 Bacteria 607
664 Ga0501048_0007103 3300049582 Bacteria 8507
665 Ga0501048_0067362 3300049582 Bacteria 2531
666 Ga0501067_0004896 3300049583 Bacteria 7438
667 Ga0501067_0015446 3300049583 Bacteria 4227
668 Ga0501067_0019884 3300049583 Bacteria 3716
669 Ga0501067_0050090 3300049583 Bacteria 2315
670 Ga0501069_0010544 3300049585 Bacteria 4894
671 Ga0501069_0030096 3300049585 Bacteria 2981
672 Ga0501070_0000111 3300049586 Bacteria 71786
673 Ga0501070_0012304 3300049586 Bacteria 7222
674 Ga0501070_0015773 3300049586 Bacteria 6353
675 Ga0501070_0017330 3300049586 Bacteria 6048
676 Ga0501070_0052121 3300049586 Bacteria 3396
677 Ga0501070_0074206 3300049586 Bacteria 2816
678 Ga0501070_0078606 3300049586 Bacteria 2730
679 Ga0501070_0577531 3300049586 Bacteria 898
680 Ga0501071_0472094 3300049587 Bacteria 961
681 Ga0501072_0016454 3300049588 Bacteria 5678
682 Ga0501072_0781435 3300049588 Unclassified 748
683 Ga0501073_0015989 3300049589 Bacteria 5438
684 Ga0501073_0099611 3300049589 Bacteria 2018
685 Ga0501073_0240222 3300049589 Bacteria 1251
686 Ga0501073_0387471 3300049589 Unclassified 965
687 Ga0501074_0002441 3300049590 Bacteria 12964
688 Ga0501074_0114550 3300049590 Bacteria 1929
689 Ga0501074_0818950 3300049590 Bacteria 656
690 Ga0501074_0985663 3300049590 Unclassified 593
691 Ga0501076_0062316 3300049592 Bacteria 2970
692 Ga0501076_0342376 3300049592 Archaea 1227
693 Ga0501079_0005434 3300049741 Bacteria 9498
694 Ga0501079_0029883 3300049741 Bacteria 4186
695 Ga0501079_0061970 3300049741 Bacteria 2885
696 Ga0501079_0284506 3300049741 Bacteria 1293
697 Ga0501080_0003916 3300049742 Bacteria 13188
698 Ga0501080_0018192 3300049742 Bacteria 6504
699 Ga0501080_0060319 3300049742 Bacteria 3531
700 Ga0501080_0065071 3300049742 Bacteria 3391
701 Ga0501080_0380435 3300049742 Unclassified 1272
702 Ga0501080_0387976 3300049742 Bacteria 1257
703 Ga0501080_1104417 3300049742 Bacteria 684
704 Ga0501083_0014640 3300049744 Bacteria 5483
705 Ga0501083_0034604 3300049744 Bacteria 3454
706 Ga0501083_0302071 3300049744 Bacteria 1041
707 Ga0501035_0002206 3300049822 Bacteria 19336
708 Ga0501035_0002523 3300049822 Bacteria 17906
709 Ga0501035_0005014 3300049822 Bacteria 12538
710 Ga0501035_0016319 3300049822 Bacteria 6851
711 Ga0501035_0049511 3300049822 Bacteria 3765
712 Ga0501035_0066618 3300049822 Bacteria 3196
713 Ga0501035_0140676 3300049822 Bacteria 2099
714 Ga0501035_0145055 3300049822 Bacteria 2062
715 Ga0501035_0180039 3300049822 Bacteria 1821
716 Ga0501035_0237743 3300049822 Bacteria 1550
717 Ga0501044_0003903 3300049823 Bacteria 16713
718 Ga0501044_0006571 3300049823 Bacteria 12839
719 Ga0501044_0007608 3300049823 Bacteria 11911
720 Ga0501044_0037484 3300049823 Bacteria 5067
721 Ga0501044_0050191 3300049823 Bacteria 4306
722 Ga0501044_0056729 3300049823 Bacteria 4021
723 Ga0501044_0098234 3300049823 Bacteria 2948
724 Ga0501044_0152575 3300049823 Bacteria 2292
725 Ga0501044_0212824 3300049823 Bacteria 1886
726 Ga0501044_0218307 3300049823 Bacteria 1858
727 Ga0501044_0293674 3300049823 Bacteria 1556
728 Ga0501044_0321349 3300049823 Bacteria 1472
729 Ga0501044_0334593 3300049823 Bacteria 1436
730 Ga0501044_0455917 3300049823 Bacteria 1184
731 Ga0501044_0661978 3300049823 Bacteria 932
732 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
733 Ga0500643_000027 3300053087 Bacteria 251062
734 Ga0500595_000824 3300053119 Bacteria 17755
735 Ga0500595_064675 3300053119 Bacteria 1096
736 Ga0500642_0193279 3300053130 Bacteria 949
737 Ga0500655_009925 3300053133 Bacteria 1718
738 Ga0500655_014893 3300053133 Bacteria 1424
739 Ga0500559_0173869 3300053136 Bacteria 1013
740 Ga0500559_0187338 3300053136 Bacteria 975
741 Ga0500573_0000032 3300053140 Bacteria 131098
742 Ga0500619_001348 3300053154 Bacteria 4316
743 Ga0500637_0182778 3300053178 Bacteria 1201
744 Ga0501084_0000057 3300054114 Bacteria 87821
745 Ga0501084_0011180 3300054114 Bacteria 7435
746 Ga0501084_0042942 3300054114 Bacteria 3782
747 Ga0501084_0058502 3300054114 Bacteria 3225
748 Ga0501082_0180046 3300060353 Bacteria 1838
749 Ga0501082_0305889 3300060353 Bacteria 1384
750 Ga0501082_0847663 3300060353 Bacteria 799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0158532 Ga0501034_0158532_1210_1683 147
2 3300046691 Ga0495670_0511848 Ga0495670_0511848_175_639 154
3 3300003215 JGI25153J46596_10001002 JGI25153J46596_1000100222 156
4 3300025297 Ga0209758_1000008 Ga0209758_1000008235 156
5 3300037312 Ga0395899_0016522 Ga0395899_0016522_5049_5540 158
6 3300037466 Ga0395898_0009858 Ga0395898_0009858_6572_7063 158
7 3300047320 Ga0495672_0158171 Ga0495672_0158171_127_684 160
8 3300053087 Ga0500643_000027 Ga0500643_000027_91940_92497 160
9 3300005548 Ga0070665_100706971 Ga0070665_1007069712 161
10 3300028379 Ga0268266_10637491 Ga0268266_106374912 161
11 3300025915 Ga0207693_10161513 Ga0207693_101615132 162
12 3300031239 Ga0265328_10078788 Ga0265328_100787882 162
13 3300031249 Ga0265339_10128734 Ga0265339_101287343 162
14 3300031344 Ga0265316_10186012 Ga0265316_101860122 162
15 3300031711 Ga0265314_10231503 Ga0265314_102315032 162
16 3300039450 Ga0436363_1255904 Ga0436363_1255904_4470_4958 162
17 3300046454 Ga0495592_0240183 Ga0495592_0240183_701_1189 162
18 3300046557 Ga0495622_0417614 Ga0495622_0417614_40_528 162
19 3300047319 Ga0495674_0269717 Ga0495674_0269717_52_540 162
20 3300049569 Ga0501032_0028493 Ga0501032_0028493_1374_1862 162
21 3300049571 Ga0501034_0146603 Ga0501034_0146603_1413_1901 162
22 3300049573 Ga0501037_0209907 Ga0501037_0209907_225_713 162
23 3300049581 Ga0501047_0194528 Ga0501047_0194528_1346_1834 162
24 3300049583 Ga0501067_0019884 Ga0501067_0019884_628_1116 162
25 3300049586 Ga0501070_0052121 Ga0501070_0052121_2488_2976 162
26 3300049589 Ga0501073_0387471 Ga0501073_0387471_421_909 162
27 3300049741 Ga0501079_0029883 Ga0501079_0029883_514_1002 162
28 3300049742 Ga0501080_0065071 Ga0501080_0065071_1178_1666 162
29 3300049744 Ga0501083_0034604 Ga0501083_0034604_2594_3082 162
30 3300049822 Ga0501035_0005014 Ga0501035_0005014_2923_3411 162
31 3300049823 Ga0501044_0037484 Ga0501044_0037484_356_844 162
32 3300060353 Ga0501082_0180046 Ga0501082_0180046_548_1036 162
33 3300005347 Ga0070668_101075887 Ga0070668_1010758871 163
34 3300021377 Ga0213874_10022498 Ga0213874_100224982 163
35 3300035089 Ga0373944_0023315 Ga0373944_0023315_1130_1627 163
36 3300035092 Ga0373952_0156240 Ga0373952_0156240_24_524 163
37 3300039437 Ga0436365_1065516 Ga0436365_1065516_609_1106 163
38 3300039450 Ga0436363_0325134 Ga0436363_0325134_997_1494 163
39 3300005577 Ga0068857_100145231 Ga0068857_1001452312 164
40 3300005842 Ga0068858_100004578 Ga0068858_10000457811 164
41 3300025924 Ga0207694_10119641 Ga0207694_101196413 164
42 3300025944 Ga0207661_10330758 Ga0207661_103307582 164
43 3300025949 Ga0207667_10037635 Ga0207667_100376352 164
44 3300026035 Ga0207703_10017787 Ga0207703_100177876 164
45 3300026116 Ga0207674_10155915 Ga0207674_101559152 164
46 3300031711 Ga0265314_10098623 Ga0265314_100986233 164
47 3300035118 Ga0373954_0249841 Ga0373954_0249841_357_851 164
48 3300035724 Ga0373933_0222632 Ga0373933_0222632_155_649 164
49 3300049742 Ga0501080_1104417 Ga0501080_1104417_178_672 164
50 3300039450 Ga0436363_1432904 Ga0436363_1432904_1188_1745 165
51 3300005327 Ga0070658_10180592 Ga0070658_101805921 166
52 3300005335 Ga0070666_10064283 Ga0070666_100642831 166
53 3300005539 Ga0068853_100426349 Ga0068853_1004263492 166
54 3300005548 Ga0070665_100018871 Ga0070665_1000188714 166
55 3300005577 Ga0068857_100220298 Ga0068857_1002202982 166
56 3300005614 Ga0068856_100344713 Ga0068856_1003447132 166
57 3300006237 Ga0097621_100002964 Ga0097621_1000029646 166
58 3300006237 Ga0097621_100566111 Ga0097621_1005661112 166
59 3300006358 Ga0068871_100001250 Ga0068871_1000012503 166
60 3300009148 Ga0105243_10006780 Ga0105243_100067807 166
61 3300009176 Ga0105242_10208294 Ga0105242_102082941 166
62 3300009177 Ga0105248_11499575 Ga0105248_114995751 166
63 3300009545 Ga0105237_11183289 Ga0105237_111832891 166
64 3300009551 Ga0105238_10171582 Ga0105238_101715822 166
65 3300010375 Ga0105239_10383015 Ga0105239_103830152 166
66 3300013297 Ga0157378_11075679 Ga0157378_110756791 166
67 3300013306 Ga0163162_10051883 Ga0163162_100518833 166
68 3300013306 Ga0163162_10129225 Ga0163162_101292252 166
69 3300014325 Ga0163163_10000012 Ga0163163_10000012202 166
70 3300014969 Ga0157376_10231906 Ga0157376_102319062 166
71 3300025903 Ga0207680_10016508 Ga0207680_100165083 166
72 3300025907 Ga0207645_10005584 Ga0207645_100055845 166
73 3300025913 Ga0207695_10652270 Ga0207695_106522702 166
74 3300025919 Ga0207657_10004729 Ga0207657_100047298 166
75 3300025931 Ga0207644_10556631 Ga0207644_105566311 166
76 3300025935 Ga0207709_10014211 Ga0207709_100142113 166
77 3300025935 Ga0207709_10970243 Ga0207709_109702432 166
78 3300025942 Ga0207689_10026374 Ga0207689_100263745 166
79 3300025960 Ga0207651_10074676 Ga0207651_100746763 166
80 3300026023 Ga0207677_10079685 Ga0207677_100796852 166
81 3300026041 Ga0207639_10589740 Ga0207639_105897402 166
82 3300026067 Ga0207678_10605430 Ga0207678_106054302 166
83 3300026067 Ga0207678_10895762 Ga0207678_108957621 166
84 3300026078 Ga0207702_10283906 Ga0207702_102839062 166
85 3300026089 Ga0207648_10009495 Ga0207648_1000949510 166
86 3300026116 Ga0207674_10125019 Ga0207674_101250191 166
87 3300026118 Ga0207675_100597325 Ga0207675_1005973252 166
88 3300028379 Ga0268266_11517902 Ga0268266_115179021 166
89 3300039438 Ga0436360_0650771 Ga0436360_0650771_15_560 166
90 3300046557 Ga0495622_0002344 Ga0495622_0002344_5346_5846 166
91 3300049572 Ga0501036_0349169 Ga0501036_0349169_385_885 166
92 3300049574 Ga0501038_0380807 Ga0501038_0380807_237_737 166
93 3300049581 Ga0501047_1101545 Ga0501047_1101545_22_522 166
94 3300049592 Ga0501076_0062316 Ga0501076_0062316_14_514 166
95 3300049823 Ga0501044_0212824 Ga0501044_0212824_1033_1533 166
96 3300053136 Ga0500559_0187338 Ga0500559_0187338_431_931 166
97 3300048905 Ga0496102_0356471 Ga0496102_0356471_357_866 167
98 3300049570 Ga0501033_0486653 Ga0501033_0486653_135_677 167
99 3300049572 Ga0501036_0294377 Ga0501036_0294377_784_1326 167
100 3300049574 Ga0501038_0681875 Ga0501038_0681875_179_721 167
101 3300049579 Ga0501043_0092419 Ga0501043_0092419_1260_1802 167
102 3300049822 Ga0501035_0016319 Ga0501035_0016319_5771_6313 167
103 3300038443 Ga0395901_1920239 Ga0395901_1920239_19_525 168
104 3300049570 Ga0501033_0496343 Ga0501033_0496343_148_663 168
105 3300049574 Ga0501038_0359204 Ga0501038_0359204_386_901 168
106 3300049577 Ga0501041_0609078 Ga0501041_0609078_90_605 168
107 3300049578 Ga0501042_0013189 Ga0501042_0013189_4772_5287 168
108 3300049582 Ga0501048_0067362 Ga0501048_0067362_360_875 168
109 3300049586 Ga0501070_0017330 Ga0501070_0017330_492_998 168
110 3300049588 Ga0501072_0781435 Ga0501072_0781435_185_700 168
111 3300049590 Ga0501074_0985663 Ga0501074_0985663_58_573 168
112 3300049592 Ga0501076_0342376 Ga0501076_0342376_54_569 168
113 3300049822 Ga0501035_0140676 Ga0501035_0140676_730_1245 168
114 3300035170 Ga0373943_0399499 Ga0373943_0399499_255_779 170
115 3300035725 Ga0373947_0082089 Ga0373947_0082089_777_1301 170
116 3300046472 Ga0495580_0056424 Ga0495580_0056424_949_1473 170
117 3300046683 Ga0495658_0001623 Ga0495658_0001623_7916_8440 170
118 3300049570 Ga0501033_0065358 Ga0501033_0065358_1088_1630 170
119 3300049581 Ga0501047_0333068 Ga0501047_0333068_346_888 170
120 3300005530 Ga0070679_100744142 Ga0070679_1007441422 172
121 3300013306 Ga0163162_10585205 Ga0163162_105852051 172
122 3300025909 Ga0207705_10253476 Ga0207705_102534762 172
123 3300037418 Ga0395900_0555517 Ga0395900_0555517_116_664 173
124 3300049573 Ga0501037_0395810 Ga0501037_0395810_156_683 173
125 3300049579 Ga0501043_0086281 Ga0501043_0086281_24_551 173
126 3300049581 Ga0501047_0590674 Ga0501047_0590674_321_848 173
127 3300049586 Ga0501070_0577531 Ga0501070_0577531_16_543 173
128 3300049823 Ga0501044_0334593 Ga0501044_0334593_268_795 173
129 3300048915 Ga0496112_0224736 Ga0496112_0224736_749_1303 175
130 3300049590 Ga0501074_0818950 Ga0501074_0818950_79_639 177
131 3300049574 Ga0501038_0498142 Ga0501038_0498142_295_861 178
132 3300049583 Ga0501067_0050090 Ga0501067_0050090_1758_2297 178
133 3300049823 Ga0501044_0056729 Ga0501044_0056729_2713_3279 178
134 3300054114 Ga0501084_0000057 Ga0501084_0000057_1826_2365 178
135 3300060353 Ga0501082_0847663 Ga0501082_0847663_158_697 178
136 3300005535 Ga0070684_100413204 Ga0070684_1004132043 179
137 3300005539 Ga0068853_100070770 Ga0068853_1000707705 179
138 3300005616 Ga0068852_100005013 Ga0068852_10000501310 179
139 3300009093 Ga0105240_10080726 Ga0105240_100807264 179
140 3300009174 Ga0105241_10039288 Ga0105241_100392883 179
141 3300009177 Ga0105248_10000001 Ga0105248_100000011595 179
142 3300021377 Ga0213874_10011832 Ga0213874_100118322 179
143 3300025911 Ga0207654_10051395 Ga0207654_100513953 179
144 3300025913 Ga0207695_10023131 Ga0207695_100231317 179
145 3300025941 Ga0207711_10000001 Ga0207711_10000001278 179
146 3300026041 Ga0207639_10001556 Ga0207639_1000155619 179
147 3300026142 Ga0207698_10017662 Ga0207698_100176623 179
148 3300028800 Ga0265338_10000011 Ga0265338_10000011223 179
149 3300031241 Ga0265325_10000009 Ga0265325_10000009102 179
150 3300031242 Ga0265329_10049528 Ga0265329_100495282 179
151 3300031249 Ga0265339_10002153 Ga0265339_100021537 179
152 3300031250 Ga0265331_10002453 Ga0265331_1000245310 179
153 3300031595 Ga0265313_10001052 Ga0265313_1000105224 179
154 3300031711 Ga0265314_10051883 Ga0265314_100518834 179
155 3300031712 Ga0265342_10013703 Ga0265342_100137033 179
156 3300049580 Ga0501046_0477407 Ga0501046_0477407_281_826 179
157 3300049581 Ga0501047_0434060 Ga0501047_0434060_256_801 179
158 3300049586 Ga0501070_0012304 Ga0501070_0012304_3756_4301 179
159 3300049590 Ga0501074_0114550 Ga0501074_0114550_100_642 179
160 3300049742 Ga0501080_0003916 Ga0501080_0003916_9535_10080 179
161 3300053154 Ga0500619_001348 Ga0500619_001348_639_1184 179
162 3300005327 Ga0070658_10160702 Ga0070658_101607022 180
163 3300005329 Ga0070683_100067412 Ga0070683_1000674122 180
164 3300005336 Ga0070680_100000870 Ga0070680_1000008703 180
165 3300005336 Ga0070680_100389688 Ga0070680_1003896882 180
166 3300005344 Ga0070661_100026806 Ga0070661_1000268065 180
167 3300005366 Ga0070659_100995023 Ga0070659_1009950231 180
168 3300005435 Ga0070714_100102534 Ga0070714_1001025342 180
169 3300005458 Ga0070681_10000002 Ga0070681_10000002707 180
170 3300005458 Ga0070681_10759929 Ga0070681_107599291 180
171 3300005530 Ga0070679_100000569 Ga0070679_1000005698 180
172 3300005530 Ga0070679_100257225 Ga0070679_1002572251 180
173 3300005539 Ga0068853_100038034 Ga0068853_1000380343 180
174 3300005563 Ga0068855_100000106 Ga0068855_10000010683 180
175 3300005563 Ga0068855_100758870 Ga0068855_1007588702 180
176 3300005577 Ga0068857_100088072 Ga0068857_1000880723 180
177 3300005614 Ga0068856_100210874 Ga0068856_1002108743 180
178 3300005614 Ga0068856_100252726 Ga0068856_1002527263 180
179 3300005614 Ga0068856_100711434 Ga0068856_1007114341 180
180 3300005616 Ga0068852_100002997 Ga0068852_1000029979 180
181 3300005616 Ga0068852_100003598 Ga0068852_1000035988 180
182 3300005834 Ga0068851_10058114 Ga0068851_100581143 180
183 3300009093 Ga0105240_10000055 Ga0105240_1000005527 180
184 3300009093 Ga0105240_10028212 Ga0105240_100282123 180
185 3300009093 Ga0105240_10187103 Ga0105240_101871034 180
186 3300009093 Ga0105240_10369042 Ga0105240_103690421 180
187 3300009093 Ga0105240_10539060 Ga0105240_105390603 180
188 3300009101 Ga0105247_10005627 Ga0105247_100056278 180
189 3300009174 Ga0105241_10016353 Ga0105241_100163532 180
190 3300009545 Ga0105237_10014301 Ga0105237_1001430110 180
191 3300009545 Ga0105237_10019700 Ga0105237_100197004 180
192 3300009545 Ga0105237_10070274 Ga0105237_100702742 180
193 3300009551 Ga0105238_10003708 Ga0105238_100037083 180
194 3300009551 Ga0105238_10026575 Ga0105238_100265757 180
195 3300009551 Ga0105238_10819796 Ga0105238_108197961 180
196 3300010375 Ga0105239_10034655 Ga0105239_100346553 180
197 3300010375 Ga0105239_10068805 Ga0105239_100688055 180
198 3300010375 Ga0105239_10087689 Ga0105239_100876893 180
199 3300010375 Ga0105239_11134998 Ga0105239_111349982 180
200 3300013105 Ga0157369_10010911 Ga0157369_100109112 180
201 3300013105 Ga0157369_10023221 Ga0157369_100232218 180
202 3300013105 Ga0157369_10444185 Ga0157369_104441852 180
203 3300013105 Ga0157369_10603419 Ga0157369_106034192 180
204 3300013297 Ga0157378_10116865 Ga0157378_101168653 180
205 3300013306 Ga0163162_11201726 Ga0163162_112017262 180
206 3300013307 Ga0157372_11310842 Ga0157372_113108422 180
207 3300014969 Ga0157376_10239375 Ga0157376_102393751 180
208 3300021384 Ga0213876_10000274 Ga0213876_1000027450 180
209 3300025321 Ga0207656_10105605 Ga0207656_101056052 180
210 3300025909 Ga0207705_10004973 Ga0207705_100049735 180
211 3300025911 Ga0207654_10019838 Ga0207654_100198385 180
212 3300025912 Ga0207707_10000002 Ga0207707_10000002251 180
213 3300025913 Ga0207695_10000012 Ga0207695_10000012309 180
214 3300025913 Ga0207695_10003622 Ga0207695_100036225 180
215 3300025913 Ga0207695_10022595 Ga0207695_100225959 180
216 3300025913 Ga0207695_10130973 Ga0207695_101309734 180
217 3300025914 Ga0207671_10041489 Ga0207671_100414895 180
218 3300025914 Ga0207671_10054219 Ga0207671_100542192 180
219 3300025914 Ga0207671_10121079 Ga0207671_101210793 180
220 3300025917 Ga0207660_10000296 Ga0207660_100002963 180
221 3300025920 Ga0207649_10017732 Ga0207649_100177322 180
222 3300025921 Ga0207652_10010383 Ga0207652_100103838 180
223 3300025921 Ga0207652_10020028 Ga0207652_100200286 180
224 3300025924 Ga0207694_10000006 Ga0207694_10000006356 180
225 3300025924 Ga0207694_10048560 Ga0207694_100485604 180
226 3300025929 Ga0207664_10016200 Ga0207664_100162006 180
227 3300025944 Ga0207661_10505439 Ga0207661_105054392 180
228 3300025949 Ga0207667_10000026 Ga0207667_1000002656 180
229 3300025949 Ga0207667_10002838 Ga0207667_1000283811 180
230 3300026041 Ga0207639_10229617 Ga0207639_102296172 180
231 3300026041 Ga0207639_10606378 Ga0207639_106063782 180
232 3300026078 Ga0207702_10541169 Ga0207702_105411692 180
233 3300026116 Ga0207674_10087310 Ga0207674_100873104 180
234 3300026142 Ga0207698_10001893 Ga0207698_100018937 180
235 3300026142 Ga0207698_10025195 Ga0207698_100251955 180
236 3300028379 Ga0268266_10156033 Ga0268266_101560333 180
237 3300028577 Ga0265318_10000444 Ga0265318_1000044422 180
238 3300028800 Ga0265338_10051307 Ga0265338_100513074 180
239 3300031241 Ga0265325_10033081 Ga0265325_100330815 180
240 3300031247 Ga0265340_10004479 Ga0265340_1000447911 180
241 3300031249 Ga0265339_10133571 Ga0265339_101335712 180
242 3300031344 Ga0265316_10093425 Ga0265316_100934254 180
243 3300031344 Ga0265316_10118156 Ga0265316_101181563 180
244 3300031595 Ga0265313_10100612 Ga0265313_101006121 180
245 3300031730 Ga0307516_10071158 Ga0307516_100711584 180
246 3300035113 Ga0373936_0127490 Ga0373936_0127490_135_677 180
247 3300036401 Ga0373937_0300931 Ga0373937_0300931_750_1298 180
248 3300039437 Ga0436365_0257402 Ga0436365_0257402_118533_119081 180
249 3300039437 Ga0436365_0483034 Ga0436365_0483034_1580_2128 180
250 3300039453 Ga0436362_0130343 Ga0436362_0130343_2201_2749 180
251 3300046454 Ga0495592_0635441 Ga0495592_0635441_46_597 180
252 3300046477 Ga0495664_0016439 Ga0495664_0016439_1329_1877 180
253 3300046477 Ga0495664_0280748 Ga0495664_0280748_53_604 180
254 3300046516 Ga0495628_0245709 Ga0495628_0245709_178_726 180
255 3300046516 Ga0495628_0506971 Ga0495628_0506971_98_640 180
256 3300046529 Ga0495652_0212461 Ga0495652_0212461_276_824 180
257 3300046529 Ga0495652_0692939 Ga0495652_0692939_88_636 180
258 3300046536 Ga0495587_0066469 Ga0495587_0066469_510_1052 180
259 3300046536 Ga0495587_0115867 Ga0495587_0115867_375_926 180
260 3300046543 Ga0495645_0013632 Ga0495645_0013632_3420_3968 180
261 3300046543 Ga0495645_0039080 Ga0495645_0039080_1407_1958 180
262 3300046678 Ga0495599_0278917 Ga0495599_0278917_115_657 180
263 3300046679 Ga0495623_0244724 Ga0495623_0244724_10_558 180
264 3300047317 Ga0495604_0537737 Ga0495604_0537737_25_567 180
265 3300047317 Ga0495604_0598589 Ga0495604_0598589_63_605 180
266 3300048910 Ga0496107_0700792 Ga0496107_0700792_182_724 180
267 3300048918 Ga0496115_0728451 Ga0496115_0728451_110_652 180
268 3300049460 Ga0495682_0001351 Ga0495682_0001351_1625_2176 180
269 3300049569 Ga0501032_0208330 Ga0501032_0208330_387_929 180
270 3300049570 Ga0501033_0003652 Ga0501033_0003652_4220_4762 180
271 3300049572 Ga0501036_0255246 Ga0501036_0255246_219_761 180
272 3300049573 Ga0501037_0083160 Ga0501037_0083160_301_843 180
273 3300049575 Ga0501039_0265636 Ga0501039_0265636_421_963 180
274 3300049579 Ga0501043_0174589 Ga0501043_0174589_1053_1595 180
275 3300049581 Ga0501047_0004469 Ga0501047_0004469_12206_12754 180
276 3300049581 Ga0501047_0019694 Ga0501047_0019694_5886_6428 180
277 3300049583 Ga0501067_0015446 Ga0501067_0015446_2372_2920 180
278 3300049586 Ga0501070_0078606 Ga0501070_0078606_1641_2189 180
279 3300049588 Ga0501072_0016454 Ga0501072_0016454_233_781 180
280 3300049589 Ga0501073_0015989 Ga0501073_0015989_233_781 180
281 3300049822 Ga0501035_0180039 Ga0501035_0180039_61_603 180
282 3300049823 Ga0501044_0006571 Ga0501044_0006571_4997_5539 180
283 3300053119 Ga0500595_064675 Ga0500595_064675_30_572 180
284 3300053133 Ga0500655_009925 Ga0500655_009925_387_938 180
285 3300053133 Ga0500655_014893 Ga0500655_014893_621_1172 180
286 3300054114 Ga0501084_0058502 Ga0501084_0058502_682_1230 180
287 3300005327 Ga0070658_10081381 Ga0070658_100813812 181
288 3300005336 Ga0070680_100160327 Ga0070680_1001603273 181
289 3300005339 Ga0070660_100018798 Ga0070660_1000187982 181
290 3300005341 Ga0070691_10005590 Ga0070691_100055904 181
291 3300005366 Ga0070659_100072331 Ga0070659_1000723313 181
292 3300005439 Ga0070711_100574128 Ga0070711_1005741282 181
293 3300005455 Ga0070663_100077387 Ga0070663_1000773874 181
294 3300005614 Ga0068856_100489925 Ga0068856_1004899252 181
295 3300006358 Ga0068871_100637050 Ga0068871_1006370501 181
296 3300009551 Ga0105238_10011779 Ga0105238_100117793 181
297 3300013307 Ga0157372_10018787 Ga0157372_100187878 181
298 3300013307 Ga0157372_10067384 Ga0157372_100673842 181
299 3300014969 Ga0157376_10215293 Ga0157376_102152932 181
300 3300021384 Ga0213876_10000349 Ga0213876_1000034943 181
301 3300025909 Ga0207705_10000058 Ga0207705_10000058133 181
302 3300025912 Ga0207707_10001851 Ga0207707_1000185127 181
303 3300025915 Ga0207693_10197238 Ga0207693_101972383 181
304 3300025917 Ga0207660_10003913 Ga0207660_100039135 181
305 3300025919 Ga0207657_10001163 Ga0207657_1000116313 181
306 3300025921 Ga0207652_10017999 Ga0207652_100179995 181
307 3300025924 Ga0207694_10014783 Ga0207694_100147832 181
308 3300025932 Ga0207690_10012687 Ga0207690_100126878 181
309 3300025949 Ga0207667_10034264 Ga0207667_1003426410 181
310 3300026067 Ga0207678_10038547 Ga0207678_100385472 181
311 3300026078 Ga0207702_10186477 Ga0207702_101864773 181
312 3300026078 Ga0207702_10570803 Ga0207702_105708032 181
313 3300031711 Ga0265314_10004805 Ga0265314_100048057 181
314 3300035410 Ga0373924_0068382 Ga0373924_0068382_400_978 181
315 3300035692 Ga0373935_0205258 Ga0373935_0205258_243_821 181
316 3300035725 Ga0373947_0005370 Ga0373947_0005370_5336_5914 181
317 3300037068 Ga0373925_0012671 Ga0373925_0012671_2990_3568 181
318 3300039437 Ga0436365_0298223 Ga0436365_0298223_38325_38885 181
319 3300039450 Ga0436363_0444918 Ga0436363_0444918_79_639 181
320 3300045976 Ga0466967_0249353 Ga0466967_0249353_742_1302 181
321 3300047319 Ga0495674_0455199 Ga0495674_0455199_174_752 181
322 3300047320 Ga0495672_0213630 Ga0495672_0213630_106_705 181
323 3300049568 Ga0501031_0098537 Ga0501031_0098537_639_1193 181
324 3300049568 Ga0501031_0442113 Ga0501031_0442113_15_569 181
325 3300049569 Ga0501032_0066844 Ga0501032_0066844_1342_1896 181
326 3300049569 Ga0501032_0690600 Ga0501032_0690600_55_609 181
327 3300049569 Ga0501032_0710041 Ga0501032_0710041_32_586 181
328 3300049570 Ga0501033_0074498 Ga0501033_0074498_86_640 181
329 3300049573 Ga0501037_0042300 Ga0501037_0042300_1694_2248 181
330 3300049574 Ga0501038_0093566 Ga0501038_0093566_405_959 181
331 3300049574 Ga0501038_0436386 Ga0501038_0436386_183_737 181
332 3300049579 Ga0501043_0230319 Ga0501043_0230319_639_1193 181
333 3300049580 Ga0501046_0402827 Ga0501046_0402827_169_723 181
334 3300049581 Ga0501047_0208383 Ga0501047_0208383_629_1183 181
335 3300049585 Ga0501069_0030096 Ga0501069_0030096_732_1286 181
336 3300049586 Ga0501070_0000111 Ga0501070_0000111_4212_4766 181
337 3300049741 Ga0501079_0061970 Ga0501079_0061970_1400_1954 181
338 3300049742 Ga0501080_0018192 Ga0501080_0018192_1112_1666 181
339 3300049822 Ga0501035_0002206 Ga0501035_0002206_7736_8290 181
340 3300049822 Ga0501035_0049511 Ga0501035_0049511_906_1460 181
341 3300049823 Ga0501044_0003903 Ga0501044_0003903_1614_2168 181
342 3300049823 Ga0501044_0321349 Ga0501044_0321349_780_1334 181
343 3300049823 Ga0501044_0661978 Ga0501044_0661978_339_893 181
344 3300005327 Ga0070658_10013783 Ga0070658_100137833 182
345 3300005329 Ga0070683_100093250 Ga0070683_1000932502 182
346 3300005336 Ga0070680_100019997 Ga0070680_1000199974 182
347 3300005339 Ga0070660_100026293 Ga0070660_1000262933 182
348 3300005341 Ga0070691_10000082 Ga0070691_1000008226 182
349 3300005344 Ga0070661_100054716 Ga0070661_1000547163 182
350 3300005434 Ga0070709_10000238 Ga0070709_1000023839 182
351 3300005434 Ga0070709_10062345 Ga0070709_100623452 182
352 3300005435 Ga0070714_100031391 Ga0070714_1000313915 182
353 3300005436 Ga0070713_100000011 Ga0070713_10000001181 182
354 3300005439 Ga0070711_100103191 Ga0070711_1001031914 182
355 3300005458 Ga0070681_10030628 Ga0070681_100306285 182
356 3300005458 Ga0070681_10151923 Ga0070681_101519234 182
357 3300005458 Ga0070681_10550473 Ga0070681_105504732 182
358 3300005530 Ga0070679_100111217 Ga0070679_1001112173 182
359 3300005530 Ga0070679_100615794 Ga0070679_1006157942 182
360 3300005530 Ga0070679_101198240 Ga0070679_1011982401 182
361 3300005535 Ga0070684_100041676 Ga0070684_1000416764 182
362 3300005539 Ga0068853_100108211 Ga0068853_1001082112 182
363 3300005546 Ga0070696_100028174 Ga0070696_1000281745 182
364 3300005547 Ga0070693_100395766 Ga0070693_1003957661 182
365 3300005548 Ga0070665_100002597 Ga0070665_10000259723 182
366 3300005563 Ga0068855_100201419 Ga0068855_1002014191 182
367 3300005577 Ga0068857_100005182 Ga0068857_10000518212 182
368 3300005577 Ga0068857_100184306 Ga0068857_1001843062 182
369 3300005614 Ga0068856_100000964 Ga0068856_10000096416 182
370 3300005614 Ga0068856_100003424 Ga0068856_1000034245 182
371 3300005614 Ga0068856_100133424 Ga0068856_1001334243 182
372 3300005616 Ga0068852_100005817 Ga0068852_1000058175 182
373 3300005616 Ga0068852_100244694 Ga0068852_1002446943 182
374 3300005844 Ga0068862_100701224 Ga0068862_1007012242 182
375 3300006173 Ga0070716_100514844 Ga0070716_1005148442 182
376 3300006175 Ga0070712_100000014 Ga0070712_10000001482 182
377 3300006358 Ga0068871_100403905 Ga0068871_1004039052 182
378 3300006914 Ga0075436_100000047 Ga0075436_10000004747 182
379 3300006914 Ga0075436_100031385 Ga0075436_1000313852 182
380 3300007076 Ga0075435_100095705 Ga0075435_1000957054 182
381 3300009093 Ga0105240_10000355 Ga0105240_1000035539 182
382 3300009093 Ga0105240_10179345 Ga0105240_101793454 182
383 3300009093 Ga0105240_10212523 Ga0105240_102125233 182
384 3300009093 Ga0105240_10274319 Ga0105240_102743192 182
385 3300009093 Ga0105240_10318352 Ga0105240_103183522 182
386 3300009093 Ga0105240_11587609 Ga0105240_115876091 182
387 3300009174 Ga0105241_10028509 Ga0105241_100285095 182
388 3300009545 Ga0105237_10008237 Ga0105237_1000823714 182
389 3300009551 Ga0105238_10011985 Ga0105238_100119858 182
390 3300009551 Ga0105238_10127064 Ga0105238_101270643 182
391 3300009551 Ga0105238_10996179 Ga0105238_109961792 182
392 3300010375 Ga0105239_10072584 Ga0105239_100725842 182
393 3300010375 Ga0105239_10921580 Ga0105239_109215801 182
394 3300010375 Ga0105239_11022513 Ga0105239_110225132 182
395 3300013100 Ga0157373_10003903 Ga0157373_100039035 182
396 3300013104 Ga0157370_10000280 Ga0157370_1000028016 182
397 3300013104 Ga0157370_10280808 Ga0157370_102808082 182
398 3300013104 Ga0157370_10372649 Ga0157370_103726493 182
399 3300013105 Ga0157369_10004867 Ga0157369_1000486714 182
400 3300013105 Ga0157369_10218750 Ga0157369_102187502 182
401 3300013296 Ga0157374_10028010 Ga0157374_100280104 182
402 3300013297 Ga0157378_10369347 Ga0157378_103693472 182
403 3300013306 Ga0163162_10084081 Ga0163162_100840815 182
404 3300013307 Ga0157372_10008076 Ga0157372_100080765 182
405 3300014968 Ga0157379_10001126 Ga0157379_1000112620 182
406 3300014968 Ga0157379_10001288 Ga0157379_100012884 182
407 3300025906 Ga0207699_10000233 Ga0207699_100002334 182
408 3300025906 Ga0207699_10050030 Ga0207699_100500302 182
409 3300025909 Ga0207705_10013975 Ga0207705_100139754 182
410 3300025911 Ga0207654_10028143 Ga0207654_100281434 182
411 3300025912 Ga0207707_10131316 Ga0207707_101313163 182
412 3300025912 Ga0207707_10132852 Ga0207707_101328521 182
413 3300025912 Ga0207707_10367173 Ga0207707_103671732 182
414 3300025913 Ga0207695_10016906 Ga0207695_100169067 182
415 3300025913 Ga0207695_10084002 Ga0207695_100840024 182
416 3300025913 Ga0207695_10111558 Ga0207695_101115583 182
417 3300025913 Ga0207695_10210009 Ga0207695_102100092 182
418 3300025913 Ga0207695_10219053 Ga0207695_102190531 182
419 3300025914 Ga0207671_10074643 Ga0207671_100746432 182
420 3300025915 Ga0207693_10000018 Ga0207693_1000001835 182
421 3300025916 Ga0207663_10075064 Ga0207663_100750642 182
422 3300025917 Ga0207660_10059809 Ga0207660_100598093 182
423 3300025919 Ga0207657_10048575 Ga0207657_100485754 182
424 3300025920 Ga0207649_10060208 Ga0207649_100602083 182
425 3300025924 Ga0207694_10021944 Ga0207694_100219444 182
426 3300025928 Ga0207700_10000005 Ga0207700_1000000546 182
427 3300025929 Ga0207664_10014515 Ga0207664_100145153 182
428 3300025944 Ga0207661_10511385 Ga0207661_105113852 182
429 3300025949 Ga0207667_10007703 Ga0207667_1000770312 182
430 3300025949 Ga0207667_10035769 Ga0207667_100357696 182
431 3300025981 Ga0207640_10492173 Ga0207640_104921732 182
432 3300026041 Ga0207639_10159886 Ga0207639_101598863 182
433 3300026078 Ga0207702_10000173 Ga0207702_100001734 182
434 3300026078 Ga0207702_10001080 Ga0207702_1000108018 182
435 3300026078 Ga0207702_10785095 Ga0207702_107850952 182
436 3300026078 Ga0207702_10967097 Ga0207702_109670971 182
437 3300026078 Ga0207702_11332994 Ga0207702_113329941 182
438 3300026116 Ga0207674_10000112 Ga0207674_1000011239 182
439 3300026116 Ga0207674_10217525 Ga0207674_102175252 182
440 3300026142 Ga0207698_10007028 Ga0207698_100070287 182
441 3300026142 Ga0207698_10896152 Ga0207698_108961522 182
442 3300028379 Ga0268266_10000463 Ga0268266_100004637 182
443 3300028800 Ga0265338_10001087 Ga0265338_1000108725 182
444 3300028800 Ga0265338_10072489 Ga0265338_100724892 182
445 3300031235 Ga0265330_10009167 Ga0265330_100091676 182
446 3300031235 Ga0265330_10067547 Ga0265330_100675472 182
447 3300031238 Ga0265332_10195710 Ga0265332_101957102 182
448 3300031238 Ga0265332_10250540 Ga0265332_102505402 182
449 3300031240 Ga0265320_10003153 Ga0265320_1000315312 182
450 3300031241 Ga0265325_10000094 Ga0265325_1000009460 182
451 3300031241 Ga0265325_10002838 Ga0265325_100028382 182
452 3300031247 Ga0265340_10000159 Ga0265340_1000015911 182
453 3300031247 Ga0265340_10000562 Ga0265340_100005629 182
454 3300031247 Ga0265340_10006207 Ga0265340_100062077 182
455 3300031249 Ga0265339_10007160 Ga0265339_100071605 182
456 3300031249 Ga0265339_10008384 Ga0265339_100083842 182
457 3300031249 Ga0265339_10048309 Ga0265339_100483092 182
458 3300031250 Ga0265331_10000009 Ga0265331_10000009253 182
459 3300031344 Ga0265316_10004977 Ga0265316_100049773 182
460 3300031344 Ga0265316_10020381 Ga0265316_100203814 182
461 3300031344 Ga0265316_10388159 Ga0265316_103881592 182
462 3300031595 Ga0265313_10043318 Ga0265313_100433183 182
463 3300031711 Ga0265314_10004872 Ga0265314_100048727 182
464 3300031711 Ga0265314_10031751 Ga0265314_100317513 182
465 3300031711 Ga0265314_10057403 Ga0265314_100574034 182
466 3300031711 Ga0265314_10085255 Ga0265314_100852552 182
467 3300031711 Ga0265314_10126486 Ga0265314_101264862 182
468 3300031711 Ga0265314_10133311 Ga0265314_101333112 182
469 3300031712 Ga0265342_10042692 Ga0265342_100426924 182
470 3300031712 Ga0265342_10160731 Ga0265342_101607313 182
471 3300031712 Ga0265342_10218665 Ga0265342_102186652 182
472 3300035086 Ga0373934_0060273 Ga0373934_0060273_81_635 182
473 3300035111 Ga0373923_0026149 Ga0373923_0026149_1188_1742 182
474 3300035112 Ga0373932_0109557 Ga0373932_0109557_136_690 182
475 3300035692 Ga0373935_0230956 Ga0373935_0230956_305_859 182
476 3300035724 Ga0373933_0352929 Ga0373933_0352929_251_805 182
477 3300036401 Ga0373937_0006814 Ga0373937_0006814_4666_5220 182
478 3300037068 Ga0373925_0050470 Ga0373925_0050470_1589_2143 182
479 3300037418 Ga0395900_0088308 Ga0395900_0088308_2201_2749 182
480 3300037466 Ga0395898_0026131 Ga0395898_0026131_1177_1725 182
481 3300038443 Ga0395901_0743540 Ga0395901_0743540_114_662 182
482 3300039438 Ga0436360_1347255 Ga0436360_1347255_1297_1845 182
483 3300044684 Ga0466966_0457464 Ga0466966_0457464_125_673 182
484 3300044842 Ga0466957_0318629 Ga0466957_0318629_456_1004 182
485 3300045976 Ga0466967_0268247 Ga0466967_0268247_509_1057 182
486 3300046472 Ga0495580_0076015 Ga0495580_0076015_1579_2133 182
487 3300046536 Ga0495587_0448709 Ga0495587_0448709_110_670 182
488 3300048913 Ga0496110_1186935 Ga0496110_1186935_22_576 182
489 3300049570 Ga0501033_0008546 Ga0501033_0008546_3723_4271 182
490 3300049571 Ga0501034_0810797 Ga0501034_0810797_53_601 182
491 3300049573 Ga0501037_0042558 Ga0501037_0042558_436_984 182
492 3300049579 Ga0501043_0334197 Ga0501043_0334197_181_729 182
493 3300049580 Ga0501046_0259564 Ga0501046_0259564_196_753 182
494 3300049580 Ga0501046_0444396 Ga0501046_0444396_32_580 182
495 3300049581 Ga0501047_0028145 Ga0501047_0028145_995_1543 182
496 3300049589 Ga0501073_0240222 Ga0501073_0240222_177_725 182
497 3300049742 Ga0501080_0060319 Ga0501080_0060319_283_831 182
498 3300049744 Ga0501083_0302071 Ga0501083_0302071_444_1004 182
499 3300049822 Ga0501035_0237743 Ga0501035_0237743_834_1382 182
500 3300049823 Ga0501044_0050191 Ga0501044_0050191_317_865 182
501 3300049823 Ga0501044_0293674 Ga0501044_0293674_538_1086 182
502 3300050514 nmdc:mga08x19_62_c1 nmdc:mga08x19_62_c1_75152_75706 182
503 3300005436 Ga0070713_100382226 Ga0070713_1003822263 183
504 3300005614 Ga0068856_100254860 Ga0068856_1002548602 183
505 3300009093 Ga0105240_10280267 Ga0105240_102802673 183
506 3300014968 Ga0157379_10098254 Ga0157379_100982542 183
507 3300025906 Ga0207699_10216354 Ga0207699_102163542 183
508 3300025913 Ga0207695_10203598 Ga0207695_102035983 183
509 3300025920 Ga0207649_10000026 Ga0207649_10000026119 183
510 3300025928 Ga0207700_10317230 Ga0207700_103172303 183
511 3300026078 Ga0207702_10266776 Ga0207702_102667762 183
512 3300031249 Ga0265339_10239321 Ga0265339_102393212 183
513 3300031250 Ga0265331_10000008 Ga0265331_10000008238 183
514 3300031251 Ga0265327_10000036 Ga0265327_10000036118 183
515 3300031344 Ga0265316_10025982 Ga0265316_100259826 183
516 3300031711 Ga0265314_10119429 Ga0265314_101194292 183
517 3300046507 Ga0495606_0224960 Ga0495606_0224960_182_733 183
518 3300049580 Ga0501046_0007202 Ga0501046_0007202_3862_4425 183
519 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035205 184
520 3300005328 Ga0070676_10001376 Ga0070676_100013762 184
521 3300005334 Ga0068869_100002394 Ga0068869_1000023945 184
522 3300005334 Ga0068869_100557039 Ga0068869_1005570391 184
523 3300005335 Ga0070666_10006536 Ga0070666_100065363 184
524 3300005335 Ga0070666_10234152 Ga0070666_102341522 184
525 3300005338 Ga0068868_100074643 Ga0068868_1000746433 184
526 3300005338 Ga0068868_100400203 Ga0068868_1004002031 184
527 3300005340 Ga0070689_100141098 Ga0070689_1001410982 184
528 3300005344 Ga0070661_100037883 Ga0070661_1000378833 184
529 3300005344 Ga0070661_100608826 Ga0070661_1006088262 184
530 3300005354 Ga0070675_100338256 Ga0070675_1003382562 184
531 3300005355 Ga0070671_100071315 Ga0070671_1000713152 184
532 3300005364 Ga0070673_100185669 Ga0070673_1001856692 184
533 3300005366 Ga0070659_100018711 Ga0070659_1000187116 184
534 3300005367 Ga0070667_100012865 Ga0070667_1000128655 184
535 3300005367 Ga0070667_100338864 Ga0070667_1003388642 184
536 3300005435 Ga0070714_100844900 Ga0070714_1008449001 184
537 3300005436 Ga0070713_101299615 Ga0070713_1012996151 184
538 3300005456 Ga0070678_100002013 Ga0070678_1000020135 184
539 3300005456 Ga0070678_100031753 Ga0070678_1000317533 184
540 3300005456 Ga0070678_100851611 Ga0070678_1008516112 184
541 3300005457 Ga0070662_100125309 Ga0070662_1001253093 184
542 3300005459 Ga0068867_100014884 Ga0068867_1000148847 184
543 3300005459 Ga0068867_100347906 Ga0068867_1003479063 184
544 3300005459 Ga0068867_100935507 Ga0068867_1009355071 184
545 3300005535 Ga0070684_100089015 Ga0070684_1000890154 184
546 3300005539 Ga0068853_101171351 Ga0068853_1011713511 184
547 3300005539 Ga0068853_101199680 Ga0068853_1011996802 184
548 3300005548 Ga0070665_100049419 Ga0070665_1000494191 184
549 3300005548 Ga0070665_100057758 Ga0070665_1000577585 184
550 3300005548 Ga0070665_100292094 Ga0070665_1002920941 184
551 3300005563 Ga0068855_101203256 Ga0068855_1012032561 184
552 3300005564 Ga0070664_100833273 Ga0070664_1008332731 184
553 3300005617 Ga0068859_100202702 Ga0068859_1002027023 184
554 3300005718 Ga0068866_10026254 Ga0068866_100262542 184
555 3300005719 Ga0068861_100581765 Ga0068861_1005817652 184
556 3300005841 Ga0068863_100201536 Ga0068863_1002015362 184
557 3300005842 Ga0068858_100132435 Ga0068858_1001324353 184
558 3300006237 Ga0097621_100011176 Ga0097621_1000111764 184
559 3300006237 Ga0097621_100019884 Ga0097621_1000198844 184
560 3300006237 Ga0097621_100222939 Ga0097621_1002229392 184
561 3300006237 Ga0097621_100335572 Ga0097621_1003355722 184
562 3300006237 Ga0097621_100578230 Ga0097621_1005782302 184
563 3300006358 Ga0068871_100076324 Ga0068871_1000763244 184
564 3300006358 Ga0068871_100117583 Ga0068871_1001175833 184
565 3300006358 Ga0068871_100143736 Ga0068871_1001437363 184
566 3300006881 Ga0068865_100025832 Ga0068865_1000258324 184
567 3300006931 Ga0097620_100202706 Ga0097620_1002027063 184
568 3300009093 Ga0105240_10038465 Ga0105240_100384652 184
569 3300009093 Ga0105240_10158446 Ga0105240_101584462 184
570 3300009098 Ga0105245_10070841 Ga0105245_100708414 184
571 3300009098 Ga0105245_10133433 Ga0105245_101334332 184
572 3300009174 Ga0105241_10022531 Ga0105241_100225316 184
573 3300009174 Ga0105241_10213252 Ga0105241_102132522 184
574 3300009174 Ga0105241_11026461 Ga0105241_110264611 184
575 3300009177 Ga0105248_10031038 Ga0105248_100310383 184
576 3300009177 Ga0105248_10109932 Ga0105248_101099323 184
577 3300009177 Ga0105248_10860054 Ga0105248_108600541 184
578 3300009545 Ga0105237_10015763 Ga0105237_100157633 184
579 3300009545 Ga0105237_10126897 Ga0105237_101268972 184
580 3300009545 Ga0105237_10167542 Ga0105237_101675422 184
581 3300009551 Ga0105238_10171636 Ga0105238_101716362 184
582 3300009551 Ga0105238_10183728 Ga0105238_101837282 184
583 3300009553 Ga0105249_10017761 Ga0105249_100177617 184
584 3300010375 Ga0105239_10150764 Ga0105239_101507642 184
585 3300010375 Ga0105239_10221464 Ga0105239_102214642 184
586 3300010375 Ga0105239_10384132 Ga0105239_103841323 184
587 3300010375 Ga0105239_10471047 Ga0105239_104710472 184
588 3300010375 Ga0105239_10532578 Ga0105239_105325782 184
589 3300011119 Ga0105246_10009904 Ga0105246_100099043 184
590 3300011119 Ga0105246_10039465 Ga0105246_100394652 184
591 3300013104 Ga0157370_10004453 Ga0157370_1000445314 184
592 3300013104 Ga0157370_11111260 Ga0157370_111112601 184
593 3300013105 Ga0157369_10378540 Ga0157369_103785403 184
594 3300013296 Ga0157374_10025468 Ga0157374_100254684 184
595 3300013296 Ga0157374_10119881 Ga0157374_101198814 184
596 3300013297 Ga0157378_10324537 Ga0157378_103245372 184
597 3300013297 Ga0157378_12127855 Ga0157378_121278551 184
598 3300013306 Ga0163162_10044647 Ga0163162_100446474 184
599 3300013307 Ga0157372_10071967 Ga0157372_100719674 184
600 3300013308 Ga0157375_10022440 Ga0157375_100224402 184
601 3300013308 Ga0157375_10358402 Ga0157375_103584022 184
602 3300013308 Ga0157375_10490806 Ga0157375_104908062 184
603 3300014325 Ga0163163_10533937 Ga0163163_105339372 184
604 3300014326 Ga0157380_10139607 Ga0157380_101396072 184
605 3300014968 Ga0157379_10002345 Ga0157379_100023455 184
606 3300014968 Ga0157379_10014522 Ga0157379_100145226 184
607 3300014968 Ga0157379_10102466 Ga0157379_101024663 184
608 3300014968 Ga0157379_10139661 Ga0157379_101396614 184
609 3300014968 Ga0157379_10155032 Ga0157379_101550322 184
610 3300014969 Ga0157376_10002383 Ga0157376_1000238310 184
611 3300017792 Ga0163161_10003599 Ga0163161_100035993 184
612 3300025231 Ga0207427_104408 Ga0207427_1044082 184
613 3300025261 Ga0209233_1000006 Ga0209233_1000006699 184
614 3300025899 Ga0207642_10042316 Ga0207642_100423163 184
615 3300025899 Ga0207642_10713787 Ga0207642_107137871 184
616 3300025903 Ga0207680_10005414 Ga0207680_100054143 184
617 3300025903 Ga0207680_10288154 Ga0207680_102881542 184
618 3300025911 Ga0207654_10011752 Ga0207654_100117527 184
619 3300025911 Ga0207654_10022256 Ga0207654_100222564 184
620 3300025911 Ga0207654_10135167 Ga0207654_101351673 184
621 3300025911 Ga0207654_10154266 Ga0207654_101542661 184
622 3300025913 Ga0207695_10135676 Ga0207695_101356762 184
623 3300025913 Ga0207695_10161510 Ga0207695_101615102 184
624 3300025914 Ga0207671_10032398 Ga0207671_100323986 184
625 3300025919 Ga0207657_10076217 Ga0207657_100762172 184
626 3300025924 Ga0207694_10044508 Ga0207694_100445084 184
627 3300025927 Ga0207687_10058623 Ga0207687_100586233 184
628 3300025927 Ga0207687_11345223 Ga0207687_113452231 184
629 3300025928 Ga0207700_10225704 Ga0207700_102257042 184
630 3300025931 Ga0207644_10066078 Ga0207644_100660784 184
631 3300025932 Ga0207690_10151761 Ga0207690_101517613 184
632 3300025933 Ga0207706_10141251 Ga0207706_101412511 184
633 3300025934 Ga0207686_10020821 Ga0207686_100208214 184
634 3300025934 Ga0207686_10118851 Ga0207686_101188513 184
635 3300025936 Ga0207670_10480591 Ga0207670_104805911 184
636 3300025937 Ga0207669_10371373 Ga0207669_103713733 184
637 3300025938 Ga0207704_10069864 Ga0207704_100698643 184
638 3300025938 Ga0207704_10596202 Ga0207704_105962022 184
639 3300025941 Ga0207711_10013219 Ga0207711_100132194 184
640 3300025941 Ga0207711_10776377 Ga0207711_107763772 184
641 3300025942 Ga0207689_10172354 Ga0207689_101723543 184
642 3300025942 Ga0207689_10195534 Ga0207689_101955342 184
643 3300025944 Ga0207661_10317265 Ga0207661_103172652 184
644 3300025945 Ga0207679_10327116 Ga0207679_103271161 184
645 3300025949 Ga0207667_10963687 Ga0207667_109636872 184
646 3300025961 Ga0207712_10014867 Ga0207712_100148673 184
647 3300025961 Ga0207712_10317962 Ga0207712_103179622 184
648 3300025981 Ga0207640_10040754 Ga0207640_100407543 184
649 3300025986 Ga0207658_10023373 Ga0207658_100233733 184
650 3300026023 Ga0207677_10004318 Ga0207677_100043186 184
651 3300026023 Ga0207677_10235130 Ga0207677_102351302 184
652 3300026023 Ga0207677_10764053 Ga0207677_107640532 184
653 3300026035 Ga0207703_10017934 Ga0207703_100179346 184
654 3300026035 Ga0207703_10108592 Ga0207703_101085923 184
655 3300026041 Ga0207639_10338157 Ga0207639_103381573 184
656 3300026041 Ga0207639_11024687 Ga0207639_110246871 184
657 3300026075 Ga0207708_11099144 Ga0207708_110991442 184
658 3300026078 Ga0207702_11721360 Ga0207702_117213601 184
659 3300026089 Ga0207648_10115605 Ga0207648_101156054 184
660 3300026121 Ga0207683_10003082 Ga0207683_100030826 184
661 3300026121 Ga0207683_10049440 Ga0207683_100494403 184
662 3300028379 Ga0268266_10079718 Ga0268266_100797184 184
663 3300028379 Ga0268266_10172741 Ga0268266_101727413 184
664 3300028379 Ga0268266_10524252 Ga0268266_105242522 184
665 3300028379 Ga0268266_10551484 Ga0268266_105514842 184
666 3300028379 Ga0268266_11027791 Ga0268266_110277912 184
667 3300028379 Ga0268266_11192895 Ga0268266_111928952 184
668 3300028800 Ga0265338_10072660 Ga0265338_100726603 184
669 3300031239 Ga0265328_10022854 Ga0265328_100228542 184
670 3300031241 Ga0265325_10002373 Ga0265325_100023732 184
671 3300031241 Ga0265325_10002474 Ga0265325_1000247413 184
672 3300031247 Ga0265340_10180493 Ga0265340_101804931 184
673 3300031249 Ga0265339_10026142 Ga0265339_100261424 184
674 3300031250 Ga0265331_10199879 Ga0265331_101998792 184
675 3300031595 Ga0265313_10002778 Ga0265313_1000277812 184
676 3300031595 Ga0265313_10137862 Ga0265313_101378622 184
677 3300031616 Ga0307508_10321667 Ga0307508_103216672 184
678 3300031711 Ga0265314_10001062 Ga0265314_1000106222 184
679 3300031711 Ga0265314_10086371 Ga0265314_100863712 184
680 3300031711 Ga0265314_10161231 Ga0265314_101612312 184
681 3300031712 Ga0265342_10007158 Ga0265342_100071588 184
682 3300031730 Ga0307516_10061230 Ga0307516_100612303 184
683 3300039437 Ga0436365_0570483 Ga0436365_0570483_344_901 184
684 3300039437 Ga0436365_1223073 Ga0436365_1223073_329_886 184
685 3300041452 Ga0451793_0085511 Ga0451793_0085511_284_838 184
686 3300041458 Ga0451798_0040364 Ga0451798_0040364_114_668 184
687 3300041512 Ga0451853_0112512 Ga0451853_0112512_193_747 184
688 3300046492 Ga0495585_0281721 Ga0495585_0281721_91_645 184
689 3300046538 Ga0495609_0017425 Ga0495609_0017425_1959_2513 184
690 3300046615 Ga0495656_0159491 Ga0495656_0159491_135_689 184
691 3300046663 Ga0495635_0238754 Ga0495635_0238754_481_1035 184
692 3300046684 Ga0495669_0325374 Ga0495669_0325374_69_623 184
693 3300046794 Ga0495589_0027867 Ga0495589_0027867_195_749 184
694 3300047318 Ga0495636_0032689 Ga0495636_0032689_133_687 184
695 3300047321 Ga0495676_0156074 Ga0495676_0156074_1027_1581 184
696 3300048924 Ga0496121_0000987 Ga0496121_0000987_3233_3790 184
697 3300049568 Ga0501031_0003423 Ga0501031_0003423_6744_7298 184
698 3300049569 Ga0501032_0007623 Ga0501032_0007623_4954_5508 184
699 3300049569 Ga0501032_0219006 Ga0501032_0219006_670_1224 184
700 3300049569 Ga0501032_0287080 Ga0501032_0287080_104_661 184
701 3300049570 Ga0501033_0002118 Ga0501033_0002118_1754_2323 184
702 3300049570 Ga0501033_0018864 Ga0501033_0018864_3128_3682 184
703 3300049570 Ga0501033_0194356 Ga0501033_0194356_153_707 184
704 3300049570 Ga0501033_0386954 Ga0501033_0386954_33_587 184
705 3300049571 Ga0501034_0035157 Ga0501034_0035157_3700_4254 184
706 3300049571 Ga0501034_0181610 Ga0501034_0181610_1451_2005 184
707 3300049572 Ga0501036_0006658 Ga0501036_0006658_4084_4638 184
708 3300049572 Ga0501036_0140420 Ga0501036_0140420_29_583 184
709 3300049572 Ga0501036_0918149 Ga0501036_0918149_81_635 184
710 3300049573 Ga0501037_0008387 Ga0501037_0008387_5811_6365 184
711 3300049574 Ga0501038_0070728 Ga0501038_0070728_1013_1567 184
712 3300049574 Ga0501038_0746217 Ga0501038_0746217_23_577 184
713 3300049575 Ga0501039_0269245 Ga0501039_0269245_718_1272 184
714 3300049576 Ga0501040_0144033 Ga0501040_0144033_634_1188 184
715 3300049578 Ga0501042_0035014 Ga0501042_0035014_157_711 184
716 3300049579 Ga0501043_0234094 Ga0501043_0234094_520_1074 184
717 3300049580 Ga0501046_0007227 Ga0501046_0007227_161_715 184
718 3300049580 Ga0501046_0041162 Ga0501046_0041162_545_1102 184
719 3300049581 Ga0501047_0010064 Ga0501047_0010064_5985_6554 184
720 3300049581 Ga0501047_0010754 Ga0501047_0010754_3367_3921 184
721 3300049581 Ga0501047_0132988 Ga0501047_0132988_997_1554 184
722 3300049582 Ga0501048_0007103 Ga0501048_0007103_2154_2708 184
723 3300049583 Ga0501067_0004896 Ga0501067_0004896_2382_2936 184
724 3300049585 Ga0501069_0010544 Ga0501069_0010544_3911_4465 184
725 3300049586 Ga0501070_0015773 Ga0501070_0015773_186_740 184
726 3300049586 Ga0501070_0074206 Ga0501070_0074206_872_1426 184
727 3300049587 Ga0501071_0472094 Ga0501071_0472094_169_723 184
728 3300049589 Ga0501073_0099611 Ga0501073_0099611_856_1410 184
729 3300049590 Ga0501074_0002441 Ga0501074_0002441_1341_1895 184
730 3300049741 Ga0501079_0005434 Ga0501079_0005434_2507_3061 184
731 3300049741 Ga0501079_0284506 Ga0501079_0284506_547_1101 184
732 3300049742 Ga0501080_0380435 Ga0501080_0380435_377_931 184
733 3300049742 Ga0501080_0387976 Ga0501080_0387976_390_944 184
734 3300049744 Ga0501083_0014640 Ga0501083_0014640_4296_4853 184
735 3300049822 Ga0501035_0002523 Ga0501035_0002523_14966_15535 184
736 3300049822 Ga0501035_0066618 Ga0501035_0066618_2355_2909 184
737 3300049822 Ga0501035_0145055 Ga0501035_0145055_116_673 184
738 3300049823 Ga0501044_0007608 Ga0501044_0007608_847_1416 184
739 3300049823 Ga0501044_0098234 Ga0501044_0098234_24_578 184
740 3300049823 Ga0501044_0152575 Ga0501044_0152575_1148_1702 184
741 3300049823 Ga0501044_0218307 Ga0501044_0218307_353_907 184
742 3300049823 Ga0501044_0455917 Ga0501044_0455917_262_816 184
743 3300053119 Ga0500595_000824 Ga0500595_000824_1439_1993 184
744 3300053130 Ga0500642_0193279 Ga0500642_0193279_43_597 184
745 3300053136 Ga0500559_0173869 Ga0500559_0173869_426_980 184
746 3300053140 Ga0500573_0000032 Ga0500573_0000032_14341_14895 184
747 3300053178 Ga0500637_0182778 Ga0500637_0182778_112_666 184
748 3300054114 Ga0501084_0011180 Ga0501084_0011180_1023_1577 184
749 3300054114 Ga0501084_0042942 Ga0501084_0042942_2088_2645 184
750 3300060353 Ga0501082_0305889 Ga0501082_0305889_638_1195 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03232

COQ7

Ubiquinone biosynthesis protein COQ7

29

195

0.97

PF02915

Rubrerythrin

Rubrerythrin

35

189

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.922 16 184
7sss-assembly1.cif.gz_H structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy 0.9035 16 184
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.8951 16 184
7sss-assembly1.cif.gz_H structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy 0.8782 16 184
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.8288 16 155
ID Description Score Start End Superfamily
af_Q9W3W4_54_201_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9521 19 165 1.20.1260.10
af_P41735_52_233_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.9514 17 184 3.15.10.10
af_Q54VB3_38_194_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9502 16 161 1.20.1260.10
af_F1QW05_54_223_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.949 16 184 1.20.1260.10
af_F1QW05_54_223_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9381 16 184 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A840I3X4-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9913 16 184 GO:0005886
GO:0006744
GO:0008682
GO:0046872
AF-B9KI23-F1-model_v4 Ubiquinone biosynthesis protein (Coq7) 0.984 61 184 GO:0006744
GO:0008682
GO:0016020
GO:0046872
AF-A0A2G2LIL8-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9819 16 184 GO:0005886
GO:0006744
GO:0008682
GO:0046872
AF-C6XLU2-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9815 16 184 GO:0005886
GO:0006744
GO:0008682
GO:0046872
AF-A0A7V8D9A1-F1-model_v4 Ubiquinone biosynthesis monooxygenase Coq7 0.9809 82 184 GO:0006744
GO:0008682

Feature Viewer

pLDDT pTM Quality
93.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map