F479032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 750 | 249 | 750 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100382226|Ga0070713_1003822263 |
| Length | 198 |
| Sequence | MAARRKEKFAAPKRMRGQRPQAPGSAAKDDIEAMIRVDHAGEYGAVRIYEGQLAVLSARPGSARAAAAIKRMSDQEQRHLARFDALVNERRVRPTALEPVWRLAGFTLGAVTALLGEKSAMACTAAVEQVIDEHYASQLERLAHDKDLQKTIEDFRKDEVAHRDEALSHGAAEAPGFKIMSEAIKAGCRLAIKLSERI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 152 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 241 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 242 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 243 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 244 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 245 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 246 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 247 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 248 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.13 |
| Nodule | 0 |
| Rhizoplane | 0.93 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 2 | JGI25153J46596_10001002 | 3300003215 | Bacteria | 17171 |
| 3 | Ga0070658_10013783 | 3300005327 | Bacteria | 6487 |
| 4 | Ga0070658_10081381 | 3300005327 | Bacteria | 2660 |
| 5 | Ga0070658_10160702 | 3300005327 | Bacteria | 1884 |
| 6 | Ga0070658_10180592 | 3300005327 | Bacteria | 1775 |
| 7 | Ga0070676_10001376 | 3300005328 | Bacteria | 12257 |
| 8 | Ga0070683_100067412 | 3300005329 | Bacteria | 3334 |
| 9 | Ga0070683_100093250 | 3300005329 | Bacteria | 2829 |
| 10 | Ga0068869_100002394 | 3300005334 | Bacteria | 11301 |
| 11 | Ga0068869_100557039 | 3300005334 | Bacteria | 964 |
| 12 | Ga0070666_10006536 | 3300005335 | Bacteria | 7162 |
| 13 | Ga0070666_10064283 | 3300005335 | Bacteria | 2488 |
| 14 | Ga0070666_10234152 | 3300005335 | Bacteria | 1297 |
| 15 | Ga0070680_100000870 | 3300005336 | Bacteria | 21436 |
| 16 | Ga0070680_100019997 | 3300005336 | Bacteria | 5308 |
| 17 | Ga0070680_100160327 | 3300005336 | Bacteria | 1890 |
| 18 | Ga0070680_100389688 | 3300005336 | Bacteria | 1187 |
| 19 | Ga0068868_100074643 | 3300005338 | Bacteria | 2709 |
| 20 | Ga0068868_100400203 | 3300005338 | Bacteria | 1185 |
| 21 | Ga0070660_100018798 | 3300005339 | Bacteria | 5056 |
| 22 | Ga0070660_100026293 | 3300005339 | Bacteria | 4332 |
| 23 | Ga0070689_100141098 | 3300005340 | Bacteria | 1938 |
| 24 | Ga0070691_10000082 | 3300005341 | Bacteria | 26541 |
| 25 | Ga0070691_10005590 | 3300005341 | Bacteria | 5721 |
| 26 | Ga0070661_100026806 | 3300005344 | Bacteria | 4147 |
| 27 | Ga0070661_100037883 | 3300005344 | Bacteria | 3509 |
| 28 | Ga0070661_100054716 | 3300005344 | Bacteria | 2923 |
| 29 | Ga0070661_100608826 | 3300005344 | Bacteria | 884 |
| 30 | Ga0070668_101075887 | 3300005347 | Bacteria | 725 |
| 31 | Ga0070675_100338256 | 3300005354 | Bacteria | 1333 |
| 32 | Ga0070671_100071315 | 3300005355 | Bacteria | 2899 |
| 33 | Ga0070673_100185669 | 3300005364 | Bacteria | 1782 |
| 34 | Ga0070659_100018711 | 3300005366 | Bacteria | 5229 |
| 35 | Ga0070659_100072331 | 3300005366 | Bacteria | 2743 |
| 36 | Ga0070659_100995023 | 3300005366 | Bacteria | 736 |
| 37 | Ga0070667_100012865 | 3300005367 | Bacteria | 6914 |
| 38 | Ga0070667_100338864 | 3300005367 | Bacteria | 1359 |
| 39 | Ga0070709_10000238 | 3300005434 | Bacteria | 35500 |
| 40 | Ga0070709_10062345 | 3300005434 | Bacteria | 2377 |
| 41 | Ga0070714_100031391 | 3300005435 | Bacteria | 4432 |
| 42 | Ga0070714_100102534 | 3300005435 | Bacteria | 2523 |
| 43 | Ga0070714_100844900 | 3300005435 | Bacteria | 888 |
| 44 | Ga0070713_100000011 | 3300005436 | Bacteria | 146314 |
| 45 | Ga0070713_100382226 | 3300005436 | Bacteria | 1312 |
| 46 | Ga0070713_101299615 | 3300005436 | Bacteria | 705 |
| 47 | Ga0070711_100103191 | 3300005439 | Bacteria | 2078 |
| 48 | Ga0070711_100574128 | 3300005439 | Bacteria | 938 |
| 49 | Ga0070663_100077387 | 3300005455 | Bacteria | 2435 |
| 50 | Ga0070678_100002013 | 3300005456 | Bacteria | 10984 |
| 51 | Ga0070678_100031753 | 3300005456 | Bacteria | 3648 |
| 52 | Ga0070678_100851611 | 3300005456 | Bacteria | 831 |
| 53 | Ga0070662_100125309 | 3300005457 | Bacteria | 1974 |
| 54 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 55 | Ga0070681_10030628 | 3300005458 | Bacteria | 5400 |
| 56 | Ga0070681_10151923 | 3300005458 | Bacteria | 2242 |
| 57 | Ga0070681_10550473 | 3300005458 | Bacteria | 1068 |
| 58 | Ga0070681_10759929 | 3300005458 | Bacteria | 886 |
| 59 | Ga0068867_100014884 | 3300005459 | Bacteria | 5513 |
| 60 | Ga0068867_100347906 | 3300005459 | Unclassified | 1236 |
| 61 | Ga0068867_100935507 | 3300005459 | Bacteria | 782 |
| 62 | Ga0070679_100000569 | 3300005530 | Bacteria | 31286 |
| 63 | Ga0070679_100111217 | 3300005530 | Bacteria | 2725 |
| 64 | Ga0070679_100257225 | 3300005530 | Bacteria | 1701 |
| 65 | Ga0070679_100615794 | 3300005530 | Bacteria | 1029 |
| 66 | Ga0070679_100744142 | 3300005530 | Bacteria | 923 |
| 67 | Ga0070679_101198240 | 3300005530 | Bacteria | 705 |
| 68 | Ga0070684_100041676 | 3300005535 | Bacteria | 3960 |
| 69 | Ga0070684_100089015 | 3300005535 | Bacteria | 2743 |
| 70 | Ga0070684_100413204 | 3300005535 | Bacteria | 1245 |
| 71 | Ga0068853_100038034 | 3300005539 | Bacteria | 4098 |
| 72 | Ga0068853_100070770 | 3300005539 | Bacteria | 3037 |
| 73 | Ga0068853_100108211 | 3300005539 | Bacteria | 2466 |
| 74 | Ga0068853_100426349 | 3300005539 | Bacteria | 1244 |
| 75 | Ga0068853_101171351 | 3300005539 | Bacteria | 742 |
| 76 | Ga0068853_101199680 | 3300005539 | Bacteria | 733 |
| 77 | Ga0070696_100028174 | 3300005546 | Bacteria | 3832 |
| 78 | Ga0070693_100395766 | 3300005547 | Bacteria | 956 |
| 79 | Ga0070665_100002597 | 3300005548 | Bacteria | 19721 |
| 80 | Ga0070665_100018871 | 3300005548 | Bacteria | 6916 |
| 81 | Ga0070665_100049419 | 3300005548 | Bacteria | 4220 |
| 82 | Ga0070665_100057758 | 3300005548 | Bacteria | 3890 |
| 83 | Ga0070665_100292094 | 3300005548 | Bacteria | 1632 |
| 84 | Ga0070665_100706971 | 3300005548 | Bacteria | 1021 |
| 85 | Ga0068855_100000106 | 3300005563 | Bacteria | 103864 |
| 86 | Ga0068855_100201419 | 3300005563 | Bacteria | 2241 |
| 87 | Ga0068855_100758870 | 3300005563 | Bacteria | 1034 |
| 88 | Ga0068855_101203256 | 3300005563 | Bacteria | 788 |
| 89 | Ga0070664_100833273 | 3300005564 | Bacteria | 863 |
| 90 | Ga0068857_100005182 | 3300005577 | Bacteria | 11087 |
| 91 | Ga0068857_100088072 | 3300005577 | Bacteria | 2777 |
| 92 | Ga0068857_100145231 | 3300005577 | Bacteria | 2146 |
| 93 | Ga0068857_100184306 | 3300005577 | Bacteria | 1900 |
| 94 | Ga0068857_100220298 | 3300005577 | Bacteria | 1733 |
| 95 | Ga0068856_100000964 | 3300005614 | Bacteria | 30705 |
| 96 | Ga0068856_100003424 | 3300005614 | Bacteria | 16037 |
| 97 | Ga0068856_100133424 | 3300005614 | Bacteria | 2488 |
| 98 | Ga0068856_100210874 | 3300005614 | Bacteria | 1958 |
| 99 | Ga0068856_100252726 | 3300005614 | Bacteria | 1778 |
| 100 | Ga0068856_100254860 | 3300005614 | Bacteria | 1770 |
| 101 | Ga0068856_100344713 | 3300005614 | Bacteria | 1508 |
| 102 | Ga0068856_100489925 | 3300005614 | Bacteria | 1250 |
| 103 | Ga0068856_100711434 | 3300005614 | Bacteria | 1025 |
| 104 | Ga0068852_100002997 | 3300005616 | Bacteria | 11733 |
| 105 | Ga0068852_100003598 | 3300005616 | Bacteria | 10848 |
| 106 | Ga0068852_100005013 | 3300005616 | Bacteria | 9416 |
| 107 | Ga0068852_100005817 | 3300005616 | Bacteria | 8853 |
| 108 | Ga0068852_100244694 | 3300005616 | Bacteria | 1716 |
| 109 | Ga0068859_100202702 | 3300005617 | Bacteria | 2069 |
| 110 | Ga0068866_10026254 | 3300005718 | Bacteria | 2748 |
| 111 | Ga0068861_100581765 | 3300005719 | Bacteria | 1025 |
| 112 | Ga0068851_10058114 | 3300005834 | Bacteria | 1976 |
| 113 | Ga0068863_100201536 | 3300005841 | Bacteria | 1914 |
| 114 | Ga0068858_100004578 | 3300005842 | Bacteria | 13542 |
| 115 | Ga0068858_100132435 | 3300005842 | Bacteria | 2338 |
| 116 | Ga0068862_100701224 | 3300005844 | Bacteria | 981 |
| 117 | Ga0070716_100514844 | 3300006173 | Bacteria | 885 |
| 118 | Ga0070712_100000014 | 3300006175 | Bacteria | 108668 |
| 119 | Ga0097621_100002964 | 3300006237 | Bacteria | 11650 |
| 120 | Ga0097621_100011176 | 3300006237 | Bacteria | 6607 |
| 121 | Ga0097621_100019884 | 3300006237 | Bacteria | 5164 |
| 122 | Ga0097621_100222939 | 3300006237 | Bacteria | 1643 |
| 123 | Ga0097621_100335572 | 3300006237 | Bacteria | 1341 |
| 124 | Ga0097621_100566111 | 3300006237 | Bacteria | 1036 |
| 125 | Ga0097621_100578230 | 3300006237 | Bacteria | 1025 |
| 126 | Ga0068871_100001250 | 3300006358 | Bacteria | 16986 |
| 127 | Ga0068871_100076324 | 3300006358 | Bacteria | 2767 |
| 128 | Ga0068871_100117583 | 3300006358 | Bacteria | 2242 |
| 129 | Ga0068871_100143736 | 3300006358 | Bacteria | 2030 |
| 130 | Ga0068871_100403905 | 3300006358 | Unclassified | 1217 |
| 131 | Ga0068871_100637050 | 3300006358 | Bacteria | 972 |
| 132 | Ga0068865_100025832 | 3300006881 | Bacteria | 3867 |
| 133 | Ga0075436_100000047 | 3300006914 | Bacteria | 72907 |
| 134 | Ga0075436_100031385 | 3300006914 | Bacteria | 3658 |
| 135 | Ga0097620_100202706 | 3300006931 | Bacteria | 2069 |
| 136 | Ga0075435_100095705 | 3300007076 | Bacteria | 2456 |
| 137 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 138 | Ga0105240_10000355 | 3300009093 | Bacteria | 86025 |
| 139 | Ga0105240_10028212 | 3300009093 | Bacteria | 7335 |
| 140 | Ga0105240_10038465 | 3300009093 | Bacteria | 6137 |
| 141 | Ga0105240_10080726 | 3300009093 | Bacteria | 3999 |
| 142 | Ga0105240_10158446 | 3300009093 | Bacteria | 2691 |
| 143 | Ga0105240_10179345 | 3300009093 | Bacteria | 2501 |
| 144 | Ga0105240_10187103 | 3300009093 | Bacteria | 2438 |
| 145 | Ga0105240_10212523 | 3300009093 | Bacteria | 2259 |
| 146 | Ga0105240_10274319 | 3300009093 | Bacteria | 1940 |
| 147 | Ga0105240_10280267 | 3300009093 | Bacteria | 1915 |
| 148 | Ga0105240_10318352 | 3300009093 | Bacteria | 1774 |
| 149 | Ga0105240_10369042 | 3300009093 | Bacteria | 1623 |
| 150 | Ga0105240_10539060 | 3300009093 | Bacteria | 1292 |
| 151 | Ga0105240_11587609 | 3300009093 | Bacteria | 685 |
| 152 | Ga0105245_10070841 | 3300009098 | Bacteria | 3165 |
| 153 | Ga0105245_10133433 | 3300009098 | Bacteria | 2331 |
| 154 | Ga0105247_10005627 | 3300009101 | Bacteria | 7863 |
| 155 | Ga0105243_10006780 | 3300009148 | Bacteria | 8830 |
| 156 | Ga0105241_10016353 | 3300009174 | Bacteria | 5440 |
| 157 | Ga0105241_10022531 | 3300009174 | Bacteria | 4666 |
| 158 | Ga0105241_10028509 | 3300009174 | Bacteria | 4162 |
| 159 | Ga0105241_10039288 | 3300009174 | Bacteria | 3569 |
| 160 | Ga0105241_10213252 | 3300009174 | Bacteria | 1619 |
| 161 | Ga0105241_11026461 | 3300009174 | Bacteria | 773 |
| 162 | Ga0105242_10208294 | 3300009176 | Bacteria | 1741 |
| 163 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 164 | Ga0105248_10031038 | 3300009177 | Bacteria | 5971 |
| 165 | Ga0105248_10109932 | 3300009177 | Bacteria | 3108 |
| 166 | Ga0105248_10860054 | 3300009177 | Unclassified | 1024 |
| 167 | Ga0105248_11499575 | 3300009177 | Bacteria | 763 |
| 168 | Ga0105237_10008237 | 3300009545 | Bacteria | 11319 |
| 169 | Ga0105237_10014301 | 3300009545 | Bacteria | 8307 |
| 170 | Ga0105237_10015763 | 3300009545 | Bacteria | 7860 |
| 171 | Ga0105237_10019700 | 3300009545 | Bacteria | 6965 |
| 172 | Ga0105237_10070274 | 3300009545 | Bacteria | 3497 |
| 173 | Ga0105237_10126897 | 3300009545 | Bacteria | 2546 |
| 174 | Ga0105237_10167542 | 3300009545 | Bacteria | 2196 |
| 175 | Ga0105237_11183289 | 3300009545 | Bacteria | 771 |
| 176 | Ga0105238_10003708 | 3300009551 | Bacteria | 15199 |
| 177 | Ga0105238_10011779 | 3300009551 | Bacteria | 8814 |
| 178 | Ga0105238_10011985 | 3300009551 | Bacteria | 8733 |
| 179 | Ga0105238_10026575 | 3300009551 | Bacteria | 5902 |
| 180 | Ga0105238_10127064 | 3300009551 | Bacteria | 2528 |
| 181 | Ga0105238_10171582 | 3300009551 | Bacteria | 2145 |
| 182 | Ga0105238_10171636 | 3300009551 | Bacteria | 2145 |
| 183 | Ga0105238_10183728 | 3300009551 | Bacteria | 2068 |
| 184 | Ga0105238_10819796 | 3300009551 | Bacteria | 947 |
| 185 | Ga0105238_10996179 | 3300009551 | Bacteria | 859 |
| 186 | Ga0105249_10017761 | 3300009553 | Bacteria | 6319 |
| 187 | Ga0105239_10034655 | 3300010375 | Bacteria | 5545 |
| 188 | Ga0105239_10068805 | 3300010375 | Bacteria | 3891 |
| 189 | Ga0105239_10072584 | 3300010375 | Bacteria | 3784 |
| 190 | Ga0105239_10087689 | 3300010375 | Bacteria | 3431 |
| 191 | Ga0105239_10150764 | 3300010375 | Bacteria | 2595 |
| 192 | Ga0105239_10221464 | 3300010375 | Bacteria | 2122 |
| 193 | Ga0105239_10383015 | 3300010375 | Bacteria | 1590 |
| 194 | Ga0105239_10384132 | 3300010375 | Bacteria | 1588 |
| 195 | Ga0105239_10471047 | 3300010375 | Bacteria | 1426 |
| 196 | Ga0105239_10532578 | 3300010375 | Bacteria | 1337 |
| 197 | Ga0105239_10921580 | 3300010375 | Bacteria | 1003 |
| 198 | Ga0105239_11022513 | 3300010375 | Bacteria | 950 |
| 199 | Ga0105239_11134998 | 3300010375 | Bacteria | 900 |
| 200 | Ga0105246_10009904 | 3300011119 | Bacteria | 5878 |
| 201 | Ga0105246_10039465 | 3300011119 | Bacteria | 3181 |
| 202 | Ga0157373_10003903 | 3300013100 | Bacteria | 11264 |
| 203 | Ga0157370_10000280 | 3300013104 | Bacteria | 64677 |
| 204 | Ga0157370_10004453 | 3300013104 | Bacteria | 16057 |
| 205 | Ga0157370_10280808 | 3300013104 | Bacteria | 1539 |
| 206 | Ga0157370_10372649 | 3300013104 | Unclassified | 1315 |
| 207 | Ga0157370_11111260 | 3300013104 | Bacteria | 714 |
| 208 | Ga0157369_10004867 | 3300013105 | Bacteria | 15757 |
| 209 | Ga0157369_10010911 | 3300013105 | Bacteria | 10345 |
| 210 | Ga0157369_10023221 | 3300013105 | Bacteria | 6910 |
| 211 | Ga0157369_10218750 | 3300013105 | Bacteria | 1994 |
| 212 | Ga0157369_10378540 | 3300013105 | Bacteria | 1469 |
| 213 | Ga0157369_10444185 | 3300013105 | Bacteria | 1343 |
| 214 | Ga0157369_10603419 | 3300013105 | Unclassified | 1133 |
| 215 | Ga0157374_10025468 | 3300013296 | Bacteria | 5312 |
| 216 | Ga0157374_10028010 | 3300013296 | Bacteria | 5088 |
| 217 | Ga0157374_10119881 | 3300013296 | Bacteria | 2538 |
| 218 | Ga0157378_10116865 | 3300013297 | Bacteria | 2453 |
| 219 | Ga0157378_10324537 | 3300013297 | Bacteria | 1496 |
| 220 | Ga0157378_10369347 | 3300013297 | Bacteria | 1406 |
| 221 | Ga0157378_11075679 | 3300013297 | Bacteria | 841 |
| 222 | Ga0157378_12127855 | 3300013297 | Unclassified | 612 |
| 223 | Ga0163162_10044647 | 3300013306 | Bacteria | 4439 |
| 224 | Ga0163162_10051883 | 3300013306 | Bacteria | 4117 |
| 225 | Ga0163162_10084081 | 3300013306 | Bacteria | 3257 |
| 226 | Ga0163162_10129225 | 3300013306 | Bacteria | 2635 |
| 227 | Ga0163162_10585205 | 3300013306 | Bacteria | 1243 |
| 228 | Ga0163162_11201726 | 3300013306 | Bacteria | 860 |
| 229 | Ga0157372_10008076 | 3300013307 | Bacteria | 11194 |
| 230 | Ga0157372_10018787 | 3300013307 | Bacteria | 7435 |
| 231 | Ga0157372_10067384 | 3300013307 | Bacteria | 4022 |
| 232 | Ga0157372_10071967 | 3300013307 | Bacteria | 3895 |
| 233 | Ga0157372_11310842 | 3300013307 | Bacteria | 835 |
| 234 | Ga0157375_10022440 | 3300013308 | Bacteria | 5809 |
| 235 | Ga0157375_10358402 | 3300013308 | Bacteria | 1624 |
| 236 | Ga0157375_10490806 | 3300013308 | Bacteria | 1393 |
| 237 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 238 | Ga0163163_10533937 | 3300014325 | Bacteria | 1235 |
| 239 | Ga0157380_10139607 | 3300014326 | Bacteria | 2080 |
| 240 | Ga0157379_10001126 | 3300014968 | Bacteria | 21842 |
| 241 | Ga0157379_10001288 | 3300014968 | Bacteria | 20426 |
| 242 | Ga0157379_10002345 | 3300014968 | Bacteria | 15799 |
| 243 | Ga0157379_10014522 | 3300014968 | Bacteria | 6912 |
| 244 | Ga0157379_10098254 | 3300014968 | Bacteria | 2628 |
| 245 | Ga0157379_10102466 | 3300014968 | Bacteria | 2569 |
| 246 | Ga0157379_10139661 | 3300014968 | Bacteria | 2184 |
| 247 | Ga0157379_10155032 | 3300014968 | Bacteria | 2066 |
| 248 | Ga0157376_10002383 | 3300014969 | Bacteria | 12692 |
| 249 | Ga0157376_10215293 | 3300014969 | Bacteria | 1776 |
| 250 | Ga0157376_10231906 | 3300014969 | Bacteria | 1715 |
| 251 | Ga0157376_10239375 | 3300014969 | Bacteria | 1690 |
| 252 | Ga0163161_10003599 | 3300017792 | Bacteria | 10865 |
| 253 | Ga0213874_10011832 | 3300021377 | Bacteria | 2222 |
| 254 | Ga0213874_10022498 | 3300021377 | Bacteria | 1750 |
| 255 | Ga0213876_10000274 | 3300021384 | Bacteria | 47640 |
| 256 | Ga0213876_10000349 | 3300021384 | Bacteria | 39867 |
| 257 | Ga0207427_104408 | 3300025231 | Bacteria | 2385 |
| 258 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 259 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 260 | Ga0207656_10105605 | 3300025321 | Bacteria | 1296 |
| 261 | Ga0207642_10042316 | 3300025899 | Bacteria | 2001 |
| 262 | Ga0207642_10713787 | 3300025899 | Unclassified | 632 |
| 263 | Ga0207680_10005414 | 3300025903 | Bacteria | 6099 |
| 264 | Ga0207680_10016508 | 3300025903 | Bacteria | 3878 |
| 265 | Ga0207680_10288154 | 3300025903 | Bacteria | 1142 |
| 266 | Ga0207699_10000233 | 3300025906 | Bacteria | 31418 |
| 267 | Ga0207699_10050030 | 3300025906 | Bacteria | 2463 |
| 268 | Ga0207699_10216354 | 3300025906 | Bacteria | 1306 |
| 269 | Ga0207645_10005584 | 3300025907 | Bacteria | 9097 |
| 270 | Ga0207705_10000058 | 3300025909 | Bacteria | 155967 |
| 271 | Ga0207705_10004973 | 3300025909 | Bacteria | 9971 |
| 272 | Ga0207705_10013975 | 3300025909 | Bacteria | 5788 |
| 273 | Ga0207705_10253476 | 3300025909 | Bacteria | 1342 |
| 274 | Ga0207654_10011752 | 3300025911 | Bacteria | 4469 |
| 275 | Ga0207654_10019838 | 3300025911 | Bacteria | 3555 |
| 276 | Ga0207654_10022256 | 3300025911 | Bacteria | 3380 |
| 277 | Ga0207654_10028143 | 3300025911 | Bacteria | 3062 |
| 278 | Ga0207654_10051395 | 3300025911 | Bacteria | 2372 |
| 279 | Ga0207654_10135167 | 3300025911 | Bacteria | 1565 |
| 280 | Ga0207654_10154266 | 3300025911 | Bacteria | 1477 |
| 281 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 282 | Ga0207707_10001851 | 3300025912 | Bacteria | 19343 |
| 283 | Ga0207707_10131316 | 3300025912 | Bacteria | 2190 |
| 284 | Ga0207707_10132852 | 3300025912 | Bacteria | 2177 |
| 285 | Ga0207707_10367173 | 3300025912 | Bacteria | 1239 |
| 286 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 287 | Ga0207695_10003622 | 3300025913 | Bacteria | 21591 |
| 288 | Ga0207695_10016906 | 3300025913 | Bacteria | 8513 |
| 289 | Ga0207695_10022595 | 3300025913 | Bacteria | 7135 |
| 290 | Ga0207695_10023131 | 3300025913 | Bacteria | 7032 |
| 291 | Ga0207695_10084002 | 3300025913 | Bacteria | 3215 |
| 292 | Ga0207695_10111558 | 3300025913 | Bacteria | 2714 |
| 293 | Ga0207695_10130973 | 3300025913 | Bacteria | 2466 |
| 294 | Ga0207695_10135676 | 3300025913 | Bacteria | 2414 |
| 295 | Ga0207695_10161510 | 3300025913 | Bacteria | 2172 |
| 296 | Ga0207695_10203598 | 3300025913 | Bacteria | 1892 |
| 297 | Ga0207695_10210009 | 3300025913 | Bacteria | 1858 |
| 298 | Ga0207695_10219053 | 3300025913 | Bacteria | 1811 |
| 299 | Ga0207695_10652270 | 3300025913 | Bacteria | 933 |
| 300 | Ga0207671_10032398 | 3300025914 | Bacteria | 3891 |
| 301 | Ga0207671_10041489 | 3300025914 | Bacteria | 3406 |
| 302 | Ga0207671_10054219 | 3300025914 | Bacteria | 2971 |
| 303 | Ga0207671_10074643 | 3300025914 | Bacteria | 2535 |
| 304 | Ga0207671_10121079 | 3300025914 | Bacteria | 2000 |
| 305 | Ga0207693_10000018 | 3300025915 | Bacteria | 138365 |
| 306 | Ga0207693_10161513 | 3300025915 | Bacteria | 1763 |
| 307 | Ga0207693_10197238 | 3300025915 | Bacteria | 1583 |
| 308 | Ga0207663_10075064 | 3300025916 | Bacteria | 2193 |
| 309 | Ga0207660_10000296 | 3300025917 | Bacteria | 32942 |
| 310 | Ga0207660_10003913 | 3300025917 | Bacteria | 9706 |
| 311 | Ga0207660_10059809 | 3300025917 | Bacteria | 2737 |
| 312 | Ga0207657_10001163 | 3300025919 | Bacteria | 27950 |
| 313 | Ga0207657_10004729 | 3300025919 | Bacteria | 14373 |
| 314 | Ga0207657_10048575 | 3300025919 | Bacteria | 3704 |
| 315 | Ga0207657_10076217 | 3300025919 | Bacteria | 2830 |
| 316 | Ga0207649_10000026 | 3300025920 | Bacteria | 177395 |
| 317 | Ga0207649_10017732 | 3300025920 | Bacteria | 4036 |
| 318 | Ga0207649_10060208 | 3300025920 | Bacteria | 2385 |
| 319 | Ga0207652_10010383 | 3300025921 | Bacteria | 7498 |
| 320 | Ga0207652_10017999 | 3300025921 | Bacteria | 5789 |
| 321 | Ga0207652_10020028 | 3300025921 | Bacteria | 5509 |
| 322 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 323 | Ga0207694_10014783 | 3300025924 | Bacteria | 5886 |
| 324 | Ga0207694_10021944 | 3300025924 | Bacteria | 4841 |
| 325 | Ga0207694_10044508 | 3300025924 | Bacteria | 3427 |
| 326 | Ga0207694_10048560 | 3300025924 | Bacteria | 3284 |
| 327 | Ga0207694_10119641 | 3300025924 | Bacteria | 2101 |
| 328 | Ga0207687_10058623 | 3300025927 | Bacteria | 2709 |
| 329 | Ga0207687_11345223 | 3300025927 | Bacteria | 614 |
| 330 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 331 | Ga0207700_10225704 | 3300025928 | Bacteria | 1590 |
| 332 | Ga0207700_10317230 | 3300025928 | Bacteria | 1350 |
| 333 | Ga0207664_10014515 | 3300025929 | Bacteria | 5692 |
| 334 | Ga0207664_10016200 | 3300025929 | Bacteria | 5431 |
| 335 | Ga0207644_10066078 | 3300025931 | Bacteria | 2632 |
| 336 | Ga0207644_10556631 | 3300025931 | Bacteria | 950 |
| 337 | Ga0207690_10012687 | 3300025932 | Bacteria | 5049 |
| 338 | Ga0207690_10151761 | 3300025932 | Bacteria | 1718 |
| 339 | Ga0207706_10141251 | 3300025933 | Bacteria | 2119 |
| 340 | Ga0207686_10020821 | 3300025934 | Bacteria | 3753 |
| 341 | Ga0207686_10118851 | 3300025934 | Bacteria | 1796 |
| 342 | Ga0207709_10014211 | 3300025935 | Bacteria | 4394 |
| 343 | Ga0207709_10970243 | 3300025935 | Bacteria | 694 |
| 344 | Ga0207670_10480591 | 3300025936 | Bacteria | 1006 |
| 345 | Ga0207669_10371373 | 3300025937 | Bacteria | 1112 |
| 346 | Ga0207704_10069864 | 3300025938 | Bacteria | 2221 |
| 347 | Ga0207704_10596202 | 3300025938 | Bacteria | 904 |
| 348 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 349 | Ga0207711_10013219 | 3300025941 | Bacteria | 6858 |
| 350 | Ga0207711_10776377 | 3300025941 | Unclassified | 893 |
| 351 | Ga0207689_10026374 | 3300025942 | Bacteria | 4865 |
| 352 | Ga0207689_10172354 | 3300025942 | Bacteria | 1784 |
| 353 | Ga0207689_10195534 | 3300025942 | Bacteria | 1669 |
| 354 | Ga0207661_10317265 | 3300025944 | Bacteria | 1400 |
| 355 | Ga0207661_10330758 | 3300025944 | Bacteria | 1371 |
| 356 | Ga0207661_10505439 | 3300025944 | Bacteria | 1104 |
| 357 | Ga0207661_10511385 | 3300025944 | Bacteria | 1098 |
| 358 | Ga0207679_10327116 | 3300025945 | Bacteria | 1329 |
| 359 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 360 | Ga0207667_10002838 | 3300025949 | Bacteria | 21514 |
| 361 | Ga0207667_10007703 | 3300025949 | Bacteria | 12887 |
| 362 | Ga0207667_10034264 | 3300025949 | Bacteria | 5454 |
| 363 | Ga0207667_10035769 | 3300025949 | Bacteria | 5327 |
| 364 | Ga0207667_10037635 | 3300025949 | Bacteria | 5171 |
| 365 | Ga0207667_10963687 | 3300025949 | Unclassified | 842 |
| 366 | Ga0207651_10074676 | 3300025960 | Bacteria | 2415 |
| 367 | Ga0207712_10014867 | 3300025961 | Bacteria | 5012 |
| 368 | Ga0207712_10317962 | 3300025961 | Bacteria | 1283 |
| 369 | Ga0207640_10040754 | 3300025981 | Bacteria | 2949 |
| 370 | Ga0207640_10492173 | 3300025981 | Bacteria | 1019 |
| 371 | Ga0207658_10023373 | 3300025986 | Bacteria | 4314 |
| 372 | Ga0207677_10004318 | 3300026023 | Bacteria | 7614 |
| 373 | Ga0207677_10079685 | 3300026023 | Bacteria | 2343 |
| 374 | Ga0207677_10235130 | 3300026023 | Bacteria | 1479 |
| 375 | Ga0207677_10764053 | 3300026023 | Bacteria | 862 |
| 376 | Ga0207703_10017787 | 3300026035 | Bacteria | 5551 |
| 377 | Ga0207703_10017934 | 3300026035 | Bacteria | 5528 |
| 378 | Ga0207703_10108592 | 3300026035 | Bacteria | 2363 |
| 379 | Ga0207639_10001556 | 3300026041 | Bacteria | 15378 |
| 380 | Ga0207639_10159886 | 3300026041 | Bacteria | 1897 |
| 381 | Ga0207639_10229617 | 3300026041 | Bacteria | 1608 |
| 382 | Ga0207639_10338157 | 3300026041 | Bacteria | 1341 |
| 383 | Ga0207639_10589740 | 3300026041 | Bacteria | 1024 |
| 384 | Ga0207639_10606378 | 3300026041 | Bacteria | 1010 |
| 385 | Ga0207639_11024687 | 3300026041 | Unclassified | 773 |
| 386 | Ga0207678_10038547 | 3300026067 | Bacteria | 4152 |
| 387 | Ga0207678_10605430 | 3300026067 | Bacteria | 961 |
| 388 | Ga0207678_10895762 | 3300026067 | Bacteria | 784 |
| 389 | Ga0207708_11099144 | 3300026075 | Bacteria | 693 |
| 390 | Ga0207702_10000173 | 3300026078 | Bacteria | 77458 |
| 391 | Ga0207702_10001080 | 3300026078 | Bacteria | 27929 |
| 392 | Ga0207702_10186477 | 3300026078 | Bacteria | 1913 |
| 393 | Ga0207702_10266776 | 3300026078 | Bacteria | 1614 |
| 394 | Ga0207702_10283906 | 3300026078 | Bacteria | 1566 |
| 395 | Ga0207702_10541169 | 3300026078 | Bacteria | 1138 |
| 396 | Ga0207702_10570803 | 3300026078 | Bacteria | 1108 |
| 397 | Ga0207702_10785095 | 3300026078 | Bacteria | 941 |
| 398 | Ga0207702_10967097 | 3300026078 | Bacteria | 844 |
| 399 | Ga0207702_11332994 | 3300026078 | Bacteria | 712 |
| 400 | Ga0207702_11721360 | 3300026078 | Bacteria | 620 |
| 401 | Ga0207648_10009495 | 3300026089 | Bacteria | 9309 |
| 402 | Ga0207648_10115605 | 3300026089 | Bacteria | 2358 |
| 403 | Ga0207674_10000112 | 3300026116 | Bacteria | 94220 |
| 404 | Ga0207674_10087310 | 3300026116 | Bacteria | 3113 |
| 405 | Ga0207674_10125019 | 3300026116 | Bacteria | 2538 |
| 406 | Ga0207674_10155915 | 3300026116 | Bacteria | 2239 |
| 407 | Ga0207674_10217525 | 3300026116 | Bacteria | 1859 |
| 408 | Ga0207675_100597325 | 3300026118 | Bacteria | 1106 |
| 409 | Ga0207683_10003082 | 3300026121 | Bacteria | 14565 |
| 410 | Ga0207683_10049440 | 3300026121 | Bacteria | 3681 |
| 411 | Ga0207698_10001893 | 3300026142 | Bacteria | 12258 |
| 412 | Ga0207698_10007028 | 3300026142 | Bacteria | 7050 |
| 413 | Ga0207698_10017662 | 3300026142 | Bacteria | 4847 |
| 414 | Ga0207698_10025195 | 3300026142 | Bacteria | 4185 |
| 415 | Ga0207698_10896152 | 3300026142 | Bacteria | 894 |
| 416 | Ga0268266_10000463 | 3300028379 | Bacteria | 59089 |
| 417 | Ga0268266_10079718 | 3300028379 | Bacteria | 2851 |
| 418 | Ga0268266_10156033 | 3300028379 | Bacteria | 2061 |
| 419 | Ga0268266_10172741 | 3300028379 | Bacteria | 1962 |
| 420 | Ga0268266_10524252 | 3300028379 | Bacteria | 1133 |
| 421 | Ga0268266_10551484 | 3300028379 | Bacteria | 1104 |
| 422 | Ga0268266_10637491 | 3300028379 | Bacteria | 1025 |
| 423 | Ga0268266_11027791 | 3300028379 | Bacteria | 797 |
| 424 | Ga0268266_11192895 | 3300028379 | Unclassified | 736 |
| 425 | Ga0268266_11517902 | 3300028379 | Bacteria | 645 |
| 426 | Ga0265318_10000444 | 3300028577 | Bacteria | 31172 |
| 427 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 428 | Ga0265338_10001087 | 3300028800 | Bacteria | 45161 |
| 429 | Ga0265338_10051307 | 3300028800 | Bacteria | 3715 |
| 430 | Ga0265338_10072489 | 3300028800 | Bacteria | 2940 |
| 431 | Ga0265338_10072660 | 3300028800 | Bacteria | 2936 |
| 432 | Ga0265330_10009167 | 3300031235 | Bacteria | 4716 |
| 433 | Ga0265330_10067547 | 3300031235 | Bacteria | 1549 |
| 434 | Ga0265332_10195710 | 3300031238 | Unclassified | 841 |
| 435 | Ga0265332_10250540 | 3300031238 | Unclassified | 733 |
| 436 | Ga0265328_10022854 | 3300031239 | Bacteria | 2375 |
| 437 | Ga0265328_10078788 | 3300031239 | Bacteria | 1214 |
| 438 | Ga0265320_10003153 | 3300031240 | Bacteria | 11187 |
| 439 | Ga0265325_10000009 | 3300031241 | Bacteria | 184273 |
| 440 | Ga0265325_10000094 | 3300031241 | Bacteria | 62066 |
| 441 | Ga0265325_10002373 | 3300031241 | Bacteria | 12725 |
| 442 | Ga0265325_10002474 | 3300031241 | Bacteria | 12447 |
| 443 | Ga0265325_10002838 | 3300031241 | Bacteria | 11552 |
| 444 | Ga0265325_10033081 | 3300031241 | Bacteria | 2757 |
| 445 | Ga0265329_10049528 | 3300031242 | Bacteria | 1338 |
| 446 | Ga0265340_10000159 | 3300031247 | Bacteria | 34106 |
| 447 | Ga0265340_10000562 | 3300031247 | Bacteria | 20607 |
| 448 | Ga0265340_10004479 | 3300031247 | Bacteria | 7800 |
| 449 | Ga0265340_10006207 | 3300031247 | Bacteria | 6588 |
| 450 | Ga0265340_10180493 | 3300031247 | Bacteria | 954 |
| 451 | Ga0265339_10002153 | 3300031249 | Bacteria | 14321 |
| 452 | Ga0265339_10007160 | 3300031249 | Bacteria | 7238 |
| 453 | Ga0265339_10008384 | 3300031249 | Bacteria | 6581 |
| 454 | Ga0265339_10026142 | 3300031249 | Bacteria | 3344 |
| 455 | Ga0265339_10048309 | 3300031249 | Bacteria | 2334 |
| 456 | Ga0265339_10128734 | 3300031249 | Unclassified | 1296 |
| 457 | Ga0265339_10133571 | 3300031249 | Bacteria | 1267 |
| 458 | Ga0265339_10239321 | 3300031249 | Unclassified | 882 |
| 459 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 460 | Ga0265331_10000009 | 3300031250 | Bacteria | 314950 |
| 461 | Ga0265331_10002453 | 3300031250 | Bacteria | 12567 |
| 462 | Ga0265331_10199879 | 3300031250 | Bacteria | 900 |
| 463 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 464 | Ga0265316_10004977 | 3300031344 | Bacteria | 13046 |
| 465 | Ga0265316_10020381 | 3300031344 | Bacteria | 5644 |
| 466 | Ga0265316_10025982 | 3300031344 | Bacteria | 4879 |
| 467 | Ga0265316_10093425 | 3300031344 | Bacteria | 2292 |
| 468 | Ga0265316_10118156 | 3300031344 | Bacteria | 2004 |
| 469 | Ga0265316_10186012 | 3300031344 | Bacteria | 1545 |
| 470 | Ga0265316_10388159 | 3300031344 | Bacteria | 1007 |
| 471 | Ga0265313_10001052 | 3300031595 | Bacteria | 26852 |
| 472 | Ga0265313_10002778 | 3300031595 | Bacteria | 14762 |
| 473 | Ga0265313_10043318 | 3300031595 | Bacteria | 2204 |
| 474 | Ga0265313_10100612 | 3300031595 | Bacteria | 1284 |
| 475 | Ga0265313_10137862 | 3300031595 | Bacteria | 1052 |
| 476 | Ga0307508_10321667 | 3300031616 | Bacteria | 1139 |
| 477 | Ga0265314_10001062 | 3300031711 | Bacteria | 31939 |
| 478 | Ga0265314_10004805 | 3300031711 | Bacteria | 12366 |
| 479 | Ga0265314_10004872 | 3300031711 | Bacteria | 12269 |
| 480 | Ga0265314_10031751 | 3300031711 | Bacteria | 3894 |
| 481 | Ga0265314_10051883 | 3300031711 | Bacteria | 2855 |
| 482 | Ga0265314_10057403 | 3300031711 | Bacteria | 2673 |
| 483 | Ga0265314_10085255 | 3300031711 | Bacteria | 2072 |
| 484 | Ga0265314_10086371 | 3300031711 | Bacteria | 2054 |
| 485 | Ga0265314_10098623 | 3300031711 | Bacteria | 1884 |
| 486 | Ga0265314_10119429 | 3300031711 | Unclassified | 1662 |
| 487 | Ga0265314_10126486 | 3300031711 | Bacteria | 1600 |
| 488 | Ga0265314_10133311 | 3300031711 | Bacteria | 1546 |
| 489 | Ga0265314_10161231 | 3300031711 | Bacteria | 1364 |
| 490 | Ga0265314_10231503 | 3300031711 | Bacteria | 1071 |
| 491 | Ga0265342_10007158 | 3300031712 | Bacteria | 8211 |
| 492 | Ga0265342_10013703 | 3300031712 | Bacteria | 5421 |
| 493 | Ga0265342_10042692 | 3300031712 | Bacteria | 2739 |
| 494 | Ga0265342_10160731 | 3300031712 | Bacteria | 1242 |
| 495 | Ga0265342_10218665 | 3300031712 | Unclassified | 1027 |
| 496 | Ga0307516_10061230 | 3300031730 | Bacteria | 3653 |
| 497 | Ga0307516_10071158 | 3300031730 | Bacteria | 3339 |
| 498 | Ga0373934_0060273 | 3300035086 | Bacteria | 1511 |
| 499 | Ga0373944_0023315 | 3300035089 | Bacteria | 1805 |
| 500 | Ga0373952_0156240 | 3300035092 | Bacteria | 643 |
| 501 | Ga0373923_0026149 | 3300035111 | Bacteria | 2320 |
| 502 | Ga0373932_0109557 | 3300035112 | Unclassified | 908 |
| 503 | Ga0373936_0127490 | 3300035113 | Bacteria | 1091 |
| 504 | Ga0373954_0249841 | 3300035118 | Bacteria | 873 |
| 505 | Ga0373943_0399499 | 3300035170 | Bacteria | 793 |
| 506 | Ga0373924_0068382 | 3300035410 | Bacteria | 1495 |
| 507 | Ga0373935_0205258 | 3300035692 | Bacteria | 1363 |
| 508 | Ga0373935_0230956 | 3300035692 | Bacteria | 1288 |
| 509 | Ga0373933_0222632 | 3300035724 | Bacteria | 1211 |
| 510 | Ga0373933_0352929 | 3300035724 | Bacteria | 955 |
| 511 | Ga0373947_0005370 | 3300035725 | Bacteria | 7479 |
| 512 | Ga0373947_0082089 | 3300035725 | Bacteria | 1997 |
| 513 | Ga0373937_0006814 | 3300036401 | Bacteria | 9858 |
| 514 | Ga0373937_0300931 | 3300036401 | Bacteria | 1516 |
| 515 | Ga0373925_0012671 | 3300037068 | Bacteria | 6105 |
| 516 | Ga0373925_0050470 | 3300037068 | Bacteria | 3103 |
| 517 | Ga0395899_0016522 | 3300037312 | Bacteria | 5630 |
| 518 | Ga0395900_0088308 | 3300037418 | Bacteria | 3187 |
| 519 | Ga0395900_0555517 | 3300037418 | Unclassified | 1092 |
| 520 | Ga0395898_0009858 | 3300037466 | Bacteria | 10012 |
| 521 | Ga0395898_0026131 | 3300037466 | Bacteria | 5877 |
| 522 | Ga0395901_0743540 | 3300038443 | Bacteria | 974 |
| 523 | Ga0395901_1920239 | 3300038443 | Bacteria | 539 |
| 524 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 525 | Ga0436365_0298223 | 3300039437 | Bacteria | 74249 |
| 526 | Ga0436365_0483034 | 3300039437 | Bacteria | 2554 |
| 527 | Ga0436365_0570483 | 3300039437 | Unclassified | 998 |
| 528 | Ga0436365_1065516 | 3300039437 | Bacteria | 1311 |
| 529 | Ga0436365_1223073 | 3300039437 | Bacteria | 984 |
| 530 | Ga0436360_0650771 | 3300039438 | Bacteria | 909 |
| 531 | Ga0436360_1347255 | 3300039438 | Bacteria | 1879 |
| 532 | Ga0436363_0325134 | 3300039450 | Bacteria | 2251 |
| 533 | Ga0436363_0444918 | 3300039450 | Unclassified | 1134 |
| 534 | Ga0436363_1255904 | 3300039450 | Bacteria | 6631 |
| 535 | Ga0436363_1432904 | 3300039450 | Unclassified | 1935 |
| 536 | Ga0436362_0130343 | 3300039453 | Bacteria | 3755 |
| 537 | Ga0451793_0085511 | 3300041452 | Bacteria | 1217 |
| 538 | Ga0451798_0040364 | 3300041458 | Bacteria | 955 |
| 539 | Ga0451853_0112512 | 3300041512 | Bacteria | 759 |
| 540 | Ga0466966_0457464 | 3300044684 | Bacteria | 767 |
| 541 | Ga0466957_0318629 | 3300044842 | Bacteria | 1049 |
| 542 | Ga0466967_0249353 | 3300045976 | Bacteria | 1696 |
| 543 | Ga0466967_0268247 | 3300045976 | Bacteria | 1635 |
| 544 | Ga0495592_0240183 | 3300046454 | Bacteria | 1202 |
| 545 | Ga0495592_0635441 | 3300046454 | Bacteria | 648 |
| 546 | Ga0495580_0056424 | 3300046472 | Bacteria | 2766 |
| 547 | Ga0495580_0076015 | 3300046472 | Bacteria | 2343 |
| 548 | Ga0495664_0016439 | 3300046477 | Bacteria | 4215 |
| 549 | Ga0495664_0280748 | 3300046477 | Bacteria | 1006 |
| 550 | Ga0495585_0281721 | 3300046492 | Bacteria | 821 |
| 551 | Ga0495606_0224960 | 3300046507 | Bacteria | 1055 |
| 552 | Ga0495628_0245709 | 3300046516 | Bacteria | 1337 |
| 553 | Ga0495628_0506971 | 3300046516 | Bacteria | 871 |
| 554 | Ga0495652_0212461 | 3300046529 | Bacteria | 1459 |
| 555 | Ga0495652_0692939 | 3300046529 | Bacteria | 686 |
| 556 | Ga0495587_0066469 | 3300046536 | Bacteria | 2103 |
| 557 | Ga0495587_0115867 | 3300046536 | Bacteria | 1537 |
| 558 | Ga0495587_0448709 | 3300046536 | Bacteria | 715 |
| 559 | Ga0495609_0017425 | 3300046538 | Bacteria | 3335 |
| 560 | Ga0495645_0013632 | 3300046543 | Bacteria | 5757 |
| 561 | Ga0495645_0039080 | 3300046543 | Bacteria | 3461 |
| 562 | Ga0495622_0002344 | 3300046557 | Bacteria | 9210 |
| 563 | Ga0495622_0417614 | 3300046557 | Bacteria | 577 |
| 564 | Ga0495656_0159491 | 3300046615 | Bacteria | 1095 |
| 565 | Ga0495635_0238754 | 3300046663 | Bacteria | 1227 |
| 566 | Ga0495599_0278917 | 3300046678 | Bacteria | 1013 |
| 567 | Ga0495623_0244724 | 3300046679 | Bacteria | 1011 |
| 568 | Ga0495658_0001623 | 3300046683 | Bacteria | 11704 |
| 569 | Ga0495669_0325374 | 3300046684 | Bacteria | 742 |
| 570 | Ga0495670_0511848 | 3300046691 | Bacteria | 652 |
| 571 | Ga0495589_0027867 | 3300046794 | Bacteria | 2855 |
| 572 | Ga0495604_0537737 | 3300047317 | Bacteria | 755 |
| 573 | Ga0495604_0598589 | 3300047317 | Bacteria | 707 |
| 574 | Ga0495636_0032689 | 3300047318 | Bacteria | 2135 |
| 575 | Ga0495674_0269717 | 3300047319 | Bacteria | 1397 |
| 576 | Ga0495674_0455199 | 3300047319 | Bacteria | 1028 |
| 577 | Ga0495672_0158171 | 3300047320 | Bacteria | 1168 |
| 578 | Ga0495672_0213630 | 3300047320 | Bacteria | 957 |
| 579 | Ga0495676_0156074 | 3300047321 | Bacteria | 1619 |
| 580 | Ga0496102_0356471 | 3300048905 | Unclassified | 1377 |
| 581 | Ga0496107_0700792 | 3300048910 | Bacteria | 745 |
| 582 | Ga0496110_1186935 | 3300048913 | Unclassified | 672 |
| 583 | Ga0496112_0224736 | 3300048915 | Bacteria | 1833 |
| 584 | Ga0496115_0728451 | 3300048918 | Bacteria | 777 |
| 585 | Ga0496121_0000987 | 3300048924 | Bacteria | 50954 |
| 586 | Ga0495682_0001351 | 3300049460 | Bacteria | 13529 |
| 587 | Ga0501031_0003423 | 3300049568 | Bacteria | 10182 |
| 588 | Ga0501031_0098537 | 3300049568 | Bacteria | 1907 |
| 589 | Ga0501031_0442113 | 3300049568 | Bacteria | 840 |
| 590 | Ga0501032_0007623 | 3300049569 | Bacteria | 7891 |
| 591 | Ga0501032_0028493 | 3300049569 | Bacteria | 3838 |
| 592 | Ga0501032_0066844 | 3300049569 | Bacteria | 2402 |
| 593 | Ga0501032_0208330 | 3300049569 | Bacteria | 1275 |
| 594 | Ga0501032_0219006 | 3300049569 | Bacteria | 1239 |
| 595 | Ga0501032_0287080 | 3300049569 | Bacteria | 1065 |
| 596 | Ga0501032_0690600 | 3300049569 | Unclassified | 647 |
| 597 | Ga0501032_0710041 | 3300049569 | Bacteria | 637 |
| 598 | Ga0501033_0002118 | 3300049570 | Bacteria | 17169 |
| 599 | Ga0501033_0003652 | 3300049570 | Bacteria | 12550 |
| 600 | Ga0501033_0008546 | 3300049570 | Bacteria | 7921 |
| 601 | Ga0501033_0018864 | 3300049570 | Bacteria | 5215 |
| 602 | Ga0501033_0065358 | 3300049570 | Bacteria | 2676 |
| 603 | Ga0501033_0074498 | 3300049570 | Bacteria | 2492 |
| 604 | Ga0501033_0194356 | 3300049570 | Bacteria | 1451 |
| 605 | Ga0501033_0386954 | 3300049570 | Bacteria | 976 |
| 606 | Ga0501033_0486653 | 3300049570 | Bacteria | 854 |
| 607 | Ga0501033_0496343 | 3300049570 | Unclassified | 845 |
| 608 | Ga0501034_0035157 | 3300049571 | Bacteria | 5081 |
| 609 | Ga0501034_0146603 | 3300049571 | Bacteria | 2337 |
| 610 | Ga0501034_0158532 | 3300049571 | Bacteria | 2236 |
| 611 | Ga0501034_0181610 | 3300049571 | Bacteria | 2069 |
| 612 | Ga0501034_0810797 | 3300049571 | Bacteria | 828 |
| 613 | Ga0501036_0006658 | 3300049572 | Bacteria | 9394 |
| 614 | Ga0501036_0140420 | 3300049572 | Bacteria | 2039 |
| 615 | Ga0501036_0255246 | 3300049572 | Bacteria | 1469 |
| 616 | Ga0501036_0294377 | 3300049572 | Bacteria | 1358 |
| 617 | Ga0501036_0349169 | 3300049572 | Bacteria | 1235 |
| 618 | Ga0501036_0918149 | 3300049572 | Unclassified | 718 |
| 619 | Ga0501037_0008387 | 3300049573 | Bacteria | 7577 |
| 620 | Ga0501037_0042300 | 3300049573 | Bacteria | 3348 |
| 621 | Ga0501037_0042558 | 3300049573 | Bacteria | 3337 |
| 622 | Ga0501037_0083160 | 3300049573 | Bacteria | 2319 |
| 623 | Ga0501037_0209907 | 3300049573 | Bacteria | 1374 |
| 624 | Ga0501037_0395810 | 3300049573 | Bacteria | 948 |
| 625 | Ga0501038_0070728 | 3300049574 | Bacteria | 2961 |
| 626 | Ga0501038_0093566 | 3300049574 | Bacteria | 2514 |
| 627 | Ga0501038_0359204 | 3300049574 | Unclassified | 1133 |
| 628 | Ga0501038_0380807 | 3300049574 | Bacteria | 1094 |
| 629 | Ga0501038_0436386 | 3300049574 | Unclassified | 1009 |
| 630 | Ga0501038_0498142 | 3300049574 | Bacteria | 932 |
| 631 | Ga0501038_0681875 | 3300049574 | Bacteria | 771 |
| 632 | Ga0501038_0746217 | 3300049574 | Unclassified | 730 |
| 633 | Ga0501039_0265636 | 3300049575 | Bacteria | 1349 |
| 634 | Ga0501039_0269245 | 3300049575 | Bacteria | 1339 |
| 635 | Ga0501040_0144033 | 3300049576 | Bacteria | 1679 |
| 636 | Ga0501041_0609078 | 3300049577 | Unclassified | 697 |
| 637 | Ga0501042_0013189 | 3300049578 | Bacteria | 5626 |
| 638 | Ga0501042_0035014 | 3300049578 | Bacteria | 3562 |
| 639 | Ga0501043_0086281 | 3300049579 | Bacteria | 2467 |
| 640 | Ga0501043_0092419 | 3300049579 | Bacteria | 2379 |
| 641 | Ga0501043_0174589 | 3300049579 | Bacteria | 1676 |
| 642 | Ga0501043_0230319 | 3300049579 | Bacteria | 1431 |
| 643 | Ga0501043_0234094 | 3300049579 | Bacteria | 1418 |
| 644 | Ga0501043_0334197 | 3300049579 | Bacteria | 1153 |
| 645 | Ga0501046_0007202 | 3300049580 | Bacteria | 9781 |
| 646 | Ga0501046_0007227 | 3300049580 | Bacteria | 9762 |
| 647 | Ga0501046_0041162 | 3300049580 | Bacteria | 3688 |
| 648 | Ga0501046_0259564 | 3300049580 | Bacteria | 1277 |
| 649 | Ga0501046_0402827 | 3300049580 | Bacteria | 988 |
| 650 | Ga0501046_0444396 | 3300049580 | Bacteria | 933 |
| 651 | Ga0501046_0477407 | 3300049580 | Bacteria | 895 |
| 652 | Ga0501047_0004469 | 3300049581 | Bacteria | 13159 |
| 653 | Ga0501047_0010064 | 3300049581 | Bacteria | 8941 |
| 654 | Ga0501047_0010754 | 3300049581 | Bacteria | 8651 |
| 655 | Ga0501047_0019694 | 3300049581 | Bacteria | 6475 |
| 656 | Ga0501047_0028145 | 3300049581 | Bacteria | 5417 |
| 657 | Ga0501047_0132988 | 3300049581 | Bacteria | 2367 |
| 658 | Ga0501047_0194528 | 3300049581 | Bacteria | 1890 |
| 659 | Ga0501047_0208383 | 3300049581 | Bacteria | 1814 |
| 660 | Ga0501047_0333068 | 3300049581 | Bacteria | 1356 |
| 661 | Ga0501047_0434060 | 3300049581 | Unclassified | 1144 |
| 662 | Ga0501047_0590674 | 3300049581 | Bacteria | 933 |
| 663 | Ga0501047_1101545 | 3300049581 | Bacteria | 607 |
| 664 | Ga0501048_0007103 | 3300049582 | Bacteria | 8507 |
| 665 | Ga0501048_0067362 | 3300049582 | Bacteria | 2531 |
| 666 | Ga0501067_0004896 | 3300049583 | Bacteria | 7438 |
| 667 | Ga0501067_0015446 | 3300049583 | Bacteria | 4227 |
| 668 | Ga0501067_0019884 | 3300049583 | Bacteria | 3716 |
| 669 | Ga0501067_0050090 | 3300049583 | Bacteria | 2315 |
| 670 | Ga0501069_0010544 | 3300049585 | Bacteria | 4894 |
| 671 | Ga0501069_0030096 | 3300049585 | Bacteria | 2981 |
| 672 | Ga0501070_0000111 | 3300049586 | Bacteria | 71786 |
| 673 | Ga0501070_0012304 | 3300049586 | Bacteria | 7222 |
| 674 | Ga0501070_0015773 | 3300049586 | Bacteria | 6353 |
| 675 | Ga0501070_0017330 | 3300049586 | Bacteria | 6048 |
| 676 | Ga0501070_0052121 | 3300049586 | Bacteria | 3396 |
| 677 | Ga0501070_0074206 | 3300049586 | Bacteria | 2816 |
| 678 | Ga0501070_0078606 | 3300049586 | Bacteria | 2730 |
| 679 | Ga0501070_0577531 | 3300049586 | Bacteria | 898 |
| 680 | Ga0501071_0472094 | 3300049587 | Bacteria | 961 |
| 681 | Ga0501072_0016454 | 3300049588 | Bacteria | 5678 |
| 682 | Ga0501072_0781435 | 3300049588 | Unclassified | 748 |
| 683 | Ga0501073_0015989 | 3300049589 | Bacteria | 5438 |
| 684 | Ga0501073_0099611 | 3300049589 | Bacteria | 2018 |
| 685 | Ga0501073_0240222 | 3300049589 | Bacteria | 1251 |
| 686 | Ga0501073_0387471 | 3300049589 | Unclassified | 965 |
| 687 | Ga0501074_0002441 | 3300049590 | Bacteria | 12964 |
| 688 | Ga0501074_0114550 | 3300049590 | Bacteria | 1929 |
| 689 | Ga0501074_0818950 | 3300049590 | Bacteria | 656 |
| 690 | Ga0501074_0985663 | 3300049590 | Unclassified | 593 |
| 691 | Ga0501076_0062316 | 3300049592 | Bacteria | 2970 |
| 692 | Ga0501076_0342376 | 3300049592 | Archaea | 1227 |
| 693 | Ga0501079_0005434 | 3300049741 | Bacteria | 9498 |
| 694 | Ga0501079_0029883 | 3300049741 | Bacteria | 4186 |
| 695 | Ga0501079_0061970 | 3300049741 | Bacteria | 2885 |
| 696 | Ga0501079_0284506 | 3300049741 | Bacteria | 1293 |
| 697 | Ga0501080_0003916 | 3300049742 | Bacteria | 13188 |
| 698 | Ga0501080_0018192 | 3300049742 | Bacteria | 6504 |
| 699 | Ga0501080_0060319 | 3300049742 | Bacteria | 3531 |
| 700 | Ga0501080_0065071 | 3300049742 | Bacteria | 3391 |
| 701 | Ga0501080_0380435 | 3300049742 | Unclassified | 1272 |
| 702 | Ga0501080_0387976 | 3300049742 | Bacteria | 1257 |
| 703 | Ga0501080_1104417 | 3300049742 | Bacteria | 684 |
| 704 | Ga0501083_0014640 | 3300049744 | Bacteria | 5483 |
| 705 | Ga0501083_0034604 | 3300049744 | Bacteria | 3454 |
| 706 | Ga0501083_0302071 | 3300049744 | Bacteria | 1041 |
| 707 | Ga0501035_0002206 | 3300049822 | Bacteria | 19336 |
| 708 | Ga0501035_0002523 | 3300049822 | Bacteria | 17906 |
| 709 | Ga0501035_0005014 | 3300049822 | Bacteria | 12538 |
| 710 | Ga0501035_0016319 | 3300049822 | Bacteria | 6851 |
| 711 | Ga0501035_0049511 | 3300049822 | Bacteria | 3765 |
| 712 | Ga0501035_0066618 | 3300049822 | Bacteria | 3196 |
| 713 | Ga0501035_0140676 | 3300049822 | Bacteria | 2099 |
| 714 | Ga0501035_0145055 | 3300049822 | Bacteria | 2062 |
| 715 | Ga0501035_0180039 | 3300049822 | Bacteria | 1821 |
| 716 | Ga0501035_0237743 | 3300049822 | Bacteria | 1550 |
| 717 | Ga0501044_0003903 | 3300049823 | Bacteria | 16713 |
| 718 | Ga0501044_0006571 | 3300049823 | Bacteria | 12839 |
| 719 | Ga0501044_0007608 | 3300049823 | Bacteria | 11911 |
| 720 | Ga0501044_0037484 | 3300049823 | Bacteria | 5067 |
| 721 | Ga0501044_0050191 | 3300049823 | Bacteria | 4306 |
| 722 | Ga0501044_0056729 | 3300049823 | Bacteria | 4021 |
| 723 | Ga0501044_0098234 | 3300049823 | Bacteria | 2948 |
| 724 | Ga0501044_0152575 | 3300049823 | Bacteria | 2292 |
| 725 | Ga0501044_0212824 | 3300049823 | Bacteria | 1886 |
| 726 | Ga0501044_0218307 | 3300049823 | Bacteria | 1858 |
| 727 | Ga0501044_0293674 | 3300049823 | Bacteria | 1556 |
| 728 | Ga0501044_0321349 | 3300049823 | Bacteria | 1472 |
| 729 | Ga0501044_0334593 | 3300049823 | Bacteria | 1436 |
| 730 | Ga0501044_0455917 | 3300049823 | Bacteria | 1184 |
| 731 | Ga0501044_0661978 | 3300049823 | Bacteria | 932 |
| 732 | nmdc:mga08x19_62_c1 | 3300050514 | Bacteria | 114601 |
| 733 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 734 | Ga0500595_000824 | 3300053119 | Bacteria | 17755 |
| 735 | Ga0500595_064675 | 3300053119 | Bacteria | 1096 |
| 736 | Ga0500642_0193279 | 3300053130 | Bacteria | 949 |
| 737 | Ga0500655_009925 | 3300053133 | Bacteria | 1718 |
| 738 | Ga0500655_014893 | 3300053133 | Bacteria | 1424 |
| 739 | Ga0500559_0173869 | 3300053136 | Bacteria | 1013 |
| 740 | Ga0500559_0187338 | 3300053136 | Bacteria | 975 |
| 741 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 742 | Ga0500619_001348 | 3300053154 | Bacteria | 4316 |
| 743 | Ga0500637_0182778 | 3300053178 | Bacteria | 1201 |
| 744 | Ga0501084_0000057 | 3300054114 | Bacteria | 87821 |
| 745 | Ga0501084_0011180 | 3300054114 | Bacteria | 7435 |
| 746 | Ga0501084_0042942 | 3300054114 | Bacteria | 3782 |
| 747 | Ga0501084_0058502 | 3300054114 | Bacteria | 3225 |
| 748 | Ga0501082_0180046 | 3300060353 | Bacteria | 1838 |
| 749 | Ga0501082_0305889 | 3300060353 | Bacteria | 1384 |
| 750 | Ga0501082_0847663 | 3300060353 | Bacteria | 799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0158532 | Ga0501034_0158532_1210_1683 | 147 |
| 2 | 3300046691 | Ga0495670_0511848 | Ga0495670_0511848_175_639 | 154 |
| 3 | 3300003215 | JGI25153J46596_10001002 | JGI25153J46596_1000100222 | 156 |
| 4 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008235 | 156 |
| 5 | 3300037312 | Ga0395899_0016522 | Ga0395899_0016522_5049_5540 | 158 |
| 6 | 3300037466 | Ga0395898_0009858 | Ga0395898_0009858_6572_7063 | 158 |
| 7 | 3300047320 | Ga0495672_0158171 | Ga0495672_0158171_127_684 | 160 |
| 8 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_91940_92497 | 160 |
| 9 | 3300005548 | Ga0070665_100706971 | Ga0070665_1007069712 | 161 |
| 10 | 3300028379 | Ga0268266_10637491 | Ga0268266_106374912 | 161 |
| 11 | 3300025915 | Ga0207693_10161513 | Ga0207693_101615132 | 162 |
| 12 | 3300031239 | Ga0265328_10078788 | Ga0265328_100787882 | 162 |
| 13 | 3300031249 | Ga0265339_10128734 | Ga0265339_101287343 | 162 |
| 14 | 3300031344 | Ga0265316_10186012 | Ga0265316_101860122 | 162 |
| 15 | 3300031711 | Ga0265314_10231503 | Ga0265314_102315032 | 162 |
| 16 | 3300039450 | Ga0436363_1255904 | Ga0436363_1255904_4470_4958 | 162 |
| 17 | 3300046454 | Ga0495592_0240183 | Ga0495592_0240183_701_1189 | 162 |
| 18 | 3300046557 | Ga0495622_0417614 | Ga0495622_0417614_40_528 | 162 |
| 19 | 3300047319 | Ga0495674_0269717 | Ga0495674_0269717_52_540 | 162 |
| 20 | 3300049569 | Ga0501032_0028493 | Ga0501032_0028493_1374_1862 | 162 |
| 21 | 3300049571 | Ga0501034_0146603 | Ga0501034_0146603_1413_1901 | 162 |
| 22 | 3300049573 | Ga0501037_0209907 | Ga0501037_0209907_225_713 | 162 |
| 23 | 3300049581 | Ga0501047_0194528 | Ga0501047_0194528_1346_1834 | 162 |
| 24 | 3300049583 | Ga0501067_0019884 | Ga0501067_0019884_628_1116 | 162 |
| 25 | 3300049586 | Ga0501070_0052121 | Ga0501070_0052121_2488_2976 | 162 |
| 26 | 3300049589 | Ga0501073_0387471 | Ga0501073_0387471_421_909 | 162 |
| 27 | 3300049741 | Ga0501079_0029883 | Ga0501079_0029883_514_1002 | 162 |
| 28 | 3300049742 | Ga0501080_0065071 | Ga0501080_0065071_1178_1666 | 162 |
| 29 | 3300049744 | Ga0501083_0034604 | Ga0501083_0034604_2594_3082 | 162 |
| 30 | 3300049822 | Ga0501035_0005014 | Ga0501035_0005014_2923_3411 | 162 |
| 31 | 3300049823 | Ga0501044_0037484 | Ga0501044_0037484_356_844 | 162 |
| 32 | 3300060353 | Ga0501082_0180046 | Ga0501082_0180046_548_1036 | 162 |
| 33 | 3300005347 | Ga0070668_101075887 | Ga0070668_1010758871 | 163 |
| 34 | 3300021377 | Ga0213874_10022498 | Ga0213874_100224982 | 163 |
| 35 | 3300035089 | Ga0373944_0023315 | Ga0373944_0023315_1130_1627 | 163 |
| 36 | 3300035092 | Ga0373952_0156240 | Ga0373952_0156240_24_524 | 163 |
| 37 | 3300039437 | Ga0436365_1065516 | Ga0436365_1065516_609_1106 | 163 |
| 38 | 3300039450 | Ga0436363_0325134 | Ga0436363_0325134_997_1494 | 163 |
| 39 | 3300005577 | Ga0068857_100145231 | Ga0068857_1001452312 | 164 |
| 40 | 3300005842 | Ga0068858_100004578 | Ga0068858_10000457811 | 164 |
| 41 | 3300025924 | Ga0207694_10119641 | Ga0207694_101196413 | 164 |
| 42 | 3300025944 | Ga0207661_10330758 | Ga0207661_103307582 | 164 |
| 43 | 3300025949 | Ga0207667_10037635 | Ga0207667_100376352 | 164 |
| 44 | 3300026035 | Ga0207703_10017787 | Ga0207703_100177876 | 164 |
| 45 | 3300026116 | Ga0207674_10155915 | Ga0207674_101559152 | 164 |
| 46 | 3300031711 | Ga0265314_10098623 | Ga0265314_100986233 | 164 |
| 47 | 3300035118 | Ga0373954_0249841 | Ga0373954_0249841_357_851 | 164 |
| 48 | 3300035724 | Ga0373933_0222632 | Ga0373933_0222632_155_649 | 164 |
| 49 | 3300049742 | Ga0501080_1104417 | Ga0501080_1104417_178_672 | 164 |
| 50 | 3300039450 | Ga0436363_1432904 | Ga0436363_1432904_1188_1745 | 165 |
| 51 | 3300005327 | Ga0070658_10180592 | Ga0070658_101805921 | 166 |
| 52 | 3300005335 | Ga0070666_10064283 | Ga0070666_100642831 | 166 |
| 53 | 3300005539 | Ga0068853_100426349 | Ga0068853_1004263492 | 166 |
| 54 | 3300005548 | Ga0070665_100018871 | Ga0070665_1000188714 | 166 |
| 55 | 3300005577 | Ga0068857_100220298 | Ga0068857_1002202982 | 166 |
| 56 | 3300005614 | Ga0068856_100344713 | Ga0068856_1003447132 | 166 |
| 57 | 3300006237 | Ga0097621_100002964 | Ga0097621_1000029646 | 166 |
| 58 | 3300006237 | Ga0097621_100566111 | Ga0097621_1005661112 | 166 |
| 59 | 3300006358 | Ga0068871_100001250 | Ga0068871_1000012503 | 166 |
| 60 | 3300009148 | Ga0105243_10006780 | Ga0105243_100067807 | 166 |
| 61 | 3300009176 | Ga0105242_10208294 | Ga0105242_102082941 | 166 |
| 62 | 3300009177 | Ga0105248_11499575 | Ga0105248_114995751 | 166 |
| 63 | 3300009545 | Ga0105237_11183289 | Ga0105237_111832891 | 166 |
| 64 | 3300009551 | Ga0105238_10171582 | Ga0105238_101715822 | 166 |
| 65 | 3300010375 | Ga0105239_10383015 | Ga0105239_103830152 | 166 |
| 66 | 3300013297 | Ga0157378_11075679 | Ga0157378_110756791 | 166 |
| 67 | 3300013306 | Ga0163162_10051883 | Ga0163162_100518833 | 166 |
| 68 | 3300013306 | Ga0163162_10129225 | Ga0163162_101292252 | 166 |
| 69 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012202 | 166 |
| 70 | 3300014969 | Ga0157376_10231906 | Ga0157376_102319062 | 166 |
| 71 | 3300025903 | Ga0207680_10016508 | Ga0207680_100165083 | 166 |
| 72 | 3300025907 | Ga0207645_10005584 | Ga0207645_100055845 | 166 |
| 73 | 3300025913 | Ga0207695_10652270 | Ga0207695_106522702 | 166 |
| 74 | 3300025919 | Ga0207657_10004729 | Ga0207657_100047298 | 166 |
| 75 | 3300025931 | Ga0207644_10556631 | Ga0207644_105566311 | 166 |
| 76 | 3300025935 | Ga0207709_10014211 | Ga0207709_100142113 | 166 |
| 77 | 3300025935 | Ga0207709_10970243 | Ga0207709_109702432 | 166 |
| 78 | 3300025942 | Ga0207689_10026374 | Ga0207689_100263745 | 166 |
| 79 | 3300025960 | Ga0207651_10074676 | Ga0207651_100746763 | 166 |
| 80 | 3300026023 | Ga0207677_10079685 | Ga0207677_100796852 | 166 |
| 81 | 3300026041 | Ga0207639_10589740 | Ga0207639_105897402 | 166 |
| 82 | 3300026067 | Ga0207678_10605430 | Ga0207678_106054302 | 166 |
| 83 | 3300026067 | Ga0207678_10895762 | Ga0207678_108957621 | 166 |
| 84 | 3300026078 | Ga0207702_10283906 | Ga0207702_102839062 | 166 |
| 85 | 3300026089 | Ga0207648_10009495 | Ga0207648_1000949510 | 166 |
| 86 | 3300026116 | Ga0207674_10125019 | Ga0207674_101250191 | 166 |
| 87 | 3300026118 | Ga0207675_100597325 | Ga0207675_1005973252 | 166 |
| 88 | 3300028379 | Ga0268266_11517902 | Ga0268266_115179021 | 166 |
| 89 | 3300039438 | Ga0436360_0650771 | Ga0436360_0650771_15_560 | 166 |
| 90 | 3300046557 | Ga0495622_0002344 | Ga0495622_0002344_5346_5846 | 166 |
| 91 | 3300049572 | Ga0501036_0349169 | Ga0501036_0349169_385_885 | 166 |
| 92 | 3300049574 | Ga0501038_0380807 | Ga0501038_0380807_237_737 | 166 |
| 93 | 3300049581 | Ga0501047_1101545 | Ga0501047_1101545_22_522 | 166 |
| 94 | 3300049592 | Ga0501076_0062316 | Ga0501076_0062316_14_514 | 166 |
| 95 | 3300049823 | Ga0501044_0212824 | Ga0501044_0212824_1033_1533 | 166 |
| 96 | 3300053136 | Ga0500559_0187338 | Ga0500559_0187338_431_931 | 166 |
| 97 | 3300048905 | Ga0496102_0356471 | Ga0496102_0356471_357_866 | 167 |
| 98 | 3300049570 | Ga0501033_0486653 | Ga0501033_0486653_135_677 | 167 |
| 99 | 3300049572 | Ga0501036_0294377 | Ga0501036_0294377_784_1326 | 167 |
| 100 | 3300049574 | Ga0501038_0681875 | Ga0501038_0681875_179_721 | 167 |
| 101 | 3300049579 | Ga0501043_0092419 | Ga0501043_0092419_1260_1802 | 167 |
| 102 | 3300049822 | Ga0501035_0016319 | Ga0501035_0016319_5771_6313 | 167 |
| 103 | 3300038443 | Ga0395901_1920239 | Ga0395901_1920239_19_525 | 168 |
| 104 | 3300049570 | Ga0501033_0496343 | Ga0501033_0496343_148_663 | 168 |
| 105 | 3300049574 | Ga0501038_0359204 | Ga0501038_0359204_386_901 | 168 |
| 106 | 3300049577 | Ga0501041_0609078 | Ga0501041_0609078_90_605 | 168 |
| 107 | 3300049578 | Ga0501042_0013189 | Ga0501042_0013189_4772_5287 | 168 |
| 108 | 3300049582 | Ga0501048_0067362 | Ga0501048_0067362_360_875 | 168 |
| 109 | 3300049586 | Ga0501070_0017330 | Ga0501070_0017330_492_998 | 168 |
| 110 | 3300049588 | Ga0501072_0781435 | Ga0501072_0781435_185_700 | 168 |
| 111 | 3300049590 | Ga0501074_0985663 | Ga0501074_0985663_58_573 | 168 |
| 112 | 3300049592 | Ga0501076_0342376 | Ga0501076_0342376_54_569 | 168 |
| 113 | 3300049822 | Ga0501035_0140676 | Ga0501035_0140676_730_1245 | 168 |
| 114 | 3300035170 | Ga0373943_0399499 | Ga0373943_0399499_255_779 | 170 |
| 115 | 3300035725 | Ga0373947_0082089 | Ga0373947_0082089_777_1301 | 170 |
| 116 | 3300046472 | Ga0495580_0056424 | Ga0495580_0056424_949_1473 | 170 |
| 117 | 3300046683 | Ga0495658_0001623 | Ga0495658_0001623_7916_8440 | 170 |
| 118 | 3300049570 | Ga0501033_0065358 | Ga0501033_0065358_1088_1630 | 170 |
| 119 | 3300049581 | Ga0501047_0333068 | Ga0501047_0333068_346_888 | 170 |
| 120 | 3300005530 | Ga0070679_100744142 | Ga0070679_1007441422 | 172 |
| 121 | 3300013306 | Ga0163162_10585205 | Ga0163162_105852051 | 172 |
| 122 | 3300025909 | Ga0207705_10253476 | Ga0207705_102534762 | 172 |
| 123 | 3300037418 | Ga0395900_0555517 | Ga0395900_0555517_116_664 | 173 |
| 124 | 3300049573 | Ga0501037_0395810 | Ga0501037_0395810_156_683 | 173 |
| 125 | 3300049579 | Ga0501043_0086281 | Ga0501043_0086281_24_551 | 173 |
| 126 | 3300049581 | Ga0501047_0590674 | Ga0501047_0590674_321_848 | 173 |
| 127 | 3300049586 | Ga0501070_0577531 | Ga0501070_0577531_16_543 | 173 |
| 128 | 3300049823 | Ga0501044_0334593 | Ga0501044_0334593_268_795 | 173 |
| 129 | 3300048915 | Ga0496112_0224736 | Ga0496112_0224736_749_1303 | 175 |
| 130 | 3300049590 | Ga0501074_0818950 | Ga0501074_0818950_79_639 | 177 |
| 131 | 3300049574 | Ga0501038_0498142 | Ga0501038_0498142_295_861 | 178 |
| 132 | 3300049583 | Ga0501067_0050090 | Ga0501067_0050090_1758_2297 | 178 |
| 133 | 3300049823 | Ga0501044_0056729 | Ga0501044_0056729_2713_3279 | 178 |
| 134 | 3300054114 | Ga0501084_0000057 | Ga0501084_0000057_1826_2365 | 178 |
| 135 | 3300060353 | Ga0501082_0847663 | Ga0501082_0847663_158_697 | 178 |
| 136 | 3300005535 | Ga0070684_100413204 | Ga0070684_1004132043 | 179 |
| 137 | 3300005539 | Ga0068853_100070770 | Ga0068853_1000707705 | 179 |
| 138 | 3300005616 | Ga0068852_100005013 | Ga0068852_10000501310 | 179 |
| 139 | 3300009093 | Ga0105240_10080726 | Ga0105240_100807264 | 179 |
| 140 | 3300009174 | Ga0105241_10039288 | Ga0105241_100392883 | 179 |
| 141 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011595 | 179 |
| 142 | 3300021377 | Ga0213874_10011832 | Ga0213874_100118322 | 179 |
| 143 | 3300025911 | Ga0207654_10051395 | Ga0207654_100513953 | 179 |
| 144 | 3300025913 | Ga0207695_10023131 | Ga0207695_100231317 | 179 |
| 145 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001278 | 179 |
| 146 | 3300026041 | Ga0207639_10001556 | Ga0207639_1000155619 | 179 |
| 147 | 3300026142 | Ga0207698_10017662 | Ga0207698_100176623 | 179 |
| 148 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011223 | 179 |
| 149 | 3300031241 | Ga0265325_10000009 | Ga0265325_10000009102 | 179 |
| 150 | 3300031242 | Ga0265329_10049528 | Ga0265329_100495282 | 179 |
| 151 | 3300031249 | Ga0265339_10002153 | Ga0265339_100021537 | 179 |
| 152 | 3300031250 | Ga0265331_10002453 | Ga0265331_1000245310 | 179 |
| 153 | 3300031595 | Ga0265313_10001052 | Ga0265313_1000105224 | 179 |
| 154 | 3300031711 | Ga0265314_10051883 | Ga0265314_100518834 | 179 |
| 155 | 3300031712 | Ga0265342_10013703 | Ga0265342_100137033 | 179 |
| 156 | 3300049580 | Ga0501046_0477407 | Ga0501046_0477407_281_826 | 179 |
| 157 | 3300049581 | Ga0501047_0434060 | Ga0501047_0434060_256_801 | 179 |
| 158 | 3300049586 | Ga0501070_0012304 | Ga0501070_0012304_3756_4301 | 179 |
| 159 | 3300049590 | Ga0501074_0114550 | Ga0501074_0114550_100_642 | 179 |
| 160 | 3300049742 | Ga0501080_0003916 | Ga0501080_0003916_9535_10080 | 179 |
| 161 | 3300053154 | Ga0500619_001348 | Ga0500619_001348_639_1184 | 179 |
| 162 | 3300005327 | Ga0070658_10160702 | Ga0070658_101607022 | 180 |
| 163 | 3300005329 | Ga0070683_100067412 | Ga0070683_1000674122 | 180 |
| 164 | 3300005336 | Ga0070680_100000870 | Ga0070680_1000008703 | 180 |
| 165 | 3300005336 | Ga0070680_100389688 | Ga0070680_1003896882 | 180 |
| 166 | 3300005344 | Ga0070661_100026806 | Ga0070661_1000268065 | 180 |
| 167 | 3300005366 | Ga0070659_100995023 | Ga0070659_1009950231 | 180 |
| 168 | 3300005435 | Ga0070714_100102534 | Ga0070714_1001025342 | 180 |
| 169 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002707 | 180 |
| 170 | 3300005458 | Ga0070681_10759929 | Ga0070681_107599291 | 180 |
| 171 | 3300005530 | Ga0070679_100000569 | Ga0070679_1000005698 | 180 |
| 172 | 3300005530 | Ga0070679_100257225 | Ga0070679_1002572251 | 180 |
| 173 | 3300005539 | Ga0068853_100038034 | Ga0068853_1000380343 | 180 |
| 174 | 3300005563 | Ga0068855_100000106 | Ga0068855_10000010683 | 180 |
| 175 | 3300005563 | Ga0068855_100758870 | Ga0068855_1007588702 | 180 |
| 176 | 3300005577 | Ga0068857_100088072 | Ga0068857_1000880723 | 180 |
| 177 | 3300005614 | Ga0068856_100210874 | Ga0068856_1002108743 | 180 |
| 178 | 3300005614 | Ga0068856_100252726 | Ga0068856_1002527263 | 180 |
| 179 | 3300005614 | Ga0068856_100711434 | Ga0068856_1007114341 | 180 |
| 180 | 3300005616 | Ga0068852_100002997 | Ga0068852_1000029979 | 180 |
| 181 | 3300005616 | Ga0068852_100003598 | Ga0068852_1000035988 | 180 |
| 182 | 3300005834 | Ga0068851_10058114 | Ga0068851_100581143 | 180 |
| 183 | 3300009093 | Ga0105240_10000055 | Ga0105240_1000005527 | 180 |
| 184 | 3300009093 | Ga0105240_10028212 | Ga0105240_100282123 | 180 |
| 185 | 3300009093 | Ga0105240_10187103 | Ga0105240_101871034 | 180 |
| 186 | 3300009093 | Ga0105240_10369042 | Ga0105240_103690421 | 180 |
| 187 | 3300009093 | Ga0105240_10539060 | Ga0105240_105390603 | 180 |
| 188 | 3300009101 | Ga0105247_10005627 | Ga0105247_100056278 | 180 |
| 189 | 3300009174 | Ga0105241_10016353 | Ga0105241_100163532 | 180 |
| 190 | 3300009545 | Ga0105237_10014301 | Ga0105237_1001430110 | 180 |
| 191 | 3300009545 | Ga0105237_10019700 | Ga0105237_100197004 | 180 |
| 192 | 3300009545 | Ga0105237_10070274 | Ga0105237_100702742 | 180 |
| 193 | 3300009551 | Ga0105238_10003708 | Ga0105238_100037083 | 180 |
| 194 | 3300009551 | Ga0105238_10026575 | Ga0105238_100265757 | 180 |
| 195 | 3300009551 | Ga0105238_10819796 | Ga0105238_108197961 | 180 |
| 196 | 3300010375 | Ga0105239_10034655 | Ga0105239_100346553 | 180 |
| 197 | 3300010375 | Ga0105239_10068805 | Ga0105239_100688055 | 180 |
| 198 | 3300010375 | Ga0105239_10087689 | Ga0105239_100876893 | 180 |
| 199 | 3300010375 | Ga0105239_11134998 | Ga0105239_111349982 | 180 |
| 200 | 3300013105 | Ga0157369_10010911 | Ga0157369_100109112 | 180 |
| 201 | 3300013105 | Ga0157369_10023221 | Ga0157369_100232218 | 180 |
| 202 | 3300013105 | Ga0157369_10444185 | Ga0157369_104441852 | 180 |
| 203 | 3300013105 | Ga0157369_10603419 | Ga0157369_106034192 | 180 |
| 204 | 3300013297 | Ga0157378_10116865 | Ga0157378_101168653 | 180 |
| 205 | 3300013306 | Ga0163162_11201726 | Ga0163162_112017262 | 180 |
| 206 | 3300013307 | Ga0157372_11310842 | Ga0157372_113108422 | 180 |
| 207 | 3300014969 | Ga0157376_10239375 | Ga0157376_102393751 | 180 |
| 208 | 3300021384 | Ga0213876_10000274 | Ga0213876_1000027450 | 180 |
| 209 | 3300025321 | Ga0207656_10105605 | Ga0207656_101056052 | 180 |
| 210 | 3300025909 | Ga0207705_10004973 | Ga0207705_100049735 | 180 |
| 211 | 3300025911 | Ga0207654_10019838 | Ga0207654_100198385 | 180 |
| 212 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002251 | 180 |
| 213 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012309 | 180 |
| 214 | 3300025913 | Ga0207695_10003622 | Ga0207695_100036225 | 180 |
| 215 | 3300025913 | Ga0207695_10022595 | Ga0207695_100225959 | 180 |
| 216 | 3300025913 | Ga0207695_10130973 | Ga0207695_101309734 | 180 |
| 217 | 3300025914 | Ga0207671_10041489 | Ga0207671_100414895 | 180 |
| 218 | 3300025914 | Ga0207671_10054219 | Ga0207671_100542192 | 180 |
| 219 | 3300025914 | Ga0207671_10121079 | Ga0207671_101210793 | 180 |
| 220 | 3300025917 | Ga0207660_10000296 | Ga0207660_100002963 | 180 |
| 221 | 3300025920 | Ga0207649_10017732 | Ga0207649_100177322 | 180 |
| 222 | 3300025921 | Ga0207652_10010383 | Ga0207652_100103838 | 180 |
| 223 | 3300025921 | Ga0207652_10020028 | Ga0207652_100200286 | 180 |
| 224 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006356 | 180 |
| 225 | 3300025924 | Ga0207694_10048560 | Ga0207694_100485604 | 180 |
| 226 | 3300025929 | Ga0207664_10016200 | Ga0207664_100162006 | 180 |
| 227 | 3300025944 | Ga0207661_10505439 | Ga0207661_105054392 | 180 |
| 228 | 3300025949 | Ga0207667_10000026 | Ga0207667_1000002656 | 180 |
| 229 | 3300025949 | Ga0207667_10002838 | Ga0207667_1000283811 | 180 |
| 230 | 3300026041 | Ga0207639_10229617 | Ga0207639_102296172 | 180 |
| 231 | 3300026041 | Ga0207639_10606378 | Ga0207639_106063782 | 180 |
| 232 | 3300026078 | Ga0207702_10541169 | Ga0207702_105411692 | 180 |
| 233 | 3300026116 | Ga0207674_10087310 | Ga0207674_100873104 | 180 |
| 234 | 3300026142 | Ga0207698_10001893 | Ga0207698_100018937 | 180 |
| 235 | 3300026142 | Ga0207698_10025195 | Ga0207698_100251955 | 180 |
| 236 | 3300028379 | Ga0268266_10156033 | Ga0268266_101560333 | 180 |
| 237 | 3300028577 | Ga0265318_10000444 | Ga0265318_1000044422 | 180 |
| 238 | 3300028800 | Ga0265338_10051307 | Ga0265338_100513074 | 180 |
| 239 | 3300031241 | Ga0265325_10033081 | Ga0265325_100330815 | 180 |
| 240 | 3300031247 | Ga0265340_10004479 | Ga0265340_1000447911 | 180 |
| 241 | 3300031249 | Ga0265339_10133571 | Ga0265339_101335712 | 180 |
| 242 | 3300031344 | Ga0265316_10093425 | Ga0265316_100934254 | 180 |
| 243 | 3300031344 | Ga0265316_10118156 | Ga0265316_101181563 | 180 |
| 244 | 3300031595 | Ga0265313_10100612 | Ga0265313_101006121 | 180 |
| 245 | 3300031730 | Ga0307516_10071158 | Ga0307516_100711584 | 180 |
| 246 | 3300035113 | Ga0373936_0127490 | Ga0373936_0127490_135_677 | 180 |
| 247 | 3300036401 | Ga0373937_0300931 | Ga0373937_0300931_750_1298 | 180 |
| 248 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_118533_119081 | 180 |
| 249 | 3300039437 | Ga0436365_0483034 | Ga0436365_0483034_1580_2128 | 180 |
| 250 | 3300039453 | Ga0436362_0130343 | Ga0436362_0130343_2201_2749 | 180 |
| 251 | 3300046454 | Ga0495592_0635441 | Ga0495592_0635441_46_597 | 180 |
| 252 | 3300046477 | Ga0495664_0016439 | Ga0495664_0016439_1329_1877 | 180 |
| 253 | 3300046477 | Ga0495664_0280748 | Ga0495664_0280748_53_604 | 180 |
| 254 | 3300046516 | Ga0495628_0245709 | Ga0495628_0245709_178_726 | 180 |
| 255 | 3300046516 | Ga0495628_0506971 | Ga0495628_0506971_98_640 | 180 |
| 256 | 3300046529 | Ga0495652_0212461 | Ga0495652_0212461_276_824 | 180 |
| 257 | 3300046529 | Ga0495652_0692939 | Ga0495652_0692939_88_636 | 180 |
| 258 | 3300046536 | Ga0495587_0066469 | Ga0495587_0066469_510_1052 | 180 |
| 259 | 3300046536 | Ga0495587_0115867 | Ga0495587_0115867_375_926 | 180 |
| 260 | 3300046543 | Ga0495645_0013632 | Ga0495645_0013632_3420_3968 | 180 |
| 261 | 3300046543 | Ga0495645_0039080 | Ga0495645_0039080_1407_1958 | 180 |
| 262 | 3300046678 | Ga0495599_0278917 | Ga0495599_0278917_115_657 | 180 |
| 263 | 3300046679 | Ga0495623_0244724 | Ga0495623_0244724_10_558 | 180 |
| 264 | 3300047317 | Ga0495604_0537737 | Ga0495604_0537737_25_567 | 180 |
| 265 | 3300047317 | Ga0495604_0598589 | Ga0495604_0598589_63_605 | 180 |
| 266 | 3300048910 | Ga0496107_0700792 | Ga0496107_0700792_182_724 | 180 |
| 267 | 3300048918 | Ga0496115_0728451 | Ga0496115_0728451_110_652 | 180 |
| 268 | 3300049460 | Ga0495682_0001351 | Ga0495682_0001351_1625_2176 | 180 |
| 269 | 3300049569 | Ga0501032_0208330 | Ga0501032_0208330_387_929 | 180 |
| 270 | 3300049570 | Ga0501033_0003652 | Ga0501033_0003652_4220_4762 | 180 |
| 271 | 3300049572 | Ga0501036_0255246 | Ga0501036_0255246_219_761 | 180 |
| 272 | 3300049573 | Ga0501037_0083160 | Ga0501037_0083160_301_843 | 180 |
| 273 | 3300049575 | Ga0501039_0265636 | Ga0501039_0265636_421_963 | 180 |
| 274 | 3300049579 | Ga0501043_0174589 | Ga0501043_0174589_1053_1595 | 180 |
| 275 | 3300049581 | Ga0501047_0004469 | Ga0501047_0004469_12206_12754 | 180 |
| 276 | 3300049581 | Ga0501047_0019694 | Ga0501047_0019694_5886_6428 | 180 |
| 277 | 3300049583 | Ga0501067_0015446 | Ga0501067_0015446_2372_2920 | 180 |
| 278 | 3300049586 | Ga0501070_0078606 | Ga0501070_0078606_1641_2189 | 180 |
| 279 | 3300049588 | Ga0501072_0016454 | Ga0501072_0016454_233_781 | 180 |
| 280 | 3300049589 | Ga0501073_0015989 | Ga0501073_0015989_233_781 | 180 |
| 281 | 3300049822 | Ga0501035_0180039 | Ga0501035_0180039_61_603 | 180 |
| 282 | 3300049823 | Ga0501044_0006571 | Ga0501044_0006571_4997_5539 | 180 |
| 283 | 3300053119 | Ga0500595_064675 | Ga0500595_064675_30_572 | 180 |
| 284 | 3300053133 | Ga0500655_009925 | Ga0500655_009925_387_938 | 180 |
| 285 | 3300053133 | Ga0500655_014893 | Ga0500655_014893_621_1172 | 180 |
| 286 | 3300054114 | Ga0501084_0058502 | Ga0501084_0058502_682_1230 | 180 |
| 287 | 3300005327 | Ga0070658_10081381 | Ga0070658_100813812 | 181 |
| 288 | 3300005336 | Ga0070680_100160327 | Ga0070680_1001603273 | 181 |
| 289 | 3300005339 | Ga0070660_100018798 | Ga0070660_1000187982 | 181 |
| 290 | 3300005341 | Ga0070691_10005590 | Ga0070691_100055904 | 181 |
| 291 | 3300005366 | Ga0070659_100072331 | Ga0070659_1000723313 | 181 |
| 292 | 3300005439 | Ga0070711_100574128 | Ga0070711_1005741282 | 181 |
| 293 | 3300005455 | Ga0070663_100077387 | Ga0070663_1000773874 | 181 |
| 294 | 3300005614 | Ga0068856_100489925 | Ga0068856_1004899252 | 181 |
| 295 | 3300006358 | Ga0068871_100637050 | Ga0068871_1006370501 | 181 |
| 296 | 3300009551 | Ga0105238_10011779 | Ga0105238_100117793 | 181 |
| 297 | 3300013307 | Ga0157372_10018787 | Ga0157372_100187878 | 181 |
| 298 | 3300013307 | Ga0157372_10067384 | Ga0157372_100673842 | 181 |
| 299 | 3300014969 | Ga0157376_10215293 | Ga0157376_102152932 | 181 |
| 300 | 3300021384 | Ga0213876_10000349 | Ga0213876_1000034943 | 181 |
| 301 | 3300025909 | Ga0207705_10000058 | Ga0207705_10000058133 | 181 |
| 302 | 3300025912 | Ga0207707_10001851 | Ga0207707_1000185127 | 181 |
| 303 | 3300025915 | Ga0207693_10197238 | Ga0207693_101972383 | 181 |
| 304 | 3300025917 | Ga0207660_10003913 | Ga0207660_100039135 | 181 |
| 305 | 3300025919 | Ga0207657_10001163 | Ga0207657_1000116313 | 181 |
| 306 | 3300025921 | Ga0207652_10017999 | Ga0207652_100179995 | 181 |
| 307 | 3300025924 | Ga0207694_10014783 | Ga0207694_100147832 | 181 |
| 308 | 3300025932 | Ga0207690_10012687 | Ga0207690_100126878 | 181 |
| 309 | 3300025949 | Ga0207667_10034264 | Ga0207667_1003426410 | 181 |
| 310 | 3300026067 | Ga0207678_10038547 | Ga0207678_100385472 | 181 |
| 311 | 3300026078 | Ga0207702_10186477 | Ga0207702_101864773 | 181 |
| 312 | 3300026078 | Ga0207702_10570803 | Ga0207702_105708032 | 181 |
| 313 | 3300031711 | Ga0265314_10004805 | Ga0265314_100048057 | 181 |
| 314 | 3300035410 | Ga0373924_0068382 | Ga0373924_0068382_400_978 | 181 |
| 315 | 3300035692 | Ga0373935_0205258 | Ga0373935_0205258_243_821 | 181 |
| 316 | 3300035725 | Ga0373947_0005370 | Ga0373947_0005370_5336_5914 | 181 |
| 317 | 3300037068 | Ga0373925_0012671 | Ga0373925_0012671_2990_3568 | 181 |
| 318 | 3300039437 | Ga0436365_0298223 | Ga0436365_0298223_38325_38885 | 181 |
| 319 | 3300039450 | Ga0436363_0444918 | Ga0436363_0444918_79_639 | 181 |
| 320 | 3300045976 | Ga0466967_0249353 | Ga0466967_0249353_742_1302 | 181 |
| 321 | 3300047319 | Ga0495674_0455199 | Ga0495674_0455199_174_752 | 181 |
| 322 | 3300047320 | Ga0495672_0213630 | Ga0495672_0213630_106_705 | 181 |
| 323 | 3300049568 | Ga0501031_0098537 | Ga0501031_0098537_639_1193 | 181 |
| 324 | 3300049568 | Ga0501031_0442113 | Ga0501031_0442113_15_569 | 181 |
| 325 | 3300049569 | Ga0501032_0066844 | Ga0501032_0066844_1342_1896 | 181 |
| 326 | 3300049569 | Ga0501032_0690600 | Ga0501032_0690600_55_609 | 181 |
| 327 | 3300049569 | Ga0501032_0710041 | Ga0501032_0710041_32_586 | 181 |
| 328 | 3300049570 | Ga0501033_0074498 | Ga0501033_0074498_86_640 | 181 |
| 329 | 3300049573 | Ga0501037_0042300 | Ga0501037_0042300_1694_2248 | 181 |
| 330 | 3300049574 | Ga0501038_0093566 | Ga0501038_0093566_405_959 | 181 |
| 331 | 3300049574 | Ga0501038_0436386 | Ga0501038_0436386_183_737 | 181 |
| 332 | 3300049579 | Ga0501043_0230319 | Ga0501043_0230319_639_1193 | 181 |
| 333 | 3300049580 | Ga0501046_0402827 | Ga0501046_0402827_169_723 | 181 |
| 334 | 3300049581 | Ga0501047_0208383 | Ga0501047_0208383_629_1183 | 181 |
| 335 | 3300049585 | Ga0501069_0030096 | Ga0501069_0030096_732_1286 | 181 |
| 336 | 3300049586 | Ga0501070_0000111 | Ga0501070_0000111_4212_4766 | 181 |
| 337 | 3300049741 | Ga0501079_0061970 | Ga0501079_0061970_1400_1954 | 181 |
| 338 | 3300049742 | Ga0501080_0018192 | Ga0501080_0018192_1112_1666 | 181 |
| 339 | 3300049822 | Ga0501035_0002206 | Ga0501035_0002206_7736_8290 | 181 |
| 340 | 3300049822 | Ga0501035_0049511 | Ga0501035_0049511_906_1460 | 181 |
| 341 | 3300049823 | Ga0501044_0003903 | Ga0501044_0003903_1614_2168 | 181 |
| 342 | 3300049823 | Ga0501044_0321349 | Ga0501044_0321349_780_1334 | 181 |
| 343 | 3300049823 | Ga0501044_0661978 | Ga0501044_0661978_339_893 | 181 |
| 344 | 3300005327 | Ga0070658_10013783 | Ga0070658_100137833 | 182 |
| 345 | 3300005329 | Ga0070683_100093250 | Ga0070683_1000932502 | 182 |
| 346 | 3300005336 | Ga0070680_100019997 | Ga0070680_1000199974 | 182 |
| 347 | 3300005339 | Ga0070660_100026293 | Ga0070660_1000262933 | 182 |
| 348 | 3300005341 | Ga0070691_10000082 | Ga0070691_1000008226 | 182 |
| 349 | 3300005344 | Ga0070661_100054716 | Ga0070661_1000547163 | 182 |
| 350 | 3300005434 | Ga0070709_10000238 | Ga0070709_1000023839 | 182 |
| 351 | 3300005434 | Ga0070709_10062345 | Ga0070709_100623452 | 182 |
| 352 | 3300005435 | Ga0070714_100031391 | Ga0070714_1000313915 | 182 |
| 353 | 3300005436 | Ga0070713_100000011 | Ga0070713_10000001181 | 182 |
| 354 | 3300005439 | Ga0070711_100103191 | Ga0070711_1001031914 | 182 |
| 355 | 3300005458 | Ga0070681_10030628 | Ga0070681_100306285 | 182 |
| 356 | 3300005458 | Ga0070681_10151923 | Ga0070681_101519234 | 182 |
| 357 | 3300005458 | Ga0070681_10550473 | Ga0070681_105504732 | 182 |
| 358 | 3300005530 | Ga0070679_100111217 | Ga0070679_1001112173 | 182 |
| 359 | 3300005530 | Ga0070679_100615794 | Ga0070679_1006157942 | 182 |
| 360 | 3300005530 | Ga0070679_101198240 | Ga0070679_1011982401 | 182 |
| 361 | 3300005535 | Ga0070684_100041676 | Ga0070684_1000416764 | 182 |
| 362 | 3300005539 | Ga0068853_100108211 | Ga0068853_1001082112 | 182 |
| 363 | 3300005546 | Ga0070696_100028174 | Ga0070696_1000281745 | 182 |
| 364 | 3300005547 | Ga0070693_100395766 | Ga0070693_1003957661 | 182 |
| 365 | 3300005548 | Ga0070665_100002597 | Ga0070665_10000259723 | 182 |
| 366 | 3300005563 | Ga0068855_100201419 | Ga0068855_1002014191 | 182 |
| 367 | 3300005577 | Ga0068857_100005182 | Ga0068857_10000518212 | 182 |
| 368 | 3300005577 | Ga0068857_100184306 | Ga0068857_1001843062 | 182 |
| 369 | 3300005614 | Ga0068856_100000964 | Ga0068856_10000096416 | 182 |
| 370 | 3300005614 | Ga0068856_100003424 | Ga0068856_1000034245 | 182 |
| 371 | 3300005614 | Ga0068856_100133424 | Ga0068856_1001334243 | 182 |
| 372 | 3300005616 | Ga0068852_100005817 | Ga0068852_1000058175 | 182 |
| 373 | 3300005616 | Ga0068852_100244694 | Ga0068852_1002446943 | 182 |
| 374 | 3300005844 | Ga0068862_100701224 | Ga0068862_1007012242 | 182 |
| 375 | 3300006173 | Ga0070716_100514844 | Ga0070716_1005148442 | 182 |
| 376 | 3300006175 | Ga0070712_100000014 | Ga0070712_10000001482 | 182 |
| 377 | 3300006358 | Ga0068871_100403905 | Ga0068871_1004039052 | 182 |
| 378 | 3300006914 | Ga0075436_100000047 | Ga0075436_10000004747 | 182 |
| 379 | 3300006914 | Ga0075436_100031385 | Ga0075436_1000313852 | 182 |
| 380 | 3300007076 | Ga0075435_100095705 | Ga0075435_1000957054 | 182 |
| 381 | 3300009093 | Ga0105240_10000355 | Ga0105240_1000035539 | 182 |
| 382 | 3300009093 | Ga0105240_10179345 | Ga0105240_101793454 | 182 |
| 383 | 3300009093 | Ga0105240_10212523 | Ga0105240_102125233 | 182 |
| 384 | 3300009093 | Ga0105240_10274319 | Ga0105240_102743192 | 182 |
| 385 | 3300009093 | Ga0105240_10318352 | Ga0105240_103183522 | 182 |
| 386 | 3300009093 | Ga0105240_11587609 | Ga0105240_115876091 | 182 |
| 387 | 3300009174 | Ga0105241_10028509 | Ga0105241_100285095 | 182 |
| 388 | 3300009545 | Ga0105237_10008237 | Ga0105237_1000823714 | 182 |
| 389 | 3300009551 | Ga0105238_10011985 | Ga0105238_100119858 | 182 |
| 390 | 3300009551 | Ga0105238_10127064 | Ga0105238_101270643 | 182 |
| 391 | 3300009551 | Ga0105238_10996179 | Ga0105238_109961792 | 182 |
| 392 | 3300010375 | Ga0105239_10072584 | Ga0105239_100725842 | 182 |
| 393 | 3300010375 | Ga0105239_10921580 | Ga0105239_109215801 | 182 |
| 394 | 3300010375 | Ga0105239_11022513 | Ga0105239_110225132 | 182 |
| 395 | 3300013100 | Ga0157373_10003903 | Ga0157373_100039035 | 182 |
| 396 | 3300013104 | Ga0157370_10000280 | Ga0157370_1000028016 | 182 |
| 397 | 3300013104 | Ga0157370_10280808 | Ga0157370_102808082 | 182 |
| 398 | 3300013104 | Ga0157370_10372649 | Ga0157370_103726493 | 182 |
| 399 | 3300013105 | Ga0157369_10004867 | Ga0157369_1000486714 | 182 |
| 400 | 3300013105 | Ga0157369_10218750 | Ga0157369_102187502 | 182 |
| 401 | 3300013296 | Ga0157374_10028010 | Ga0157374_100280104 | 182 |
| 402 | 3300013297 | Ga0157378_10369347 | Ga0157378_103693472 | 182 |
| 403 | 3300013306 | Ga0163162_10084081 | Ga0163162_100840815 | 182 |
| 404 | 3300013307 | Ga0157372_10008076 | Ga0157372_100080765 | 182 |
| 405 | 3300014968 | Ga0157379_10001126 | Ga0157379_1000112620 | 182 |
| 406 | 3300014968 | Ga0157379_10001288 | Ga0157379_100012884 | 182 |
| 407 | 3300025906 | Ga0207699_10000233 | Ga0207699_100002334 | 182 |
| 408 | 3300025906 | Ga0207699_10050030 | Ga0207699_100500302 | 182 |
| 409 | 3300025909 | Ga0207705_10013975 | Ga0207705_100139754 | 182 |
| 410 | 3300025911 | Ga0207654_10028143 | Ga0207654_100281434 | 182 |
| 411 | 3300025912 | Ga0207707_10131316 | Ga0207707_101313163 | 182 |
| 412 | 3300025912 | Ga0207707_10132852 | Ga0207707_101328521 | 182 |
| 413 | 3300025912 | Ga0207707_10367173 | Ga0207707_103671732 | 182 |
| 414 | 3300025913 | Ga0207695_10016906 | Ga0207695_100169067 | 182 |
| 415 | 3300025913 | Ga0207695_10084002 | Ga0207695_100840024 | 182 |
| 416 | 3300025913 | Ga0207695_10111558 | Ga0207695_101115583 | 182 |
| 417 | 3300025913 | Ga0207695_10210009 | Ga0207695_102100092 | 182 |
| 418 | 3300025913 | Ga0207695_10219053 | Ga0207695_102190531 | 182 |
| 419 | 3300025914 | Ga0207671_10074643 | Ga0207671_100746432 | 182 |
| 420 | 3300025915 | Ga0207693_10000018 | Ga0207693_1000001835 | 182 |
| 421 | 3300025916 | Ga0207663_10075064 | Ga0207663_100750642 | 182 |
| 422 | 3300025917 | Ga0207660_10059809 | Ga0207660_100598093 | 182 |
| 423 | 3300025919 | Ga0207657_10048575 | Ga0207657_100485754 | 182 |
| 424 | 3300025920 | Ga0207649_10060208 | Ga0207649_100602083 | 182 |
| 425 | 3300025924 | Ga0207694_10021944 | Ga0207694_100219444 | 182 |
| 426 | 3300025928 | Ga0207700_10000005 | Ga0207700_1000000546 | 182 |
| 427 | 3300025929 | Ga0207664_10014515 | Ga0207664_100145153 | 182 |
| 428 | 3300025944 | Ga0207661_10511385 | Ga0207661_105113852 | 182 |
| 429 | 3300025949 | Ga0207667_10007703 | Ga0207667_1000770312 | 182 |
| 430 | 3300025949 | Ga0207667_10035769 | Ga0207667_100357696 | 182 |
| 431 | 3300025981 | Ga0207640_10492173 | Ga0207640_104921732 | 182 |
| 432 | 3300026041 | Ga0207639_10159886 | Ga0207639_101598863 | 182 |
| 433 | 3300026078 | Ga0207702_10000173 | Ga0207702_100001734 | 182 |
| 434 | 3300026078 | Ga0207702_10001080 | Ga0207702_1000108018 | 182 |
| 435 | 3300026078 | Ga0207702_10785095 | Ga0207702_107850952 | 182 |
| 436 | 3300026078 | Ga0207702_10967097 | Ga0207702_109670971 | 182 |
| 437 | 3300026078 | Ga0207702_11332994 | Ga0207702_113329941 | 182 |
| 438 | 3300026116 | Ga0207674_10000112 | Ga0207674_1000011239 | 182 |
| 439 | 3300026116 | Ga0207674_10217525 | Ga0207674_102175252 | 182 |
| 440 | 3300026142 | Ga0207698_10007028 | Ga0207698_100070287 | 182 |
| 441 | 3300026142 | Ga0207698_10896152 | Ga0207698_108961522 | 182 |
| 442 | 3300028379 | Ga0268266_10000463 | Ga0268266_100004637 | 182 |
| 443 | 3300028800 | Ga0265338_10001087 | Ga0265338_1000108725 | 182 |
| 444 | 3300028800 | Ga0265338_10072489 | Ga0265338_100724892 | 182 |
| 445 | 3300031235 | Ga0265330_10009167 | Ga0265330_100091676 | 182 |
| 446 | 3300031235 | Ga0265330_10067547 | Ga0265330_100675472 | 182 |
| 447 | 3300031238 | Ga0265332_10195710 | Ga0265332_101957102 | 182 |
| 448 | 3300031238 | Ga0265332_10250540 | Ga0265332_102505402 | 182 |
| 449 | 3300031240 | Ga0265320_10003153 | Ga0265320_1000315312 | 182 |
| 450 | 3300031241 | Ga0265325_10000094 | Ga0265325_1000009460 | 182 |
| 451 | 3300031241 | Ga0265325_10002838 | Ga0265325_100028382 | 182 |
| 452 | 3300031247 | Ga0265340_10000159 | Ga0265340_1000015911 | 182 |
| 453 | 3300031247 | Ga0265340_10000562 | Ga0265340_100005629 | 182 |
| 454 | 3300031247 | Ga0265340_10006207 | Ga0265340_100062077 | 182 |
| 455 | 3300031249 | Ga0265339_10007160 | Ga0265339_100071605 | 182 |
| 456 | 3300031249 | Ga0265339_10008384 | Ga0265339_100083842 | 182 |
| 457 | 3300031249 | Ga0265339_10048309 | Ga0265339_100483092 | 182 |
| 458 | 3300031250 | Ga0265331_10000009 | Ga0265331_10000009253 | 182 |
| 459 | 3300031344 | Ga0265316_10004977 | Ga0265316_100049773 | 182 |
| 460 | 3300031344 | Ga0265316_10020381 | Ga0265316_100203814 | 182 |
| 461 | 3300031344 | Ga0265316_10388159 | Ga0265316_103881592 | 182 |
| 462 | 3300031595 | Ga0265313_10043318 | Ga0265313_100433183 | 182 |
| 463 | 3300031711 | Ga0265314_10004872 | Ga0265314_100048727 | 182 |
| 464 | 3300031711 | Ga0265314_10031751 | Ga0265314_100317513 | 182 |
| 465 | 3300031711 | Ga0265314_10057403 | Ga0265314_100574034 | 182 |
| 466 | 3300031711 | Ga0265314_10085255 | Ga0265314_100852552 | 182 |
| 467 | 3300031711 | Ga0265314_10126486 | Ga0265314_101264862 | 182 |
| 468 | 3300031711 | Ga0265314_10133311 | Ga0265314_101333112 | 182 |
| 469 | 3300031712 | Ga0265342_10042692 | Ga0265342_100426924 | 182 |
| 470 | 3300031712 | Ga0265342_10160731 | Ga0265342_101607313 | 182 |
| 471 | 3300031712 | Ga0265342_10218665 | Ga0265342_102186652 | 182 |
| 472 | 3300035086 | Ga0373934_0060273 | Ga0373934_0060273_81_635 | 182 |
| 473 | 3300035111 | Ga0373923_0026149 | Ga0373923_0026149_1188_1742 | 182 |
| 474 | 3300035112 | Ga0373932_0109557 | Ga0373932_0109557_136_690 | 182 |
| 475 | 3300035692 | Ga0373935_0230956 | Ga0373935_0230956_305_859 | 182 |
| 476 | 3300035724 | Ga0373933_0352929 | Ga0373933_0352929_251_805 | 182 |
| 477 | 3300036401 | Ga0373937_0006814 | Ga0373937_0006814_4666_5220 | 182 |
| 478 | 3300037068 | Ga0373925_0050470 | Ga0373925_0050470_1589_2143 | 182 |
| 479 | 3300037418 | Ga0395900_0088308 | Ga0395900_0088308_2201_2749 | 182 |
| 480 | 3300037466 | Ga0395898_0026131 | Ga0395898_0026131_1177_1725 | 182 |
| 481 | 3300038443 | Ga0395901_0743540 | Ga0395901_0743540_114_662 | 182 |
| 482 | 3300039438 | Ga0436360_1347255 | Ga0436360_1347255_1297_1845 | 182 |
| 483 | 3300044684 | Ga0466966_0457464 | Ga0466966_0457464_125_673 | 182 |
| 484 | 3300044842 | Ga0466957_0318629 | Ga0466957_0318629_456_1004 | 182 |
| 485 | 3300045976 | Ga0466967_0268247 | Ga0466967_0268247_509_1057 | 182 |
| 486 | 3300046472 | Ga0495580_0076015 | Ga0495580_0076015_1579_2133 | 182 |
| 487 | 3300046536 | Ga0495587_0448709 | Ga0495587_0448709_110_670 | 182 |
| 488 | 3300048913 | Ga0496110_1186935 | Ga0496110_1186935_22_576 | 182 |
| 489 | 3300049570 | Ga0501033_0008546 | Ga0501033_0008546_3723_4271 | 182 |
| 490 | 3300049571 | Ga0501034_0810797 | Ga0501034_0810797_53_601 | 182 |
| 491 | 3300049573 | Ga0501037_0042558 | Ga0501037_0042558_436_984 | 182 |
| 492 | 3300049579 | Ga0501043_0334197 | Ga0501043_0334197_181_729 | 182 |
| 493 | 3300049580 | Ga0501046_0259564 | Ga0501046_0259564_196_753 | 182 |
| 494 | 3300049580 | Ga0501046_0444396 | Ga0501046_0444396_32_580 | 182 |
| 495 | 3300049581 | Ga0501047_0028145 | Ga0501047_0028145_995_1543 | 182 |
| 496 | 3300049589 | Ga0501073_0240222 | Ga0501073_0240222_177_725 | 182 |
| 497 | 3300049742 | Ga0501080_0060319 | Ga0501080_0060319_283_831 | 182 |
| 498 | 3300049744 | Ga0501083_0302071 | Ga0501083_0302071_444_1004 | 182 |
| 499 | 3300049822 | Ga0501035_0237743 | Ga0501035_0237743_834_1382 | 182 |
| 500 | 3300049823 | Ga0501044_0050191 | Ga0501044_0050191_317_865 | 182 |
| 501 | 3300049823 | Ga0501044_0293674 | Ga0501044_0293674_538_1086 | 182 |
| 502 | 3300050514 | nmdc:mga08x19_62_c1 | nmdc:mga08x19_62_c1_75152_75706 | 182 |
| 503 | 3300005436 | Ga0070713_100382226 | Ga0070713_1003822263 | 183 |
| 504 | 3300005614 | Ga0068856_100254860 | Ga0068856_1002548602 | 183 |
| 505 | 3300009093 | Ga0105240_10280267 | Ga0105240_102802673 | 183 |
| 506 | 3300014968 | Ga0157379_10098254 | Ga0157379_100982542 | 183 |
| 507 | 3300025906 | Ga0207699_10216354 | Ga0207699_102163542 | 183 |
| 508 | 3300025913 | Ga0207695_10203598 | Ga0207695_102035983 | 183 |
| 509 | 3300025920 | Ga0207649_10000026 | Ga0207649_10000026119 | 183 |
| 510 | 3300025928 | Ga0207700_10317230 | Ga0207700_103172303 | 183 |
| 511 | 3300026078 | Ga0207702_10266776 | Ga0207702_102667762 | 183 |
| 512 | 3300031249 | Ga0265339_10239321 | Ga0265339_102393212 | 183 |
| 513 | 3300031250 | Ga0265331_10000008 | Ga0265331_10000008238 | 183 |
| 514 | 3300031251 | Ga0265327_10000036 | Ga0265327_10000036118 | 183 |
| 515 | 3300031344 | Ga0265316_10025982 | Ga0265316_100259826 | 183 |
| 516 | 3300031711 | Ga0265314_10119429 | Ga0265314_101194292 | 183 |
| 517 | 3300046507 | Ga0495606_0224960 | Ga0495606_0224960_182_733 | 183 |
| 518 | 3300049580 | Ga0501046_0007202 | Ga0501046_0007202_3862_4425 | 183 |
| 519 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035205 | 184 |
| 520 | 3300005328 | Ga0070676_10001376 | Ga0070676_100013762 | 184 |
| 521 | 3300005334 | Ga0068869_100002394 | Ga0068869_1000023945 | 184 |
| 522 | 3300005334 | Ga0068869_100557039 | Ga0068869_1005570391 | 184 |
| 523 | 3300005335 | Ga0070666_10006536 | Ga0070666_100065363 | 184 |
| 524 | 3300005335 | Ga0070666_10234152 | Ga0070666_102341522 | 184 |
| 525 | 3300005338 | Ga0068868_100074643 | Ga0068868_1000746433 | 184 |
| 526 | 3300005338 | Ga0068868_100400203 | Ga0068868_1004002031 | 184 |
| 527 | 3300005340 | Ga0070689_100141098 | Ga0070689_1001410982 | 184 |
| 528 | 3300005344 | Ga0070661_100037883 | Ga0070661_1000378833 | 184 |
| 529 | 3300005344 | Ga0070661_100608826 | Ga0070661_1006088262 | 184 |
| 530 | 3300005354 | Ga0070675_100338256 | Ga0070675_1003382562 | 184 |
| 531 | 3300005355 | Ga0070671_100071315 | Ga0070671_1000713152 | 184 |
| 532 | 3300005364 | Ga0070673_100185669 | Ga0070673_1001856692 | 184 |
| 533 | 3300005366 | Ga0070659_100018711 | Ga0070659_1000187116 | 184 |
| 534 | 3300005367 | Ga0070667_100012865 | Ga0070667_1000128655 | 184 |
| 535 | 3300005367 | Ga0070667_100338864 | Ga0070667_1003388642 | 184 |
| 536 | 3300005435 | Ga0070714_100844900 | Ga0070714_1008449001 | 184 |
| 537 | 3300005436 | Ga0070713_101299615 | Ga0070713_1012996151 | 184 |
| 538 | 3300005456 | Ga0070678_100002013 | Ga0070678_1000020135 | 184 |
| 539 | 3300005456 | Ga0070678_100031753 | Ga0070678_1000317533 | 184 |
| 540 | 3300005456 | Ga0070678_100851611 | Ga0070678_1008516112 | 184 |
| 541 | 3300005457 | Ga0070662_100125309 | Ga0070662_1001253093 | 184 |
| 542 | 3300005459 | Ga0068867_100014884 | Ga0068867_1000148847 | 184 |
| 543 | 3300005459 | Ga0068867_100347906 | Ga0068867_1003479063 | 184 |
| 544 | 3300005459 | Ga0068867_100935507 | Ga0068867_1009355071 | 184 |
| 545 | 3300005535 | Ga0070684_100089015 | Ga0070684_1000890154 | 184 |
| 546 | 3300005539 | Ga0068853_101171351 | Ga0068853_1011713511 | 184 |
| 547 | 3300005539 | Ga0068853_101199680 | Ga0068853_1011996802 | 184 |
| 548 | 3300005548 | Ga0070665_100049419 | Ga0070665_1000494191 | 184 |
| 549 | 3300005548 | Ga0070665_100057758 | Ga0070665_1000577585 | 184 |
| 550 | 3300005548 | Ga0070665_100292094 | Ga0070665_1002920941 | 184 |
| 551 | 3300005563 | Ga0068855_101203256 | Ga0068855_1012032561 | 184 |
| 552 | 3300005564 | Ga0070664_100833273 | Ga0070664_1008332731 | 184 |
| 553 | 3300005617 | Ga0068859_100202702 | Ga0068859_1002027023 | 184 |
| 554 | 3300005718 | Ga0068866_10026254 | Ga0068866_100262542 | 184 |
| 555 | 3300005719 | Ga0068861_100581765 | Ga0068861_1005817652 | 184 |
| 556 | 3300005841 | Ga0068863_100201536 | Ga0068863_1002015362 | 184 |
| 557 | 3300005842 | Ga0068858_100132435 | Ga0068858_1001324353 | 184 |
| 558 | 3300006237 | Ga0097621_100011176 | Ga0097621_1000111764 | 184 |
| 559 | 3300006237 | Ga0097621_100019884 | Ga0097621_1000198844 | 184 |
| 560 | 3300006237 | Ga0097621_100222939 | Ga0097621_1002229392 | 184 |
| 561 | 3300006237 | Ga0097621_100335572 | Ga0097621_1003355722 | 184 |
| 562 | 3300006237 | Ga0097621_100578230 | Ga0097621_1005782302 | 184 |
| 563 | 3300006358 | Ga0068871_100076324 | Ga0068871_1000763244 | 184 |
| 564 | 3300006358 | Ga0068871_100117583 | Ga0068871_1001175833 | 184 |
| 565 | 3300006358 | Ga0068871_100143736 | Ga0068871_1001437363 | 184 |
| 566 | 3300006881 | Ga0068865_100025832 | Ga0068865_1000258324 | 184 |
| 567 | 3300006931 | Ga0097620_100202706 | Ga0097620_1002027063 | 184 |
| 568 | 3300009093 | Ga0105240_10038465 | Ga0105240_100384652 | 184 |
| 569 | 3300009093 | Ga0105240_10158446 | Ga0105240_101584462 | 184 |
| 570 | 3300009098 | Ga0105245_10070841 | Ga0105245_100708414 | 184 |
| 571 | 3300009098 | Ga0105245_10133433 | Ga0105245_101334332 | 184 |
| 572 | 3300009174 | Ga0105241_10022531 | Ga0105241_100225316 | 184 |
| 573 | 3300009174 | Ga0105241_10213252 | Ga0105241_102132522 | 184 |
| 574 | 3300009174 | Ga0105241_11026461 | Ga0105241_110264611 | 184 |
| 575 | 3300009177 | Ga0105248_10031038 | Ga0105248_100310383 | 184 |
| 576 | 3300009177 | Ga0105248_10109932 | Ga0105248_101099323 | 184 |
| 577 | 3300009177 | Ga0105248_10860054 | Ga0105248_108600541 | 184 |
| 578 | 3300009545 | Ga0105237_10015763 | Ga0105237_100157633 | 184 |
| 579 | 3300009545 | Ga0105237_10126897 | Ga0105237_101268972 | 184 |
| 580 | 3300009545 | Ga0105237_10167542 | Ga0105237_101675422 | 184 |
| 581 | 3300009551 | Ga0105238_10171636 | Ga0105238_101716362 | 184 |
| 582 | 3300009551 | Ga0105238_10183728 | Ga0105238_101837282 | 184 |
| 583 | 3300009553 | Ga0105249_10017761 | Ga0105249_100177617 | 184 |
| 584 | 3300010375 | Ga0105239_10150764 | Ga0105239_101507642 | 184 |
| 585 | 3300010375 | Ga0105239_10221464 | Ga0105239_102214642 | 184 |
| 586 | 3300010375 | Ga0105239_10384132 | Ga0105239_103841323 | 184 |
| 587 | 3300010375 | Ga0105239_10471047 | Ga0105239_104710472 | 184 |
| 588 | 3300010375 | Ga0105239_10532578 | Ga0105239_105325782 | 184 |
| 589 | 3300011119 | Ga0105246_10009904 | Ga0105246_100099043 | 184 |
| 590 | 3300011119 | Ga0105246_10039465 | Ga0105246_100394652 | 184 |
| 591 | 3300013104 | Ga0157370_10004453 | Ga0157370_1000445314 | 184 |
| 592 | 3300013104 | Ga0157370_11111260 | Ga0157370_111112601 | 184 |
| 593 | 3300013105 | Ga0157369_10378540 | Ga0157369_103785403 | 184 |
| 594 | 3300013296 | Ga0157374_10025468 | Ga0157374_100254684 | 184 |
| 595 | 3300013296 | Ga0157374_10119881 | Ga0157374_101198814 | 184 |
| 596 | 3300013297 | Ga0157378_10324537 | Ga0157378_103245372 | 184 |
| 597 | 3300013297 | Ga0157378_12127855 | Ga0157378_121278551 | 184 |
| 598 | 3300013306 | Ga0163162_10044647 | Ga0163162_100446474 | 184 |
| 599 | 3300013307 | Ga0157372_10071967 | Ga0157372_100719674 | 184 |
| 600 | 3300013308 | Ga0157375_10022440 | Ga0157375_100224402 | 184 |
| 601 | 3300013308 | Ga0157375_10358402 | Ga0157375_103584022 | 184 |
| 602 | 3300013308 | Ga0157375_10490806 | Ga0157375_104908062 | 184 |
| 603 | 3300014325 | Ga0163163_10533937 | Ga0163163_105339372 | 184 |
| 604 | 3300014326 | Ga0157380_10139607 | Ga0157380_101396072 | 184 |
| 605 | 3300014968 | Ga0157379_10002345 | Ga0157379_100023455 | 184 |
| 606 | 3300014968 | Ga0157379_10014522 | Ga0157379_100145226 | 184 |
| 607 | 3300014968 | Ga0157379_10102466 | Ga0157379_101024663 | 184 |
| 608 | 3300014968 | Ga0157379_10139661 | Ga0157379_101396614 | 184 |
| 609 | 3300014968 | Ga0157379_10155032 | Ga0157379_101550322 | 184 |
| 610 | 3300014969 | Ga0157376_10002383 | Ga0157376_1000238310 | 184 |
| 611 | 3300017792 | Ga0163161_10003599 | Ga0163161_100035993 | 184 |
| 612 | 3300025231 | Ga0207427_104408 | Ga0207427_1044082 | 184 |
| 613 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006699 | 184 |
| 614 | 3300025899 | Ga0207642_10042316 | Ga0207642_100423163 | 184 |
| 615 | 3300025899 | Ga0207642_10713787 | Ga0207642_107137871 | 184 |
| 616 | 3300025903 | Ga0207680_10005414 | Ga0207680_100054143 | 184 |
| 617 | 3300025903 | Ga0207680_10288154 | Ga0207680_102881542 | 184 |
| 618 | 3300025911 | Ga0207654_10011752 | Ga0207654_100117527 | 184 |
| 619 | 3300025911 | Ga0207654_10022256 | Ga0207654_100222564 | 184 |
| 620 | 3300025911 | Ga0207654_10135167 | Ga0207654_101351673 | 184 |
| 621 | 3300025911 | Ga0207654_10154266 | Ga0207654_101542661 | 184 |
| 622 | 3300025913 | Ga0207695_10135676 | Ga0207695_101356762 | 184 |
| 623 | 3300025913 | Ga0207695_10161510 | Ga0207695_101615102 | 184 |
| 624 | 3300025914 | Ga0207671_10032398 | Ga0207671_100323986 | 184 |
| 625 | 3300025919 | Ga0207657_10076217 | Ga0207657_100762172 | 184 |
| 626 | 3300025924 | Ga0207694_10044508 | Ga0207694_100445084 | 184 |
| 627 | 3300025927 | Ga0207687_10058623 | Ga0207687_100586233 | 184 |
| 628 | 3300025927 | Ga0207687_11345223 | Ga0207687_113452231 | 184 |
| 629 | 3300025928 | Ga0207700_10225704 | Ga0207700_102257042 | 184 |
| 630 | 3300025931 | Ga0207644_10066078 | Ga0207644_100660784 | 184 |
| 631 | 3300025932 | Ga0207690_10151761 | Ga0207690_101517613 | 184 |
| 632 | 3300025933 | Ga0207706_10141251 | Ga0207706_101412511 | 184 |
| 633 | 3300025934 | Ga0207686_10020821 | Ga0207686_100208214 | 184 |
| 634 | 3300025934 | Ga0207686_10118851 | Ga0207686_101188513 | 184 |
| 635 | 3300025936 | Ga0207670_10480591 | Ga0207670_104805911 | 184 |
| 636 | 3300025937 | Ga0207669_10371373 | Ga0207669_103713733 | 184 |
| 637 | 3300025938 | Ga0207704_10069864 | Ga0207704_100698643 | 184 |
| 638 | 3300025938 | Ga0207704_10596202 | Ga0207704_105962022 | 184 |
| 639 | 3300025941 | Ga0207711_10013219 | Ga0207711_100132194 | 184 |
| 640 | 3300025941 | Ga0207711_10776377 | Ga0207711_107763772 | 184 |
| 641 | 3300025942 | Ga0207689_10172354 | Ga0207689_101723543 | 184 |
| 642 | 3300025942 | Ga0207689_10195534 | Ga0207689_101955342 | 184 |
| 643 | 3300025944 | Ga0207661_10317265 | Ga0207661_103172652 | 184 |
| 644 | 3300025945 | Ga0207679_10327116 | Ga0207679_103271161 | 184 |
| 645 | 3300025949 | Ga0207667_10963687 | Ga0207667_109636872 | 184 |
| 646 | 3300025961 | Ga0207712_10014867 | Ga0207712_100148673 | 184 |
| 647 | 3300025961 | Ga0207712_10317962 | Ga0207712_103179622 | 184 |
| 648 | 3300025981 | Ga0207640_10040754 | Ga0207640_100407543 | 184 |
| 649 | 3300025986 | Ga0207658_10023373 | Ga0207658_100233733 | 184 |
| 650 | 3300026023 | Ga0207677_10004318 | Ga0207677_100043186 | 184 |
| 651 | 3300026023 | Ga0207677_10235130 | Ga0207677_102351302 | 184 |
| 652 | 3300026023 | Ga0207677_10764053 | Ga0207677_107640532 | 184 |
| 653 | 3300026035 | Ga0207703_10017934 | Ga0207703_100179346 | 184 |
| 654 | 3300026035 | Ga0207703_10108592 | Ga0207703_101085923 | 184 |
| 655 | 3300026041 | Ga0207639_10338157 | Ga0207639_103381573 | 184 |
| 656 | 3300026041 | Ga0207639_11024687 | Ga0207639_110246871 | 184 |
| 657 | 3300026075 | Ga0207708_11099144 | Ga0207708_110991442 | 184 |
| 658 | 3300026078 | Ga0207702_11721360 | Ga0207702_117213601 | 184 |
| 659 | 3300026089 | Ga0207648_10115605 | Ga0207648_101156054 | 184 |
| 660 | 3300026121 | Ga0207683_10003082 | Ga0207683_100030826 | 184 |
| 661 | 3300026121 | Ga0207683_10049440 | Ga0207683_100494403 | 184 |
| 662 | 3300028379 | Ga0268266_10079718 | Ga0268266_100797184 | 184 |
| 663 | 3300028379 | Ga0268266_10172741 | Ga0268266_101727413 | 184 |
| 664 | 3300028379 | Ga0268266_10524252 | Ga0268266_105242522 | 184 |
| 665 | 3300028379 | Ga0268266_10551484 | Ga0268266_105514842 | 184 |
| 666 | 3300028379 | Ga0268266_11027791 | Ga0268266_110277912 | 184 |
| 667 | 3300028379 | Ga0268266_11192895 | Ga0268266_111928952 | 184 |
| 668 | 3300028800 | Ga0265338_10072660 | Ga0265338_100726603 | 184 |
| 669 | 3300031239 | Ga0265328_10022854 | Ga0265328_100228542 | 184 |
| 670 | 3300031241 | Ga0265325_10002373 | Ga0265325_100023732 | 184 |
| 671 | 3300031241 | Ga0265325_10002474 | Ga0265325_1000247413 | 184 |
| 672 | 3300031247 | Ga0265340_10180493 | Ga0265340_101804931 | 184 |
| 673 | 3300031249 | Ga0265339_10026142 | Ga0265339_100261424 | 184 |
| 674 | 3300031250 | Ga0265331_10199879 | Ga0265331_101998792 | 184 |
| 675 | 3300031595 | Ga0265313_10002778 | Ga0265313_1000277812 | 184 |
| 676 | 3300031595 | Ga0265313_10137862 | Ga0265313_101378622 | 184 |
| 677 | 3300031616 | Ga0307508_10321667 | Ga0307508_103216672 | 184 |
| 678 | 3300031711 | Ga0265314_10001062 | Ga0265314_1000106222 | 184 |
| 679 | 3300031711 | Ga0265314_10086371 | Ga0265314_100863712 | 184 |
| 680 | 3300031711 | Ga0265314_10161231 | Ga0265314_101612312 | 184 |
| 681 | 3300031712 | Ga0265342_10007158 | Ga0265342_100071588 | 184 |
| 682 | 3300031730 | Ga0307516_10061230 | Ga0307516_100612303 | 184 |
| 683 | 3300039437 | Ga0436365_0570483 | Ga0436365_0570483_344_901 | 184 |
| 684 | 3300039437 | Ga0436365_1223073 | Ga0436365_1223073_329_886 | 184 |
| 685 | 3300041452 | Ga0451793_0085511 | Ga0451793_0085511_284_838 | 184 |
| 686 | 3300041458 | Ga0451798_0040364 | Ga0451798_0040364_114_668 | 184 |
| 687 | 3300041512 | Ga0451853_0112512 | Ga0451853_0112512_193_747 | 184 |
| 688 | 3300046492 | Ga0495585_0281721 | Ga0495585_0281721_91_645 | 184 |
| 689 | 3300046538 | Ga0495609_0017425 | Ga0495609_0017425_1959_2513 | 184 |
| 690 | 3300046615 | Ga0495656_0159491 | Ga0495656_0159491_135_689 | 184 |
| 691 | 3300046663 | Ga0495635_0238754 | Ga0495635_0238754_481_1035 | 184 |
| 692 | 3300046684 | Ga0495669_0325374 | Ga0495669_0325374_69_623 | 184 |
| 693 | 3300046794 | Ga0495589_0027867 | Ga0495589_0027867_195_749 | 184 |
| 694 | 3300047318 | Ga0495636_0032689 | Ga0495636_0032689_133_687 | 184 |
| 695 | 3300047321 | Ga0495676_0156074 | Ga0495676_0156074_1027_1581 | 184 |
| 696 | 3300048924 | Ga0496121_0000987 | Ga0496121_0000987_3233_3790 | 184 |
| 697 | 3300049568 | Ga0501031_0003423 | Ga0501031_0003423_6744_7298 | 184 |
| 698 | 3300049569 | Ga0501032_0007623 | Ga0501032_0007623_4954_5508 | 184 |
| 699 | 3300049569 | Ga0501032_0219006 | Ga0501032_0219006_670_1224 | 184 |
| 700 | 3300049569 | Ga0501032_0287080 | Ga0501032_0287080_104_661 | 184 |
| 701 | 3300049570 | Ga0501033_0002118 | Ga0501033_0002118_1754_2323 | 184 |
| 702 | 3300049570 | Ga0501033_0018864 | Ga0501033_0018864_3128_3682 | 184 |
| 703 | 3300049570 | Ga0501033_0194356 | Ga0501033_0194356_153_707 | 184 |
| 704 | 3300049570 | Ga0501033_0386954 | Ga0501033_0386954_33_587 | 184 |
| 705 | 3300049571 | Ga0501034_0035157 | Ga0501034_0035157_3700_4254 | 184 |
| 706 | 3300049571 | Ga0501034_0181610 | Ga0501034_0181610_1451_2005 | 184 |
| 707 | 3300049572 | Ga0501036_0006658 | Ga0501036_0006658_4084_4638 | 184 |
| 708 | 3300049572 | Ga0501036_0140420 | Ga0501036_0140420_29_583 | 184 |
| 709 | 3300049572 | Ga0501036_0918149 | Ga0501036_0918149_81_635 | 184 |
| 710 | 3300049573 | Ga0501037_0008387 | Ga0501037_0008387_5811_6365 | 184 |
| 711 | 3300049574 | Ga0501038_0070728 | Ga0501038_0070728_1013_1567 | 184 |
| 712 | 3300049574 | Ga0501038_0746217 | Ga0501038_0746217_23_577 | 184 |
| 713 | 3300049575 | Ga0501039_0269245 | Ga0501039_0269245_718_1272 | 184 |
| 714 | 3300049576 | Ga0501040_0144033 | Ga0501040_0144033_634_1188 | 184 |
| 715 | 3300049578 | Ga0501042_0035014 | Ga0501042_0035014_157_711 | 184 |
| 716 | 3300049579 | Ga0501043_0234094 | Ga0501043_0234094_520_1074 | 184 |
| 717 | 3300049580 | Ga0501046_0007227 | Ga0501046_0007227_161_715 | 184 |
| 718 | 3300049580 | Ga0501046_0041162 | Ga0501046_0041162_545_1102 | 184 |
| 719 | 3300049581 | Ga0501047_0010064 | Ga0501047_0010064_5985_6554 | 184 |
| 720 | 3300049581 | Ga0501047_0010754 | Ga0501047_0010754_3367_3921 | 184 |
| 721 | 3300049581 | Ga0501047_0132988 | Ga0501047_0132988_997_1554 | 184 |
| 722 | 3300049582 | Ga0501048_0007103 | Ga0501048_0007103_2154_2708 | 184 |
| 723 | 3300049583 | Ga0501067_0004896 | Ga0501067_0004896_2382_2936 | 184 |
| 724 | 3300049585 | Ga0501069_0010544 | Ga0501069_0010544_3911_4465 | 184 |
| 725 | 3300049586 | Ga0501070_0015773 | Ga0501070_0015773_186_740 | 184 |
| 726 | 3300049586 | Ga0501070_0074206 | Ga0501070_0074206_872_1426 | 184 |
| 727 | 3300049587 | Ga0501071_0472094 | Ga0501071_0472094_169_723 | 184 |
| 728 | 3300049589 | Ga0501073_0099611 | Ga0501073_0099611_856_1410 | 184 |
| 729 | 3300049590 | Ga0501074_0002441 | Ga0501074_0002441_1341_1895 | 184 |
| 730 | 3300049741 | Ga0501079_0005434 | Ga0501079_0005434_2507_3061 | 184 |
| 731 | 3300049741 | Ga0501079_0284506 | Ga0501079_0284506_547_1101 | 184 |
| 732 | 3300049742 | Ga0501080_0380435 | Ga0501080_0380435_377_931 | 184 |
| 733 | 3300049742 | Ga0501080_0387976 | Ga0501080_0387976_390_944 | 184 |
| 734 | 3300049744 | Ga0501083_0014640 | Ga0501083_0014640_4296_4853 | 184 |
| 735 | 3300049822 | Ga0501035_0002523 | Ga0501035_0002523_14966_15535 | 184 |
| 736 | 3300049822 | Ga0501035_0066618 | Ga0501035_0066618_2355_2909 | 184 |
| 737 | 3300049822 | Ga0501035_0145055 | Ga0501035_0145055_116_673 | 184 |
| 738 | 3300049823 | Ga0501044_0007608 | Ga0501044_0007608_847_1416 | 184 |
| 739 | 3300049823 | Ga0501044_0098234 | Ga0501044_0098234_24_578 | 184 |
| 740 | 3300049823 | Ga0501044_0152575 | Ga0501044_0152575_1148_1702 | 184 |
| 741 | 3300049823 | Ga0501044_0218307 | Ga0501044_0218307_353_907 | 184 |
| 742 | 3300049823 | Ga0501044_0455917 | Ga0501044_0455917_262_816 | 184 |
| 743 | 3300053119 | Ga0500595_000824 | Ga0500595_000824_1439_1993 | 184 |
| 744 | 3300053130 | Ga0500642_0193279 | Ga0500642_0193279_43_597 | 184 |
| 745 | 3300053136 | Ga0500559_0173869 | Ga0500559_0173869_426_980 | 184 |
| 746 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_14341_14895 | 184 |
| 747 | 3300053178 | Ga0500637_0182778 | Ga0500637_0182778_112_666 | 184 |
| 748 | 3300054114 | Ga0501084_0011180 | Ga0501084_0011180_1023_1577 | 184 |
| 749 | 3300054114 | Ga0501084_0042942 | Ga0501084_0042942_2088_2645 | 184 |
| 750 | 3300060353 | Ga0501082_0305889 | Ga0501082_0305889_638_1195 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ssp-assembly1.cif.gz_H | structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state | 0.922 | 16 | 184 |
| 7sss-assembly1.cif.gz_H | structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy | 0.9035 | 16 | 184 |
| 7ssp-assembly1.cif.gz_H | structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state | 0.8951 | 16 | 184 |
| 7sss-assembly1.cif.gz_H | structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy | 0.8782 | 16 | 184 |
| 2c41-assembly1.cif.gz_C | x-ray structure of dps from thermosynechococcus elongatus | 0.8288 | 16 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W3W4_54_201_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9521 | 19 | 165 | 1.20.1260.10 |
| af_P41735_52_233_3.15.10.10 | Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 | 0.9514 | 17 | 184 | 3.15.10.10 |
| af_Q54VB3_38_194_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9502 | 16 | 161 | 1.20.1260.10 |
| af_F1QW05_54_223_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.949 | 16 | 184 | 1.20.1260.10 |
| af_F1QW05_54_223_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9381 | 16 | 184 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840I3X4-F1-model_v4 | 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) | 0.9913 | 16 | 184 |
GO:0005886
GO:0006744 GO:0008682 GO:0046872 |
| AF-B9KI23-F1-model_v4 | Ubiquinone biosynthesis protein (Coq7) | 0.984 | 61 | 184 |
GO:0006744
GO:0008682 GO:0016020 GO:0046872 |
| AF-A0A2G2LIL8-F1-model_v4 | 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) | 0.9819 | 16 | 184 |
GO:0005886
GO:0006744 GO:0008682 GO:0046872 |
| AF-C6XLU2-F1-model_v4 | 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) | 0.9815 | 16 | 184 |
GO:0005886
GO:0006744 GO:0008682 GO:0046872 |
| AF-A0A7V8D9A1-F1-model_v4 | Ubiquinone biosynthesis monooxygenase Coq7 | 0.9809 | 82 | 184 |
GO:0006744
GO:0008682 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar