F478886

General Info

Members Datasets Scaffolds Average Seq Length
746 281 645 199

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0000175|Ga0495643_0000175_52120_52773
Length 217
Sequence VASAKPTLKITEEDESMPIQLLNETPSQTAGPYVHIGLALSAAGNPPRDQEIWNEMAKPGAPGEHILLLGNVYDGNGHLVRDSFLEFWQADHQGRYDADFNLEKPFNSFGRTATTFDAGEWTLHTIKPGVVSNAAGVPMAPHINVSLFARGINIHLHTRLYFDDEAEANKACPVLNLIEQPQRRETLVATRCEVDGKLAYRFDIRIQGEGETVFFDF

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2511231024 Pseudomonas sp. GM84 Isolate Nodule
12 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
13 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
14 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
15 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
16 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
19 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
20 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
21 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
22 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
23 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
24 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
25 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
26 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
27 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
28 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
29 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
30 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
31 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
32 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
33 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
34 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
35 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
36 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
37 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
38 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
39 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
40 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
41 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
42 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
43 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
44 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
45 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
46 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
47 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
48 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
49 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
50 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
51 2765235841 Pseudomonas putida AA7 Isolate Unclassified
52 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
53 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
54 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
55 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
56 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
57 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
58 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
59 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
60 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
61 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
62 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
63 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
64 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
65 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
66 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
67 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
68 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
69 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
70 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
71 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
72 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
73 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
74 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
75 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
76 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
77 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
78 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
79 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
80 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
81 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
82 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
83 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
84 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
85 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
86 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
87 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
88 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
89 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
90 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
91 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
92 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
93 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
95 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
162 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
266 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
267 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
268 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
269 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
270 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
271 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
272 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
273 8052494512 Pseudomonas putida LD6 Isolate Unclassified
274 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
275 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
276 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
277 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
278 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
279 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
280 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
281 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.46
Metatranscriptomes 0
Isolates 13.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 3.62
Nodule 1.61
Rhizoplane 4.96
Rhizosphere 77.48
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1414 2124908027 Bacteria 4098
2 JGI25163J39215_1000021 3300002771 Bacteria 74332
3 JGI25163J39215_1000507 3300002771 Bacteria 11511
4 JGI25164J39214_1000005 3300002772 Bacteria 343384
5 JGI25164J39214_1000121 3300002772 Bacteria 75225
6 JGI25165J46597_1000099 3300003214 Bacteria 158550
7 JGI25165J46597_1000240 3300003214 Bacteria 75225
8 Ga0055536_1000059 3300003781 Bacteria 103307
9 Ga0055536_1029510 3300003781 Bacteria 1472
10 Ga0055530_10000096 3300003791 Bacteria 73950
11 Ga0055540_1000650 3300003792 Bacteria 24393
12 Ga0065714_10002376 3300005288 Bacteria 24092
13 Ga0065714_10002743 3300005288 Bacteria 21142
14 Ga0065714_10071835 3300005288 Bacteria 3485
15 Ga0065714_10081755 3300005288 Bacteria 2344
16 Ga0065714_10128881 3300005288 Bacteria 1269
17 Ga0065714_10143315 3300005288 Bacteria 1156
18 Ga0065704_10000847 3300005289 Bacteria 16500
19 Ga0065704_10080381 3300005289 Bacteria 3945
20 Ga0065704_10084836 3300005289 Bacteria 3290
21 Ga0065704_10089809 3300005289 Bacteria 2831
22 Ga0065712_10068945 3300005290 Bacteria 8500
23 Ga0070661_100008330 3300005344 Bacteria 7161
24 Ga0070664_100011988 3300005564 Bacteria 7040
25 Ga0075432_10001850 3300006058 Bacteria 6983
26 Ga0075432_10003080 3300006058 Bacteria 5623
27 Ga0075432_10026201 3300006058 Bacteria 2002
28 Ga0075436_100422457 3300006914 Bacteria 968
29 Ga0075436_100766937 3300006914 Bacteria 717
30 Ga0099823_1000188 3300006944 Bacteria 34181
31 Ga0079104_1000068 3300006946 Bacteria 154984
32 Ga0105251_10000050 3300009011 Bacteria 108597
33 Ga0105251_10001307 3300009011 Bacteria 21525
34 Ga0105251_10001933 3300009011 Bacteria 16960
35 Ga0105251_10053384 3300009011 Bacteria 1921
36 Ga0105244_10000456 3300009036 Bacteria 37378
37 Ga0105244_10000475 3300009036 Bacteria 36441
38 Ga0105244_10001890 3300009036 Bacteria 16280
39 Ga0105244_10007113 3300009036 Bacteria 7153
40 Ga0105244_10012905 3300009036 Bacteria 4915
41 Ga0105244_10015041 3300009036 Bacteria 4450
42 Ga0105244_10016850 3300009036 Bacteria 4149
43 Ga0105244_10018747 3300009036 Bacteria 3876
44 Ga0105244_10059080 3300009036 Bacteria 1933
45 Ga0105244_10062573 3300009036 Bacteria 1870
46 Ga0105244_10142259 3300009036 Bacteria 1153
47 Ga0105250_10000130 3300009092 Bacteria 65133
48 Ga0105250_10012007 3300009092 Bacteria 3586
49 Ga0105250_10073304 3300009092 Bacteria 1384
50 Ga0105250_10212657 3300009092 Bacteria 818
51 Ga0105243_10000115 3300009148 Bacteria 92572
52 Ga0105243_10006536 3300009148 Bacteria 9003
53 Ga0105243_10029124 3300009148 Bacteria 4245
54 Ga0105242_10010100 3300009176 Bacteria 7229
55 Ga0105237_10018729 3300009545 Bacteria 7159
56 Ga0105246_10020760 3300011119 Bacteria 4217
57 Ga0105246_10326129 3300011119 Bacteria 1250
58 Ga0157373_10004432 3300013100 Bacteria 10574
59 Ga0157373_10009652 3300013100 Bacteria 7122
60 Ga0157373_10247337 3300013100 Bacteria 1261
61 Ga0157371_10000185 3300013102 Bacteria 91305
62 Ga0157371_10000282 3300013102 Bacteria 68612
63 Ga0157371_10002965 3300013102 Bacteria 15777
64 Ga0157371_10021424 3300013102 Bacteria 4746
65 Ga0157371_10503363 3300013102 Bacteria 895
66 Ga0157370_10000199 3300013104 Bacteria 75511
67 Ga0157370_10002968 3300013104 Bacteria 20177
68 Ga0157370_10044593 3300013104 Bacteria 4260
69 Ga0157370_10074041 3300013104 Bacteria 3213
70 Ga0157370_10294555 3300013104 Bacteria 1498
71 Ga0157369_10021607 3300013105 Bacteria 7197
72 Ga0157369_10037445 3300013105 Bacteria 5311
73 Ga0157369_11359780 3300013105 Bacteria 723
74 Ga0163162_10204141 3300013306 Bacteria 2105
75 Ga0157372_10409930 3300013307 Bacteria 1579
76 Ga0182008_10013933 3300014497 Bacteria 4218
77 Ga0182008_10019434 3300014497 Bacteria 3506
78 Ga0182008_10112428 3300014497 Bacteria 1350
79 Ga0182008_10473001 3300014497 Bacteria 685
80 Ga0182006_1000101 3300015261 Bacteria 95777
81 Ga0182006_1022562 3300015261 Bacteria 2615
82 Ga0182007_10000034 3300015262 Bacteria 134262
83 Ga0182005_1000226 3300015265 Bacteria 37379
84 Ga0182005_1000571 3300015265 Bacteria 18332
85 Ga0182005_1027646 3300015265 Bacteria 1546
86 Ga0163161_10002413 3300017792 Bacteria 13400
87 Ga0163161_10003669 3300017792 Bacteria 10765
88 Ga0163161_10010246 3300017792 Bacteria 6490
89 Ga0163161_10064421 3300017792 Bacteria 2674
90 Ga0209760_100007 3300025207 Bacteria 211381
91 Ga0209760_100102 3300025207 Bacteria 65474
92 Ga0207427_100018 3300025231 Bacteria 530735
93 Ga0207427_100056 3300025231 Bacteria 204343
94 Ga0209437_100031 3300025233 Bacteria 530871
95 Ga0209437_100065 3300025233 Bacteria 332417
96 Ga0209759_1002536 3300025256 Bacteria 7949
97 Ga0209233_1000012 3300025261 Bacteria 1019519
98 Ga0209233_1000085 3300025261 Bacteria 333078
99 Ga0209676_1000313 3300025292 Bacteria 94925
100 Ga0209676_1000805 3300025292 Bacteria 41142
101 Ga0209050_1000106 3300025298 Bacteria 224396
102 Ga0209051_1000139 3300025303 Bacteria 136281
103 Ga0207696_1000022 3300025711 Bacteria 427529
104 Ga0207696_1000255 3300025711 Bacteria 69740
105 Ga0207696_1002754 3300025711 Bacteria 8356
106 Ga0207696_1009579 3300025711 Bacteria 3605
107 Ga0207655_1000015 3300025728 Bacteria 600662
108 Ga0207655_1000162 3300025728 Bacteria 122768
109 Ga0207655_1000224 3300025728 Bacteria 96252
110 Ga0207655_1000269 3300025728 Bacteria 81483
111 Ga0207655_1000383 3300025728 Bacteria 61839
112 Ga0207655_1005047 3300025728 Bacteria 9123
113 Ga0207655_1006722 3300025728 Bacteria 7573
114 Ga0207655_1021713 3300025728 Bacteria 3246
115 Ga0207655_1027789 3300025728 Bacteria 2684
116 Ga0207655_1031378 3300025728 Bacteria 2449
117 Ga0207655_1031575 3300025728 Bacteria 2438
118 Ga0207713_1000049 3300025735 Bacteria 227882
119 Ga0207713_1000245 3300025735 Bacteria 69586
120 Ga0207713_1015450 3300025735 Bacteria 3918
121 Ga0207713_1049653 3300025735 Bacteria 1680
122 Ga0207713_1057871 3300025735 Bacteria 1496
123 Ga0207671_10004190 3300025914 Bacteria 13923
124 Ga0207649_10000061 3300025920 Bacteria 98067
125 Ga0207686_10008134 3300025934 Bacteria 5656
126 Ga0207709_10000127 3300025935 Bacteria 112650
127 Ga0207709_10006418 3300025935 Bacteria 6601
128 Ga0207709_10015777 3300025935 Bacteria 4193
129 Ga0207709_10028847 3300025935 Bacteria 3212
130 Ga0207709_10207330 3300025935 Bacteria 1404
131 Ga0207679_10000018 3300025945 Bacteria 238375
132 Ga0207712_10332402 3300025961 Bacteria 1257
133 Ga0207668_10927688 3300025972 Bacteria 776
134 Ga0209281_1000168 3300027111 Bacteria 155116
135 Ga0209389_1000002 3300027296 Bacteria 333932
136 Ga0209389_1107658 3300027296 Bacteria 930
137 Ga0209371_1001305 3300027312 Bacteria 17451
138 Ga0209371_1011908 3300027312 Bacteria 2552
139 Ga0209969_1003257 3300027360 Bacteria 2241
140 Ga0209996_1000824 3300027395 Bacteria 3655
141 Ga0209995_1002536 3300027471 Bacteria 2893
142 Ga0209982_1016709 3300027552 Bacteria 1116
143 Ga0209970_1043773 3300027614 Bacteria 800
144 Ga0209983_1026335 3300027665 Bacteria 1230
145 Ga0209971_1013784 3300027682 Bacteria 1915
146 Ga0209974_10009353 3300027876 Bacteria 3325
147 Ga0207428_10107110 3300027907 Bacteria 2154
148 Ga0268256_1001429 3300030500 Bacteria 14413
149 Ga0268256_1009453 3300030500 Bacteria 3234
150 Ga0265316_10117676 3300031344 Bacteria 2009
151 Ga0307408_100000013 3300031548 Bacteria 386212
152 Ga0307405_10363346 3300031731 Bacteria 1121
153 Ga0307414_10185873 3300032004 Bacteria 1676
154 Ga0439438_002103 3300041405 Bacteria 8588
155 Ga0439447_004389 3300041407 Bacteria 4863
156 Ga0439447_004532 3300041407 Bacteria 4755
157 Ga0439466_0000126 3300041411 Bacteria 30051
158 Ga0439466_0003068 3300041411 Bacteria 6497
159 Ga0439466_0003689 3300041411 Bacteria 5911
160 Ga0439466_0006460 3300041411 Bacteria 4456
161 Ga0439466_0024235 3300041411 Bacteria 2129
162 Ga0439432_025634 3300042006 Bacteria 1933
163 Ga0439456_000013 3300042013 Bacteria 72544
164 Ga0439456_079630 3300042013 Bacteria 730
165 Ga0439463_000178 3300042016 Bacteria 16747
166 Ga0450902_000185 3300042137 Bacteria 7237
167 Ga0450902_005964 3300042137 Bacteria 1858
168 Ga0450905_000015 3300042142 Bacteria 15971
169 Ga0450905_005113 3300042142 Bacteria 1757
170 Ga0439446_0000588 3300042156 Bacteria 7427
171 Ga0439446_0003519 3300042156 Bacteria 3899
172 Ga0439434_0000671 3300042435 Bacteria 9869
173 Ga0439464_0032894 3300042439 Bacteria 1458
174 Ga0439464_0101393 3300042439 Bacteria 875
175 Ga0450901_004005 3300042533 Bacteria 1526
176 Ga0439440_0000515 3300042993 Bacteria 6500
177 Ga0495617_000214 3300046452 Bacteria 35487
178 Ga0495617_002264 3300046452 Bacteria 7799
179 Ga0495617_005073 3300046452 Bacteria 4714
180 Ga0495617_009547 3300046452 Bacteria 3330
181 Ga0495617_086983 3300046452 Bacteria 1022
182 Ga0495627_000032 3300046453 Bacteria 224665
183 Ga0495627_002959 3300046453 Bacteria 7791
184 Ga0495627_113372 3300046453 Bacteria 768
185 Ga0495603_0007419 3300046455 Bacteria 6595
186 Ga0495603_0008325 3300046455 Bacteria 6268
187 Ga0495603_0334849 3300046455 Bacteria 868
188 Ga0495590_0000156 3300046457 Bacteria 41017
189 Ga0495590_0001448 3300046457 Bacteria 10246
190 Ga0495590_0004589 3300046457 Bacteria 5557
191 Ga0495590_0007297 3300046457 Bacteria 4270
192 Ga0495591_000018 3300046458 Bacteria 232216
193 Ga0495591_000074 3300046458 Bacteria 114062
194 Ga0495591_000121 3300046458 Bacteria 84919
195 Ga0495591_000419 3300046458 Bacteria 35268
196 Ga0495591_002619 3300046458 Bacteria 9870
197 Ga0495591_003794 3300046458 Bacteria 7641
198 Ga0495591_004758 3300046458 Bacteria 6501
199 Ga0495591_005101 3300046458 Bacteria 6164
200 Ga0495591_010861 3300046458 Bacteria 3490
201 Ga0495591_020770 3300046458 Bacteria 2160
202 Ga0495591_021570 3300046458 Bacteria 2098
203 Ga0495591_038730 3300046458 Bacteria 1371
204 Ga0495591_041841 3300046458 Bacteria 1298
205 Ga0495591_069207 3300046458 Bacteria 920
206 Ga0495638_0000262 3300046460 Bacteria 70901
207 Ga0495638_0002180 3300046460 Bacteria 16413
208 Ga0495638_0005270 3300046460 Bacteria 9660
209 Ga0495638_0011754 3300046460 Bacteria 6026
210 Ga0495638_0016822 3300046460 Bacteria 4890
211 Ga0495638_0019122 3300046460 Bacteria 4536
212 Ga0495638_0023282 3300046460 Bacteria 4052
213 Ga0495638_0023551 3300046460 Bacteria 4025
214 Ga0495638_0026517 3300046460 Bacteria 3755
215 Ga0495638_0028844 3300046460 Bacteria 3580
216 Ga0495638_0041239 3300046460 Bacteria 2922
217 Ga0495638_0065447 3300046460 Bacteria 2237
218 Ga0495638_0133143 3300046460 Bacteria 1458
219 Ga0495638_0219925 3300046460 Bacteria 1062
220 Ga0495638_0368599 3300046460 Bacteria 753
221 Ga0495653_0000332 3300046463 Bacteria 38593
222 Ga0495650_0001549 3300046471 Bacteria 21751
223 Ga0495650_0003386 3300046471 Bacteria 11677
224 Ga0495650_0010317 3300046471 Bacteria 5222
225 Ga0495650_0014211 3300046471 Bacteria 4158
226 Ga0495650_0014677 3300046471 Bacteria 4057
227 Ga0495650_0036585 3300046471 Bacteria 2146
228 Ga0495580_0260359 3300046472 Bacteria 1186
229 Ga0495605_0000001 3300046474 Bacteria 614538
230 Ga0495605_0000002 3300046474 Bacteria 522417
231 Ga0495605_0000091 3300046474 Bacteria 115482
232 Ga0495605_0000220 3300046474 Bacteria 70521
233 Ga0495605_0000458 3300046474 Bacteria 36672
234 Ga0495605_0000723 3300046474 Bacteria 24302
235 Ga0495605_0002830 3300046474 Bacteria 10547
236 Ga0495605_0003434 3300046474 Bacteria 9418
237 Ga0495605_0004925 3300046474 Bacteria 7808
238 Ga0495605_0099757 3300046474 Bacteria 1336
239 Ga0495605_0216435 3300046474 Bacteria 829
240 Ga0495639_0000004 3300046475 Bacteria 103675
241 Ga0495639_0061257 3300046475 Bacteria 1725
242 Ga0495584_0001983 3300046491 Bacteria 11785
243 Ga0495584_0002169 3300046491 Bacteria 11193
244 Ga0495584_0002461 3300046491 Bacteria 10496
245 Ga0495584_0005398 3300046491 Bacteria 6770
246 Ga0495584_0033246 3300046491 Bacteria 2608
247 Ga0495584_0049848 3300046491 Bacteria 2109
248 Ga0495584_0051159 3300046491 Bacteria 2080
249 Ga0495585_0000749 3300046492 Bacteria 28764
250 Ga0495585_0013787 3300046492 Bacteria 4723
251 Ga0495585_0103941 3300046492 Bacteria 1516
252 Ga0495585_0124369 3300046492 Bacteria 1362
253 Ga0495594_0000720 3300046499 Bacteria 17015
254 Ga0495594_0001144 3300046499 Bacteria 13849
255 Ga0495594_0005988 3300046499 Bacteria 6246
256 Ga0495596_0000056 3300046500 Bacteria 81755
257 Ga0495607_0000013 3300046501 Bacteria 189755
258 Ga0495607_0000032 3300046501 Bacteria 153288
259 Ga0495607_0000661 3300046501 Bacteria 33467
260 Ga0495607_0003133 3300046501 Bacteria 12840
261 Ga0495607_0004274 3300046501 Bacteria 10567
262 Ga0495607_0005095 3300046501 Bacteria 9507
263 Ga0495607_0010163 3300046501 Bacteria 6332
264 Ga0495607_0011570 3300046501 Bacteria 5866
265 Ga0495607_0016548 3300046501 Bacteria 4757
266 Ga0495607_0025581 3300046501 Bacteria 3669
267 Ga0495607_0028293 3300046501 Bacteria 3460
268 Ga0495607_0029094 3300046501 Bacteria 3403
269 Ga0495607_0037199 3300046501 Bacteria 2925
270 Ga0495607_0264325 3300046501 Bacteria 823
271 Ga0495583_0000012 3300046506 Bacteria 324839
272 Ga0495583_0000781 3300046506 Bacteria 39796
273 Ga0495583_0001519 3300046506 Bacteria 23035
274 Ga0495583_0004569 3300046506 Bacteria 9836
275 Ga0495606_0000238 3300046507 Bacteria 96877
276 Ga0495606_0000271 3300046507 Bacteria 90916
277 Ga0495606_0000287 3300046507 Bacteria 87639
278 Ga0495606_0000962 3300046507 Bacteria 42131
279 Ga0495606_0001537 3300046507 Bacteria 30458
280 Ga0495606_0004209 3300046507 Bacteria 14562
281 Ga0495606_0047914 3300046507 Bacteria 2815
282 Ga0495606_0060616 3300046507 Bacteria 2423
283 Ga0495606_0090006 3300046507 Bacteria 1889
284 Ga0495610_0007650 3300046512 Bacteria 7143
285 Ga0495610_0012510 3300046512 Bacteria 5102
286 Ga0495610_0012739 3300046512 Bacteria 5037
287 Ga0495610_0014252 3300046512 Bacteria 4680
288 Ga0495610_0030648 3300046512 Bacteria 2814
289 Ga0495610_0032875 3300046512 Bacteria 2689
290 Ga0495610_0036480 3300046512 Bacteria 2511
291 Ga0495610_0102038 3300046512 Bacteria 1283
292 Ga0495610_0108724 3300046512 Bacteria 1231
293 Ga0495610_0149602 3300046512 Bacteria 997
294 Ga0495616_0000381 3300046513 Bacteria 34674
295 Ga0495616_0007951 3300046513 Bacteria 6321
296 Ga0495616_0023576 3300046513 Bacteria 3309
297 Ga0495616_0056042 3300046513 Bacteria 1948
298 Ga0495616_0066697 3300046513 Bacteria 1750
299 Ga0495616_0080839 3300046513 Bacteria 1555
300 Ga0495616_0084033 3300046513 Bacteria 1518
301 Ga0495620_0000052 3300046515 Bacteria 103693
302 Ga0495620_0000238 3300046515 Bacteria 41133
303 Ga0495620_0001748 3300046515 Bacteria 12813
304 Ga0495620_0002249 3300046515 Bacteria 11189
305 Ga0495620_0007222 3300046515 Bacteria 6050
306 Ga0495620_0010727 3300046515 Bacteria 4821
307 Ga0495620_0036149 3300046515 Bacteria 2212
308 Ga0495620_0174262 3300046515 Bacteria 833
309 Ga0495630_0408468 3300046517 Bacteria 1040
310 Ga0495631_0000472 3300046518 Bacteria 27165
311 Ga0495631_0002296 3300046518 Bacteria 10921
312 Ga0495631_0003952 3300046518 Bacteria 8006
313 Ga0495631_0004339 3300046518 Bacteria 7563
314 Ga0495631_0039136 3300046518 Bacteria 2105
315 Ga0495631_0064593 3300046518 Bacteria 1584
316 Ga0495632_0000540 3300046519 Bacteria 35597
317 Ga0495632_0003172 3300046519 Bacteria 11852
318 Ga0495632_0008111 3300046519 Bacteria 6499
319 Ga0495632_0008838 3300046519 Bacteria 6130
320 Ga0495632_0015629 3300046519 Bacteria 4244
321 Ga0495632_0019285 3300046519 Bacteria 3720
322 Ga0495632_0023208 3300046519 Bacteria 3315
323 Ga0495632_0028386 3300046519 Bacteria 2920
324 Ga0495632_0032652 3300046519 Bacteria 2680
325 Ga0495632_0085589 3300046519 Bacteria 1500
326 Ga0495637_0000039 3300046520 Bacteria 117112
327 Ga0495637_0000210 3300046520 Bacteria 45704
328 Ga0495637_0003250 3300046520 Bacteria 8659
329 Ga0495637_0003624 3300046520 Bacteria 8181
330 Ga0495637_0005180 3300046520 Bacteria 6677
331 Ga0495637_0005780 3300046520 Bacteria 6265
332 Ga0495637_0026840 3300046520 Bacteria 2581
333 Ga0495637_0030764 3300046520 Bacteria 2378
334 Ga0495637_0030829 3300046520 Bacteria 2375
335 Ga0495637_0061650 3300046520 Bacteria 1537
336 Ga0495637_0099696 3300046520 Bacteria 1136
337 Ga0495643_0000175 3300046522 Bacteria 102200
338 Ga0495643_0001593 3300046522 Bacteria 20127
339 Ga0495643_0001686 3300046522 Bacteria 19265
340 Ga0495643_0002450 3300046522 Bacteria 14685
341 Ga0495643_0004514 3300046522 Bacteria 9703
342 Ga0495643_0006249 3300046522 Bacteria 7893
343 Ga0495643_0015796 3300046522 Bacteria 4451
344 Ga0495643_0026220 3300046522 Bacteria 3290
345 Ga0495643_0055822 3300046522 Bacteria 2110
346 Ga0495643_0083841 3300046522 Bacteria 1654
347 Ga0495644_0000017 3300046523 Bacteria 85885
348 Ga0495644_0000864 3300046523 Bacteria 12524
349 Ga0495644_0002802 3300046523 Bacteria 6908
350 Ga0495644_0036877 3300046523 Bacteria 1844
351 Ga0495644_0111792 3300046523 Bacteria 1036
352 Ga0495648_0000190 3300046524 Bacteria 70740
353 Ga0495648_0000511 3300046524 Bacteria 41770
354 Ga0495648_0000611 3300046524 Bacteria 38272
355 Ga0495648_0001710 3300046524 Bacteria 21202
356 Ga0495648_0003594 3300046524 Bacteria 13563
357 Ga0495648_0006106 3300046524 Bacteria 9876
358 Ga0495648_0010288 3300046524 Bacteria 7138
359 Ga0495648_0029696 3300046524 Bacteria 3624
360 Ga0495648_0103713 3300046524 Bacteria 1563
361 Ga0495648_0141304 3300046524 Bacteria 1266
362 Ga0495648_0177156 3300046524 Bacteria 1087
363 Ga0495666_0000088 3300046526 Bacteria 37174
364 Ga0495666_0009312 3300046526 Bacteria 4912
365 Ga0495666_0152940 3300046526 Bacteria 1072
366 Ga0495642_0000037 3300046528 Bacteria 79709
367 Ga0495652_0129095 3300046529 Bacteria 2004
368 Ga0495654_0000385 3300046530 Bacteria 38131
369 Ga0495654_0001231 3300046530 Bacteria 18082
370 Ga0495654_0001379 3300046530 Bacteria 16832
371 Ga0495654_0001815 3300046530 Bacteria 14213
372 Ga0495654_0001971 3300046530 Bacteria 13529
373 Ga0495654_0006940 3300046530 Bacteria 6382
374 Ga0495654_0008362 3300046530 Bacteria 5721
375 Ga0495654_0009828 3300046530 Bacteria 5227
376 Ga0495654_0009839 3300046530 Bacteria 5225
377 Ga0495654_0009972 3300046530 Bacteria 5188
378 Ga0495654_0024823 3300046530 Bacteria 3093
379 Ga0495654_0036289 3300046530 Bacteria 2477
380 Ga0495654_0037620 3300046530 Bacteria 2424
381 Ga0495654_0081886 3300046530 Bacteria 1512
382 Ga0495654_0169290 3300046530 Bacteria 953
383 Ga0495587_0204908 3300046536 Bacteria 1115
384 Ga0495609_0000008 3300046538 Bacteria 383025
385 Ga0495609_0000836 3300046538 Bacteria 22821
386 Ga0495609_0004332 3300046538 Bacteria 7798
387 Ga0495597_0000013 3300046542 Bacteria 203829
388 Ga0495597_0001812 3300046542 Bacteria 14632
389 Ga0495597_0007863 3300046542 Bacteria 5381
390 Ga0495597_0008022 3300046542 Bacteria 5313
391 Ga0495597_0010073 3300046542 Bacteria 4637
392 Ga0495597_0014959 3300046542 Bacteria 3683
393 Ga0495597_0033642 3300046542 Bacteria 2319
394 Ga0495597_0034786 3300046542 Bacteria 2276
395 Ga0495597_0052709 3300046542 Bacteria 1790
396 Ga0495645_0074511 3300046543 Bacteria 2444
397 Ga0495622_0000777 3300046557 Bacteria 17798
398 Ga0495622_0013322 3300046557 Bacteria 3815
399 Ga0495622_0018093 3300046557 Bacteria 3282
400 Ga0495633_0000009 3300046558 Bacteria 293183
401 Ga0495633_0032661 3300046558 Bacteria 2513
402 Ga0495633_0053522 3300046558 Bacteria 1900
403 Ga0495633_0112486 3300046558 Bacteria 1262
404 Ga0495656_0017887 3300046615 Bacteria 2712
405 Ga0495656_0229280 3300046615 Bacteria 931
406 Ga0495668_0000176 3300046616 Bacteria 95098
407 Ga0495668_0002276 3300046616 Bacteria 16139
408 Ga0495668_0021455 3300046616 Bacteria 3703
409 Ga0495668_0123989 3300046616 Bacteria 1413
410 Ga0495668_0153617 3300046616 Bacteria 1260
411 Ga0495611_0000555 3300046648 Bacteria 21770
412 Ga0495611_0001016 3300046648 Bacteria 14886
413 Ga0495611_0011750 3300046648 Bacteria 3715
414 Ga0495611_0011931 3300046648 Bacteria 3690
415 Ga0495625_0001957 3300046660 Bacteria 23271
416 Ga0495625_0002335 3300046660 Bacteria 20734
417 Ga0495625_0002515 3300046660 Bacteria 19738
418 Ga0495625_0063206 3300046660 Bacteria 2614
419 Ga0495625_0124115 3300046660 Bacteria 1754
420 Ga0495659_0000013 3300046664 Bacteria 79904
421 Ga0495661_0000029 3300046665 Bacteria 173899
422 Ga0495661_0000075 3300046665 Bacteria 119777
423 Ga0495661_0002924 3300046665 Bacteria 12922
424 Ga0495661_0004839 3300046665 Bacteria 9647
425 Ga0495661_0021017 3300046665 Bacteria 4258
426 Ga0495661_0035593 3300046665 Bacteria 3122
427 Ga0495661_0053255 3300046665 Bacteria 2434
428 Ga0495661_0094553 3300046665 Bacteria 1694
429 Ga0495661_0222707 3300046665 Bacteria 976
430 Ga0495657_0009168 3300046675 Bacteria 7517
431 Ga0495623_0002717 3300046679 Bacteria 11694
432 Ga0495669_0003966 3300046684 Bacteria 6091
433 Ga0495670_0000215 3300046691 Bacteria 26202
434 Ga0495670_0002071 3300046691 Bacteria 9888
435 Ga0495670_0006967 3300046691 Bacteria 5568
436 Ga0495670_0019923 3300046691 Bacteria 3305
437 Ga0495670_0024471 3300046691 Bacteria 2984
438 Ga0495670_0075070 3300046691 Bacteria 1716
439 Ga0495670_0129157 3300046691 Bacteria 1316
440 Ga0495670_0149039 3300046691 Bacteria 1226
441 Ga0495671_0000692 3300046692 Bacteria 24406
442 Ga0495671_0003368 3300046692 Bacteria 9844
443 Ga0495671_0004287 3300046692 Bacteria 8572
444 Ga0495671_0004293 3300046692 Bacteria 8563
445 Ga0495671_0013118 3300046692 Bacteria 4502
446 Ga0495671_0017103 3300046692 Bacteria 3859
447 Ga0495671_0019889 3300046692 Bacteria 3543
448 Ga0495671_0044562 3300046692 Bacteria 2223
449 Ga0495671_0050895 3300046692 Bacteria 2061
450 Ga0495671_0062282 3300046692 Bacteria 1838
451 Ga0495671_0076384 3300046692 Bacteria 1642
452 Ga0495671_0089400 3300046692 Bacteria 1508
453 Ga0495649_0000113 3300046694 Bacteria 71567
454 Ga0495649_0000186 3300046694 Bacteria 54356
455 Ga0495649_0001536 3300046694 Bacteria 17338
456 Ga0495649_0001772 3300046694 Bacteria 15917
457 Ga0495649_0004415 3300046694 Bacteria 9193
458 Ga0495649_0007731 3300046694 Bacteria 6527
459 Ga0495649_0014128 3300046694 Bacteria 4584
460 Ga0495649_0014181 3300046694 Bacteria 4576
461 Ga0495649_0036903 3300046694 Bacteria 2684
462 Ga0495589_0000562 3300046794 Bacteria 25678
463 Ga0495589_0000814 3300046794 Bacteria 19733
464 Ga0495589_0001465 3300046794 Bacteria 13579
465 Ga0495589_0003431 3300046794 Bacteria 8576
466 Ga0495589_0007437 3300046794 Bacteria 5737
467 Ga0495600_0506368 3300046809 Bacteria 741
468 Ga0495660_0000535 3300046810 Bacteria 31085
469 Ga0495660_0000611 3300046810 Bacteria 28147
470 Ga0495660_0002227 3300046810 Bacteria 12473
471 Ga0495660_0002662 3300046810 Bacteria 11311
472 Ga0495660_0003620 3300046810 Bacteria 9520
473 Ga0495660_0007163 3300046810 Bacteria 6568
474 Ga0495660_0014962 3300046810 Bacteria 4486
475 Ga0495660_0023871 3300046810 Bacteria 3486
476 Ga0495660_0024026 3300046810 Bacteria 3473
477 Ga0495660_0026629 3300046810 Bacteria 3276
478 Ga0495660_0040175 3300046810 Bacteria 2594
479 Ga0495660_0187726 3300046810 Bacteria 995
480 Ga0495660_0229618 3300046810 Bacteria 870
481 Ga0495660_0239615 3300046810 Bacteria 846
482 Ga0495581_0000210 3300047315 Bacteria 27458
483 Ga0495604_0004795 3300047317 Bacteria 10719
484 Ga0495672_0000360 3300047320 Bacteria 58168
485 Ga0495672_0000550 3300047320 Bacteria 42605
486 Ga0495672_0001014 3300047320 Bacteria 28957
487 Ga0495672_0001418 3300047320 Bacteria 23551
488 Ga0495672_0004334 3300047320 Bacteria 11682
489 Ga0495672_0006963 3300047320 Bacteria 8599
490 Ga0495672_0008403 3300047320 Bacteria 7626
491 Ga0495672_0019944 3300047320 Bacteria 4407
492 Ga0495672_0023216 3300047320 Bacteria 4019
493 Ga0495672_0047679 3300047320 Bacteria 2546
494 Ga0495672_0068858 3300047320 Bacteria 2010
495 Ga0495672_0079434 3300047320 Bacteria 1832
496 Ga0495672_0088140 3300047320 Bacteria 1711
497 Ga0495672_0247097 3300047320 Bacteria 868
498 Ga0495676_0000039 3300047321 Bacteria 111011
499 Ga0495676_0002451 3300047321 Bacteria 16487
500 Ga0495680_0011661 3300047322 Bacteria 7763
501 Ga0495680_0034506 3300047322 Bacteria 4083
502 Ga0495680_0073114 3300047322 Bacteria 2606
503 Ga0495683_0000039 3300047323 Bacteria 137702
504 Ga0495683_0000043 3300047323 Bacteria 136876
505 Ga0495683_0000135 3300047323 Bacteria 72196
506 Ga0495683_0000503 3300047323 Bacteria 30180
507 Ga0495683_0024244 3300047323 Bacteria 3114
508 Ga0495683_0051125 3300047323 Bacteria 2067
509 Ga0495683_0171163 3300047323 Bacteria 998
510 Ga0495687_000948 3300047443 Bacteria 29881
511 Ga0495675_0057013 3300047444 Bacteria 2476
512 Ga0495679_000086 3300047446 Bacteria 85895
513 Ga0495679_000160 3300047446 Bacteria 61002
514 Ga0495679_000284 3300047446 Bacteria 41806
515 Ga0495679_020527 3300047446 Bacteria 2299
516 Ga0495673_0000261 3300047469 Bacteria 73160
517 Ga0495673_0000429 3300047469 Bacteria 47646
518 Ga0495673_0000619 3300047469 Bacteria 35084
519 Ga0495673_0001441 3300047469 Bacteria 18966
520 Ga0495673_0001957 3300047469 Bacteria 15285
521 Ga0495673_0002274 3300047469 Bacteria 13772
522 Ga0495673_0006333 3300047469 Bacteria 6971
523 Ga0495673_0008814 3300047469 Bacteria 5632
524 Ga0495673_0012220 3300047469 Bacteria 4567
525 Ga0495673_0015133 3300047469 Bacteria 3985
526 Ga0495673_0019949 3300047469 Bacteria 3348
527 Ga0495673_0024299 3300047469 Bacteria 2931
528 Ga0495673_0036420 3300047469 Bacteria 2257
529 Ga0495681_0000235 3300047470 Bacteria 45882
530 Ga0495681_0000501 3300047470 Bacteria 30014
531 Ga0495681_0000652 3300047470 Bacteria 26406
532 Ga0495681_0001649 3300047470 Bacteria 16557
533 Ga0495681_0004113 3300047470 Bacteria 10002
534 Ga0495681_0005085 3300047470 Bacteria 8866
535 Ga0495681_0007776 3300047470 Bacteria 6794
536 Ga0495681_0008204 3300047470 Bacteria 6567
537 Ga0495681_0026829 3300047470 Bacteria 2989
538 Ga0495681_0035376 3300047470 Bacteria 2480
539 Ga0495681_0047969 3300047470 Bacteria 2028
540 Ga0495681_0088234 3300047470 Bacteria 1373
541 Ga0495684_0108806 3300047471 Bacteria 2093
542 Ga0495686_0013427 3300047472 Bacteria 5680
543 Ga0495686_0021108 3300047472 Bacteria 4331
544 Ga0495686_0088478 3300047472 Bacteria 1882
545 Ga0495686_0098338 3300047472 Bacteria 1768
546 Ga0495686_0101224 3300047472 Bacteria 1737
547 Ga0495686_0102142 3300047472 Bacteria 1728
548 Ga0495686_0208386 3300047472 Bacteria 1118
549 Ga0495593_0000018 3300047673 Bacteria 74926
550 Ga0495593_0034609 3300047673 Bacteria 2746
551 Ga0495593_0326373 3300047673 Bacteria 767
552 Ga0495626_0000086 3300048091 Bacteria 123059
553 Ga0495626_0000112 3300048091 Bacteria 105221
554 Ga0495626_0000143 3300048091 Bacteria 90432
555 Ga0495626_0000235 3300048091 Bacteria 64391
556 Ga0496102_0056252 3300048905 Bacteria 3588
557 Ga0496105_0239666 3300048908 Bacteria 1472
558 Ga0496106_0015149 3300048909 Bacteria 5706
559 Ga0496107_0168849 3300048910 Bacteria 1623
560 Ga0496110_0041968 3300048913 Bacteria 3993
561 Ga0496110_0099490 3300048913 Bacteria 2607
562 Ga0496110_0153570 3300048913 Bacteria 2085
563 Ga0496111_0306866 3300048914 Bacteria 1176
564 Ga0496112_0068965 3300048915 Bacteria 3493
565 Ga0496112_0303748 3300048915 Bacteria 1541
566 Ga0496114_0001680 3300048917 Bacteria 16792
567 Ga0496114_0003874 3300048917 Bacteria 11531
568 Ga0496116_0000258 3300048919 Bacteria 93019
569 Ga0496116_0000267 3300048919 Bacteria 91320
570 Ga0496116_0003215 3300048919 Bacteria 16308
571 Ga0496117_0000345 3300048920 Bacteria 82051
572 Ga0496117_0003106 3300048920 Bacteria 19860
573 Ga0496117_0012755 3300048920 Bacteria 7373
574 Ga0496117_0202354 3300048920 Bacteria 1121
575 Ga0496118_0002944 3300048921 Bacteria 22125
576 Ga0496118_0003187 3300048921 Bacteria 20960
577 Ga0496118_0031378 3300048921 Bacteria 4406
578 Ga0496118_0085981 3300048921 Bacteria 2187
579 Ga0496118_0181289 3300048921 Bacteria 1272
580 Ga0496119_0000011 3300048922 Bacteria 438315
581 Ga0496120_0000306 3300048923 Bacteria 81699
582 Ga0496121_0000316 3300048924 Bacteria 100872
583 Ga0496121_0000366 3300048924 Bacteria 92773
584 Ga0496121_0000487 3300048924 Bacteria 76772
585 Ga0496121_0001079 3300048924 Bacteria 48170
586 Ga0496121_0002636 3300048924 Bacteria 27038
587 Ga0496121_0063699 3300048924 Bacteria 3010
588 Ga0496121_0140295 3300048924 Bacteria 1794
589 Ga0496121_0457936 3300048924 Bacteria 820
590 Ga0496122_0000292 3300048925 Bacteria 110793
591 Ga0496122_0001617 3300048925 Bacteria 35202
592 Ga0496122_0001775 3300048925 Bacteria 33047
593 Ga0496122_0004613 3300048925 Bacteria 16959
594 Ga0496122_0009795 3300048925 Bacteria 10008
595 Ga0496122_0062617 3300048925 Bacteria 2722
596 Ga0496122_0073545 3300048925 Bacteria 2422
597 Ga0496123_0000037 3300048926 Bacteria 262238
598 Ga0496123_0002675 3300048926 Bacteria 21457
599 Ga0496123_0006000 3300048926 Bacteria 11946
600 Ga0496123_0017382 3300048926 Bacteria 5789
601 Ga0496123_0039288 3300048926 Bacteria 3312
602 Ga0496123_0233852 3300048926 Bacteria 917
603 Ga0496124_0000580 3300048927 Bacteria 61729
604 Ga0496124_0000838 3300048927 Bacteria 50136
605 Ga0496124_0001078 3300048927 Bacteria 43125
606 Ga0496124_0003076 3300048927 Bacteria 20781
607 Ga0496124_0013052 3300048927 Bacteria 8138
608 Ga0496124_0020419 3300048927 Bacteria 6120
609 Ga0496124_0023557 3300048927 Bacteria 5619
610 Ga0496124_0104548 3300048927 Bacteria 2289
611 Ga0496124_0208207 3300048927 Bacteria 1482
612 Ga0496124_0447786 3300048927 Bacteria 881
613 Ga0496125_0000240 3300048928 Bacteria 112092
614 Ga0496125_0004331 3300048928 Bacteria 16465
615 Ga0496125_0037486 3300048928 Bacteria 4214
616 Ga0496125_0052533 3300048928 Bacteria 3351
617 Ga0496125_0132322 3300048928 Bacteria 1753
618 Ga0496126_0004195 3300048929 Bacteria 17367
619 Ga0496126_0027264 3300048929 Bacteria 5459
620 Ga0496126_0036947 3300048929 Bacteria 4563
621 Ga0496126_0674613 3300048929 Bacteria 806
622 Ga0495678_000011 3300049459 Bacteria 335512
623 Ga0495678_000083 3300049459 Bacteria 117558
624 Ga0495678_001806 3300049459 Bacteria 15762
625 Ga0495678_004167 3300049459 Bacteria 8530
626 Ga0495678_006617 3300049459 Bacteria 6142
627 Ga0495678_018635 3300049459 Bacteria 3116
628 Ga0495678_035245 3300049459 Bacteria 2053
629 Ga0495678_047771 3300049459 Bacteria 1673
630 Ga0495682_0000118 3300049460 Bacteria 69167
631 Ga0495682_0000457 3300049460 Bacteria 28139
632 Ga0495682_0001442 3300049460 Bacteria 12847
633 Ga0495682_0035237 3300049460 Bacteria 1844
634 Ga0495682_0059766 3300049460 Bacteria 1377
635 Ga0495682_0098421 3300049460 Bacteria 1049
636 Ga0501031_0125480 3300049568 Bacteria 1677
637 Ga0501034_0000330 3300049571 Bacteria 82994
638 Ga0501037_0054561 3300049573 Bacteria 2923
639 Ga0501038_0060240 3300049574 Bacteria 3249
640 nmdc:mga08x19_88927_c1 3300050514 Bacteria 2036
641 Ga0500618_004037 3300053125 Bacteria 4827
642 Ga0500659_0001851 3300053135 Bacteria 13161
643 Ga0500573_0002921 3300053140 Bacteria 8712
644 Ga0500586_136223 3300053145 Bacteria 847
645 Ga0500586_139802 3300053145 Bacteria 833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046523 Ga0495644_0111792 Ga0495644_0111792_23_508 161
2 3300046524 Ga0495648_0177156 Ga0495648_0177156_10_495 161
3 3300047673 Ga0495593_0326373 Ga0495593_0326373_261_746 161
4 3300011119 Ga0105246_10326129 Ga0105246_103261291 175
5 iso_pu_bacteria 8016728285 8016732048 180
6 3300046810 Ga0495660_0026629 Ga0495660_0026629_27_578 183
7 3300047320 Ga0495672_0088140 Ga0495672_0088140_1123_1674 183
8 3300049460 Ga0495682_0035237 Ga0495682_0035237_17_568 183
9 3300053145 Ga0500586_136223 Ga0500586_136223_15_566 183
10 3300042006 Ga0439432_025634 Ga0439432_025634_1354_1908 184
11 3300042013 Ga0439456_079630 Ga0439456_079630_160_714 184
12 3300046530 Ga0495654_0036289 Ga0495654_0036289_14_568 184
13 3300046458 Ga0495591_005101 Ga0495591_005101_4357_4926 189
14 3300046471 Ga0495650_0014677 Ga0495650_0014677_3378_3947 189
15 3300046499 Ga0495594_0001144 Ga0495594_0001144_9492_10061 189
16 3300046501 Ga0495607_0264325 Ga0495607_0264325_97_666 189
17 3300046506 Ga0495583_0000012 Ga0495583_0000012_140408_140977 189
18 3300046512 Ga0495610_0014252 Ga0495610_0014252_2089_2658 189
19 3300046518 Ga0495631_0004339 Ga0495631_0004339_2984_3553 189
20 3300046538 Ga0495609_0000008 Ga0495609_0000008_241980_242549 189
21 3300046542 Ga0495597_0001812 Ga0495597_0001812_13974_14543 189
22 3300046558 Ga0495633_0000009 Ga0495633_0000009_263356_263925 189
23 3300046648 Ga0495611_0000555 Ga0495611_0000555_17792_18361 189
24 3300046691 Ga0495670_0006967 Ga0495670_0006967_1465_2034 189
25 3300046692 Ga0495671_0004293 Ga0495671_0004293_6657_7226 189
26 3300046810 Ga0495660_0002662 Ga0495660_0002662_5728_6297 189
27 3300047446 Ga0495679_000160 Ga0495679_000160_5779_6348 189
28 3300047469 Ga0495673_0002274 Ga0495673_0002274_2717_3286 189
29 3300047470 Ga0495681_0007776 Ga0495681_0007776_5717_6286 189
30 3300048925 Ga0496122_0073545 Ga0496122_0073545_1197_1766 189
31 3300049459 Ga0495678_000011 Ga0495678_000011_255861_256430 189
32 3300046471 Ga0495650_0001549 Ga0495650_0001549_6157_6744 195
33 3300046474 Ga0495605_0000002 Ga0495605_0000002_281142_281729 195
34 3300046515 Ga0495620_0000238 Ga0495620_0000238_22550_23137 195
35 3300046520 Ga0495637_0061650 Ga0495637_0061650_373_960 195
36 3300046524 Ga0495648_0010288 Ga0495648_0010288_2000_2587 195
37 3300046530 Ga0495654_0001971 Ga0495654_0001971_8721_9308 195
38 3300046665 Ga0495661_0000029 Ga0495661_0000029_17691_18278 195
39 3300046794 Ga0495589_0000562 Ga0495589_0000562_4198_4785 195
40 3300047323 Ga0495683_0000039 Ga0495683_0000039_77215_77802 195
41 iso_pu_bacteria 2511231008 2511277962 196
42 iso_pu_bacteria 2511231017 2511331203 196
43 iso_pu_bacteria 2511231021 2511359623 196
44 iso_pu_bacteria 2511231156 2511827374 196
45 iso_pu_bacteria 2599185155 2599326768 196
46 iso_pu_bacteria 2600255283 2601624231 196
47 iso_pu_bacteria 2619619299 2621300764 196
48 iso_pu_bacteria 2643221650 2644283415 196
49 iso_pu_bacteria 2738541265 2738670618 196
50 iso_pu_bacteria 2738541282 2738749011 196
51 iso_pu_bacteria 2738541303 2738858053 196
52 iso_pu_bacteria 2816332298 2817489946 196
53 iso_pu_bacteria 2825651385 2825655363 196
54 iso_pu_bacteria 2826581358 2826583908 196
55 iso_pu_bacteria 2842815866 2842820232 196
56 iso_pu_bacteria 2842849001 2842850825 196
57 iso_pu_bacteria 2913036834 2913042296 196
58 iso_pu_bacteria 8056177738 8056182522 196
59 iso_pu_bacteria 2511231006 2511267147 197
60 iso_pu_bacteria 2511231007 2511273321 197
61 iso_pu_bacteria 2511231022 2511364473 197
62 iso_pu_bacteria 2511231024 2511375161 197
63 iso_pu_bacteria 2512047018 2512324709 197
64 iso_pu_bacteria 2554235132 2554812508 197
65 iso_pu_bacteria 2554235231 2555245647 197
66 iso_pu_bacteria 2554235341 2555672311 197
67 iso_pu_bacteria 2582580891 2583794732 197
68 iso_pu_bacteria 2597489887 2597860380 197
69 iso_pu_bacteria 2599185160 2599358248 197
70 iso_pu_bacteria 2599185161 2599364603 197
71 iso_pu_bacteria 2599185162 2599370861 197
72 iso_pu_bacteria 2599185163 2599376883 197
73 iso_pu_bacteria 2599185164 2599383413 197
74 iso_pu_bacteria 2599185165 2599389860 197
75 iso_pu_bacteria 2599185166 2599396149 197
76 iso_pu_bacteria 2599185168 2599407989 197
77 iso_pu_bacteria 2599185181 2599465063 197
78 iso_pu_bacteria 2599185182 2599471380 197
79 iso_pu_bacteria 2599185185 2599486778 197
80 iso_pu_bacteria 2599185186 2599494022 197
81 iso_pu_bacteria 2599185257 2599807098 197
82 iso_pu_bacteria 2599185356 2600217796 197
83 iso_pu_bacteria 2600254931 2600367106 197
84 iso_pu_bacteria 2600254954 2600445277 197
85 iso_pu_bacteria 2600255313 2601777963 197
86 iso_pu_bacteria 2600255389 2602007826 197
87 iso_pu_bacteria 2606217733 2608384818 197
88 iso_pu_bacteria 2623620446 2624491917 197
89 iso_pu_bacteria 2667528171 2671100777 197
90 iso_pu_bacteria 2671180172 2671773344 197
91 iso_pu_bacteria 2738543020 2739287025 197
92 iso_pu_bacteria 2738543021 2739292338 197
93 iso_pu_bacteria 2740892503 2743739929 197
94 iso_pu_bacteria 2765235841 2765585986 197
95 iso_pu_bacteria 2806310737 2807410300 197
96 iso_pu_bacteria 2806310745 2807458648 197
97 iso_pu_bacteria 2811994881 2812366406 197
98 iso_pu_bacteria 2818991464 2819706445 197
99 iso_pu_bacteria 2823421272 2823422087 197
100 iso_pu_bacteria 2842805378 2842808362 197
101 iso_pu_bacteria 2844665904 2844666477 197
102 iso_pu_bacteria 2912963787 2912964454 197
103 iso_pu_bacteria 2917070673 2917076191 197
104 iso_pu_bacteria 2919155634 2919157030 197
105 iso_pu_bacteria 2919501602 2919506341 197
106 iso_pu_bacteria 2919697872 2919698083 197
107 iso_pu_bacteria 2923153595 2923159020 197
108 iso_pu_bacteria 2923519811 2923520430 197
109 iso_pu_bacteria 2926063275 2926067411 197
110 iso_pu_bacteria 2935353572 2935359615 197
111 iso_pu_bacteria 2939651529 2939651962 197
112 iso_pu_bacteria 2984286254 2984287150 197
113 iso_pu_bacteria 3007315729 3007317985 197
114 iso_pu_bacteria 3007395558 3007398640 197
115 iso_pu_bacteria 3007419365 3007420362 197
116 iso_pu_bacteria 3007803356 3007803547 197
117 iso_pu_bacteria 3007872151 3007875246 197
118 iso_pu_bacteria 637000220 637322730 197
119 iso_pu_bacteria 8011350971 8011352346 197
120 iso_pu_bacteria 8015687852 8015693096 197
121 iso_pu_bacteria 8019769354 8019771378 197
122 iso_pu_bacteria 8019775933 8019778757 197
123 iso_pu_bacteria 8034962539 8034966902 197
124 iso_pu_bacteria 8052494512 8052495444 197
125 iso_pu_bacteria 8054929484 8054932801 197
126 iso_pu_bacteria 8055770955 8055776345 197
127 iso_pu_bacteria 8055878733 8055882028 197
128 iso_pu_bacteria 8056115690 8056116991 197
129 iso_pu_bacteria 8056120720 8056121463 197
130 iso_pu_bacteria 8056137416 8056142293 197
131 iso_pu_bacteria 8057798959 8057805185 197
132 iso_pu_bacteria 2510065053 2510285443 199
133 iso_pu_bacteria 2510065055 2510295914 199
134 iso_pu_bacteria 2510065058 2510313543 199
135 iso_pu_bacteria 2773857672 2774132459 199
136 iso_pu_bacteria 2917832318 2917833938 199
137 iso_pu_bacteria 2919125081 2919129953 199
138 iso_pu_bacteria 2974298342 2974302874 199
139 iso_pu_bacteria 2984499530 2984499542 199
140 iso_pu_bacteria 2984504281 2984505986 199
141 3300005288 Ga0065714_10002376 Ga0065714_100023767 200
142 3300005288 Ga0065714_10002743 Ga0065714_1000274312 200
143 3300005288 Ga0065714_10071835 Ga0065714_100718354 200
144 3300005288 Ga0065714_10081755 Ga0065714_100817553 200
145 3300005288 Ga0065714_10128881 Ga0065714_101288811 200
146 3300005288 Ga0065714_10143315 Ga0065714_101433151 200
147 3300005289 Ga0065704_10000847 Ga0065704_100008477 200
148 3300005290 Ga0065712_10068945 Ga0065712_1006894510 200
149 3300005344 Ga0070661_100008330 Ga0070661_1000083305 200
150 3300005564 Ga0070664_100011988 Ga0070664_1000119884 200
151 3300006058 Ga0075432_10001850 Ga0075432_100018504 200
152 3300006058 Ga0075432_10003080 Ga0075432_100030802 200
153 3300006914 Ga0075436_100766937 Ga0075436_1007669371 200
154 3300006946 Ga0079104_1000068 Ga0079104_100006812 200
155 3300009011 Ga0105251_10000050 Ga0105251_1000005060 200
156 3300009011 Ga0105251_10001307 Ga0105251_1000130713 200
157 3300009036 Ga0105244_10000475 Ga0105244_100004758 200
158 3300009036 Ga0105244_10001890 Ga0105244_100018908 200
159 3300009036 Ga0105244_10007113 Ga0105244_100071135 200
160 3300009036 Ga0105244_10016850 Ga0105244_100168504 200
161 3300009036 Ga0105244_10059080 Ga0105244_100590802 200
162 3300009036 Ga0105244_10142259 Ga0105244_101422591 200
163 3300009092 Ga0105250_10212657 Ga0105250_102126571 200
164 3300009148 Ga0105243_10029124 Ga0105243_100291242 200
165 3300009176 Ga0105242_10010100 Ga0105242_100101005 200
166 3300009545 Ga0105237_10018729 Ga0105237_100187294 200
167 3300011119 Ga0105246_10020760 Ga0105246_100207602 200
168 3300013100 Ga0157373_10004432 Ga0157373_100044326 200
169 3300013100 Ga0157373_10009652 Ga0157373_100096525 200
170 3300013102 Ga0157371_10002965 Ga0157371_100029653 200
171 3300013102 Ga0157371_10503363 Ga0157371_105033632 200
172 3300013104 Ga0157370_10002968 Ga0157370_1000296817 200
173 3300013104 Ga0157370_10044593 Ga0157370_100445932 200
174 3300013104 Ga0157370_10294555 Ga0157370_102945552 200
175 3300013105 Ga0157369_10021607 Ga0157369_100216076 200
176 3300013105 Ga0157369_10037445 Ga0157369_100374457 200
177 3300013306 Ga0163162_10204141 Ga0163162_102041413 200
178 3300013307 Ga0157372_10409930 Ga0157372_104099302 200
179 3300014497 Ga0182008_10019434 Ga0182008_100194343 200
180 3300014497 Ga0182008_10473001 Ga0182008_104730011 200
181 3300015265 Ga0182005_1000571 Ga0182005_100057116 200
182 3300015265 Ga0182005_1027646 Ga0182005_10276462 200
183 3300017792 Ga0163161_10003669 Ga0163161_100036697 200
184 3300017792 Ga0163161_10010246 Ga0163161_100102464 200
185 3300017792 Ga0163161_10064421 Ga0163161_100644212 200
186 3300025256 Ga0209759_1002536 Ga0209759_10025367 200
187 3300025728 Ga0207655_1000269 Ga0207655_100026952 200
188 3300025728 Ga0207655_1005047 Ga0207655_10050476 200
189 3300025728 Ga0207655_1006722 Ga0207655_10067225 200
190 3300025728 Ga0207655_1031378 Ga0207655_10313782 200
191 3300025735 Ga0207713_1000245 Ga0207713_100024522 200
192 3300025914 Ga0207671_10004190 Ga0207671_100041904 200
193 3300025920 Ga0207649_10000061 Ga0207649_1000006162 200
194 3300025934 Ga0207686_10008134 Ga0207686_100081345 200
195 3300025935 Ga0207709_10207330 Ga0207709_102073302 200
196 3300025945 Ga0207679_10000018 Ga0207679_10000018187 200
197 3300027111 Ga0209281_1000168 Ga0209281_1000168141 200
198 3300027907 Ga0207428_10107110 Ga0207428_101071103 200
199 3300031344 Ga0265316_10117676 Ga0265316_101176763 200
200 3300041407 Ga0439447_004389 Ga0439447_004389_128_730 200
201 3300041411 Ga0439466_0003068 Ga0439466_0003068_4226_4828 200
202 3300041411 Ga0439466_0003689 Ga0439466_0003689_2977_3579 200
203 3300042137 Ga0450902_005964 Ga0450902_005964_1199_1801 200
204 3300046452 Ga0495617_000214 Ga0495617_000214_13662_14264 200
205 3300046452 Ga0495617_002264 Ga0495617_002264_1889_2491 200
206 3300046452 Ga0495617_005073 Ga0495617_005073_583_1185 200
207 3300046452 Ga0495617_009547 Ga0495617_009547_2548_3150 200
208 3300046452 Ga0495617_086983 Ga0495617_086983_89_691 200
209 3300046453 Ga0495627_000032 Ga0495627_000032_100921_101529 200
210 3300046453 Ga0495627_002959 Ga0495627_002959_5210_5812 200
211 3300046453 Ga0495627_113372 Ga0495627_113372_102_704 200
212 3300046455 Ga0495603_0008325 Ga0495603_0008325_4624_5226 200
213 3300046455 Ga0495603_0334849 Ga0495603_0334849_219_821 200
214 3300046457 Ga0495590_0001448 Ga0495590_0001448_7323_7925 200
215 3300046457 Ga0495590_0004589 Ga0495590_0004589_712_1314 200
216 3300046457 Ga0495590_0007297 Ga0495590_0007297_255_857 200
217 3300046458 Ga0495591_000018 Ga0495591_000018_153053_153655 200
218 3300046458 Ga0495591_000074 Ga0495591_000074_69838_70440 200
219 3300046458 Ga0495591_000121 Ga0495591_000121_69354_69956 200
220 3300046458 Ga0495591_000419 Ga0495591_000419_16478_17080 200
221 3300046458 Ga0495591_002619 Ga0495591_002619_8641_9243 200
222 3300046458 Ga0495591_003794 Ga0495591_003794_5483_6085 200
223 3300046458 Ga0495591_004758 Ga0495591_004758_1158_1760 200
224 3300046458 Ga0495591_010861 Ga0495591_010861_93_695 200
225 3300046458 Ga0495591_021570 Ga0495591_021570_743_1345 200
226 3300046458 Ga0495591_038730 Ga0495591_038730_649_1251 200
227 3300046458 Ga0495591_041841 Ga0495591_041841_236_838 200
228 3300046458 Ga0495591_069207 Ga0495591_069207_178_780 200
229 3300046460 Ga0495638_0000262 Ga0495638_0000262_274_876 200
230 3300046460 Ga0495638_0002180 Ga0495638_0002180_8342_8944 200
231 3300046460 Ga0495638_0005270 Ga0495638_0005270_5748_6350 200
232 3300046460 Ga0495638_0011754 Ga0495638_0011754_2595_3197 200
233 3300046460 Ga0495638_0016822 Ga0495638_0016822_2508_3110 200
234 3300046460 Ga0495638_0019122 Ga0495638_0019122_3827_4429 200
235 3300046460 Ga0495638_0023282 Ga0495638_0023282_2709_3311 200
236 3300046460 Ga0495638_0023551 Ga0495638_0023551_1837_2439 200
237 3300046460 Ga0495638_0026517 Ga0495638_0026517_100_702 200
238 3300046460 Ga0495638_0028844 Ga0495638_0028844_2564_3166 200
239 3300046460 Ga0495638_0041239 Ga0495638_0041239_390_992 200
240 3300046460 Ga0495638_0065447 Ga0495638_0065447_76_678 200
241 3300046460 Ga0495638_0219925 Ga0495638_0219925_250_852 200
242 3300046460 Ga0495638_0368599 Ga0495638_0368599_65_667 200
243 3300046471 Ga0495650_0003386 Ga0495650_0003386_2758_3360 200
244 3300046471 Ga0495650_0010317 Ga0495650_0010317_3864_4466 200
245 3300046471 Ga0495650_0014211 Ga0495650_0014211_3372_3974 200
246 3300046474 Ga0495605_0000001 Ga0495605_0000001_93419_94021 200
247 3300046474 Ga0495605_0000091 Ga0495605_0000091_35224_35826 200
248 3300046474 Ga0495605_0000220 Ga0495605_0000220_19246_19848 200
249 3300046474 Ga0495605_0000458 Ga0495605_0000458_35117_35719 200
250 3300046474 Ga0495605_0000723 Ga0495605_0000723_3146_3748 200
251 3300046474 Ga0495605_0003434 Ga0495605_0003434_6719_7321 200
252 3300046474 Ga0495605_0004925 Ga0495605_0004925_7115_7717 200
253 3300046474 Ga0495605_0099757 Ga0495605_0099757_462_1064 200
254 3300046474 Ga0495605_0216435 Ga0495605_0216435_108_710 200
255 3300046475 Ga0495639_0061257 Ga0495639_0061257_18_620 200
256 3300046491 Ga0495584_0001983 Ga0495584_0001983_419_1021 200
257 3300046491 Ga0495584_0002169 Ga0495584_0002169_10117_10719 200
258 3300046491 Ga0495584_0002461 Ga0495584_0002461_4998_5600 200
259 3300046491 Ga0495584_0005398 Ga0495584_0005398_4115_4717 200
260 3300046491 Ga0495584_0033246 Ga0495584_0033246_94_696 200
261 3300046491 Ga0495584_0049848 Ga0495584_0049848_22_624 200
262 3300046491 Ga0495584_0051159 Ga0495584_0051159_1000_1602 200
263 3300046492 Ga0495585_0000749 Ga0495585_0000749_12252_12854 200
264 3300046492 Ga0495585_0013787 Ga0495585_0013787_157_759 200
265 3300046492 Ga0495585_0124369 Ga0495585_0124369_204_806 200
266 3300046499 Ga0495594_0005988 Ga0495594_0005988_5571_6173 200
267 3300046500 Ga0495596_0000056 Ga0495596_0000056_14034_14636 200
268 3300046501 Ga0495607_0000013 Ga0495607_0000013_63614_64216 200
269 3300046501 Ga0495607_0000032 Ga0495607_0000032_146392_146994 200
270 3300046501 Ga0495607_0003133 Ga0495607_0003133_8944_9546 200
271 3300046501 Ga0495607_0005095 Ga0495607_0005095_4325_4927 200
272 3300046501 Ga0495607_0010163 Ga0495607_0010163_3826_4428 200
273 3300046501 Ga0495607_0011570 Ga0495607_0011570_828_1430 200
274 3300046501 Ga0495607_0016548 Ga0495607_0016548_3643_4245 200
275 3300046501 Ga0495607_0025581 Ga0495607_0025581_1467_2069 200
276 3300046501 Ga0495607_0028293 Ga0495607_0028293_718_1320 200
277 3300046501 Ga0495607_0029094 Ga0495607_0029094_381_983 200
278 3300046501 Ga0495607_0037199 Ga0495607_0037199_2279_2881 200
279 3300046506 Ga0495583_0000781 Ga0495583_0000781_25609_26211 200
280 3300046506 Ga0495583_0001519 Ga0495583_0001519_5113_5715 200
281 3300046506 Ga0495583_0004569 Ga0495583_0004569_3185_3787 200
282 3300046507 Ga0495606_0000238 Ga0495606_0000238_48188_48790 200
283 3300046507 Ga0495606_0000287 Ga0495606_0000287_7128_7730 200
284 3300046507 Ga0495606_0000962 Ga0495606_0000962_7898_8500 200
285 3300046507 Ga0495606_0004209 Ga0495606_0004209_8883_9485 200
286 3300046507 Ga0495606_0047914 Ga0495606_0047914_1993_2595 200
287 3300046507 Ga0495606_0060616 Ga0495606_0060616_403_1005 200
288 3300046507 Ga0495606_0090006 Ga0495606_0090006_504_1106 200
289 3300046512 Ga0495610_0007650 Ga0495610_0007650_1393_1995 200
290 3300046512 Ga0495610_0012510 Ga0495610_0012510_99_701 200
291 3300046512 Ga0495610_0012739 Ga0495610_0012739_4090_4692 200
292 3300046512 Ga0495610_0030648 Ga0495610_0030648_99_701 200
293 3300046512 Ga0495610_0032875 Ga0495610_0032875_883_1485 200
294 3300046512 Ga0495610_0036480 Ga0495610_0036480_1446_2048 200
295 3300046512 Ga0495610_0102038 Ga0495610_0102038_462_1064 200
296 3300046512 Ga0495610_0108724 Ga0495610_0108724_246_848 200
297 3300046512 Ga0495610_0149602 Ga0495610_0149602_267_869 200
298 3300046513 Ga0495616_0007951 Ga0495616_0007951_312_914 200
299 3300046513 Ga0495616_0056042 Ga0495616_0056042_175_777 200
300 3300046513 Ga0495616_0066697 Ga0495616_0066697_143_745 200
301 3300046513 Ga0495616_0080839 Ga0495616_0080839_681_1283 200
302 3300046513 Ga0495616_0084033 Ga0495616_0084033_636_1238 200
303 3300046515 Ga0495620_0001748 Ga0495620_0001748_9024_9626 200
304 3300046515 Ga0495620_0002249 Ga0495620_0002249_2277_2879 200
305 3300046515 Ga0495620_0007222 Ga0495620_0007222_1990_2592 200
306 3300046515 Ga0495620_0010727 Ga0495620_0010727_3313_3915 200
307 3300046515 Ga0495620_0036149 Ga0495620_0036149_86_688 200
308 3300046515 Ga0495620_0174262 Ga0495620_0174262_54_656 200
309 3300046517 Ga0495630_0408468 Ga0495630_0408468_268_870 200
310 3300046518 Ga0495631_0002296 Ga0495631_0002296_8206_8808 200
311 3300046518 Ga0495631_0003952 Ga0495631_0003952_5771_6373 200
312 3300046518 Ga0495631_0039136 Ga0495631_0039136_891_1493 200
313 3300046518 Ga0495631_0064593 Ga0495631_0064593_873_1475 200
314 3300046519 Ga0495632_0003172 Ga0495632_0003172_5337_5939 200
315 3300046519 Ga0495632_0008111 Ga0495632_0008111_4242_4844 200
316 3300046519 Ga0495632_0015629 Ga0495632_0015629_1393_1995 200
317 3300046519 Ga0495632_0019285 Ga0495632_0019285_1774_2376 200
318 3300046519 Ga0495632_0023208 Ga0495632_0023208_292_894 200
319 3300046519 Ga0495632_0028386 Ga0495632_0028386_456_1058 200
320 3300046519 Ga0495632_0032652 Ga0495632_0032652_1592_2194 200
321 3300046519 Ga0495632_0085589 Ga0495632_0085589_202_804 200
322 3300046520 Ga0495637_0000039 Ga0495637_0000039_69599_70201 200
323 3300046520 Ga0495637_0000210 Ga0495637_0000210_5353_5955 200
324 3300046520 Ga0495637_0003250 Ga0495637_0003250_2934_3536 200
325 3300046520 Ga0495637_0003624 Ga0495637_0003624_3674_4276 200
326 3300046520 Ga0495637_0005780 Ga0495637_0005780_4249_4851 200
327 3300046520 Ga0495637_0026840 Ga0495637_0026840_578_1180 200
328 3300046520 Ga0495637_0030764 Ga0495637_0030764_1592_2194 200
329 3300046520 Ga0495637_0030829 Ga0495637_0030829_1718_2320 200
330 3300046520 Ga0495637_0099696 Ga0495637_0099696_446_1048 200
331 3300046522 Ga0495643_0004514 Ga0495643_0004514_903_1505 200
332 3300046522 Ga0495643_0006249 Ga0495643_0006249_1316_1918 200
333 3300046522 Ga0495643_0015796 Ga0495643_0015796_3265_3867 200
334 3300046522 Ga0495643_0026220 Ga0495643_0026220_2118_2720 200
335 3300046522 Ga0495643_0055822 Ga0495643_0055822_72_674 200
336 3300046522 Ga0495643_0083841 Ga0495643_0083841_780_1382 200
337 3300046523 Ga0495644_0000017 Ga0495644_0000017_69937_70539 200
338 3300046523 Ga0495644_0000864 Ga0495644_0000864_4101_4703 200
339 3300046523 Ga0495644_0002802 Ga0495644_0002802_4937_5539 200
340 3300046523 Ga0495644_0036877 Ga0495644_0036877_1107_1709 200
341 3300046524 Ga0495648_0000190 Ga0495648_0000190_17943_18545 200
342 3300046524 Ga0495648_0000511 Ga0495648_0000511_15037_15639 200
343 3300046524 Ga0495648_0001710 Ga0495648_0001710_18183_18785 200
344 3300046524 Ga0495648_0003594 Ga0495648_0003594_7468_8070 200
345 3300046524 Ga0495648_0006106 Ga0495648_0006106_5819_6421 200
346 3300046524 Ga0495648_0029696 Ga0495648_0029696_2595_3197 200
347 3300046524 Ga0495648_0103713 Ga0495648_0103713_130_732 200
348 3300046524 Ga0495648_0141304 Ga0495648_0141304_451_1053 200
349 3300046526 Ga0495666_0000088 Ga0495666_0000088_8107_8709 200
350 3300046526 Ga0495666_0152940 Ga0495666_0152940_409_1011 200
351 3300046528 Ga0495642_0000037 Ga0495642_0000037_72574_73176 200
352 3300046530 Ga0495654_0001379 Ga0495654_0001379_5480_6082 200
353 3300046530 Ga0495654_0001815 Ga0495654_0001815_4035_4637 200
354 3300046530 Ga0495654_0006940 Ga0495654_0006940_4788_5390 200
355 3300046530 Ga0495654_0008362 Ga0495654_0008362_3425_4027 200
356 3300046530 Ga0495654_0009828 Ga0495654_0009828_569_1171 200
357 3300046530 Ga0495654_0009839 Ga0495654_0009839_3591_4193 200
358 3300046530 Ga0495654_0009972 Ga0495654_0009972_172_774 200
359 3300046530 Ga0495654_0037620 Ga0495654_0037620_1715_2317 200
360 3300046530 Ga0495654_0081886 Ga0495654_0081886_60_662 200
361 3300046530 Ga0495654_0169290 Ga0495654_0169290_295_897 200
362 3300046536 Ga0495587_0204908 Ga0495587_0204908_370_972 200
363 3300046538 Ga0495609_0000836 Ga0495609_0000836_5175_5777 200
364 3300046538 Ga0495609_0004332 Ga0495609_0004332_3388_3990 200
365 3300046542 Ga0495597_0000013 Ga0495597_0000013_151445_152047 200
366 3300046542 Ga0495597_0007863 Ga0495597_0007863_1117_1719 200
367 3300046542 Ga0495597_0008022 Ga0495597_0008022_2975_3577 200
368 3300046542 Ga0495597_0010073 Ga0495597_0010073_3964_4566 200
369 3300046542 Ga0495597_0014959 Ga0495597_0014959_2689_3291 200
370 3300046542 Ga0495597_0033642 Ga0495597_0033642_1646_2248 200
371 3300046542 Ga0495597_0034786 Ga0495597_0034786_997_1599 200
372 3300046542 Ga0495597_0052709 Ga0495597_0052709_828_1430 200
373 3300046543 Ga0495645_0074511 Ga0495645_0074511_898_1500 200
374 3300046557 Ga0495622_0013322 Ga0495622_0013322_2562_3164 200
375 3300046557 Ga0495622_0018093 Ga0495622_0018093_866_1468 200
376 3300046558 Ga0495633_0053522 Ga0495633_0053522_901_1503 200
377 3300046558 Ga0495633_0112486 Ga0495633_0112486_54_656 200
378 3300046615 Ga0495656_0017887 Ga0495656_0017887_66_668 200
379 3300046615 Ga0495656_0229280 Ga0495656_0229280_102_704 200
380 3300046616 Ga0495668_0000176 Ga0495668_0000176_16054_16656 200
381 3300046616 Ga0495668_0002276 Ga0495668_0002276_11522_12124 200
382 3300046616 Ga0495668_0021455 Ga0495668_0021455_745_1347 200
383 3300046616 Ga0495668_0123989 Ga0495668_0123989_539_1141 200
384 3300046616 Ga0495668_0153617 Ga0495668_0153617_39_641 200
385 3300046648 Ga0495611_0001016 Ga0495611_0001016_5061_5663 200
386 3300046648 Ga0495611_0011750 Ga0495611_0011750_1076_1678 200
387 3300046648 Ga0495611_0011931 Ga0495611_0011931_2684_3286 200
388 3300046660 Ga0495625_0001957 Ga0495625_0001957_17295_17897 200
389 3300046660 Ga0495625_0002335 Ga0495625_0002335_19292_19894 200
390 3300046660 Ga0495625_0002515 Ga0495625_0002515_17545_18147 200
391 3300046660 Ga0495625_0063206 Ga0495625_0063206_1562_2164 200
392 3300046660 Ga0495625_0124115 Ga0495625_0124115_52_654 200
393 3300046665 Ga0495661_0002924 Ga0495661_0002924_5404_6006 200
394 3300046665 Ga0495661_0004839 Ga0495661_0004839_5676_6278 200
395 3300046665 Ga0495661_0021017 Ga0495661_0021017_2607_3209 200
396 3300046665 Ga0495661_0035593 Ga0495661_0035593_2437_3039 200
397 3300046665 Ga0495661_0053255 Ga0495661_0053255_1821_2423 200
398 3300046665 Ga0495661_0222707 Ga0495661_0222707_319_921 200
399 3300046675 Ga0495657_0009168 Ga0495657_0009168_6645_7247 200
400 3300046679 Ga0495623_0002717 Ga0495623_0002717_6439_7041 200
401 3300046684 Ga0495669_0003966 Ga0495669_0003966_3887_4489 200
402 3300046691 Ga0495670_0000215 Ga0495670_0000215_1069_1671 200
403 3300046691 Ga0495670_0002071 Ga0495670_0002071_4437_5039 200
404 3300046691 Ga0495670_0019923 Ga0495670_0019923_2582_3184 200
405 3300046691 Ga0495670_0024471 Ga0495670_0024471_242_844 200
406 3300046691 Ga0495670_0075070 Ga0495670_0075070_689_1291 200
407 3300046691 Ga0495670_0149039 Ga0495670_0149039_513_1115 200
408 3300046692 Ga0495671_0004287 Ga0495671_0004287_3540_4142 200
409 3300046692 Ga0495671_0013118 Ga0495671_0013118_3532_4134 200
410 3300046692 Ga0495671_0017103 Ga0495671_0017103_2163_2765 200
411 3300046692 Ga0495671_0019889 Ga0495671_0019889_2621_3223 200
412 3300046692 Ga0495671_0044562 Ga0495671_0044562_1601_2203 200
413 3300046692 Ga0495671_0050895 Ga0495671_0050895_1072_1674 200
414 3300046692 Ga0495671_0062282 Ga0495671_0062282_652_1254 200
415 3300046692 Ga0495671_0076384 Ga0495671_0076384_562_1164 200
416 3300046694 Ga0495649_0000113 Ga0495649_0000113_67991_68593 200
417 3300046694 Ga0495649_0004415 Ga0495649_0004415_3604_4206 200
418 3300046694 Ga0495649_0007731 Ga0495649_0007731_5859_6461 200
419 3300046694 Ga0495649_0014128 Ga0495649_0014128_3893_4495 200
420 3300046694 Ga0495649_0014181 Ga0495649_0014181_1651_2253 200
421 3300046794 Ga0495589_0000814 Ga0495589_0000814_7964_8566 200
422 3300046794 Ga0495589_0001465 Ga0495589_0001465_4973_5575 200
423 3300046794 Ga0495589_0007437 Ga0495589_0007437_4532_5134 200
424 3300046809 Ga0495600_0506368 Ga0495600_0506368_36_638 200
425 3300046810 Ga0495660_0000535 Ga0495660_0000535_11533_12135 200
426 3300046810 Ga0495660_0000611 Ga0495660_0000611_15916_16518 200
427 3300046810 Ga0495660_0002227 Ga0495660_0002227_5008_5610 200
428 3300046810 Ga0495660_0003620 Ga0495660_0003620_3499_4101 200
429 3300046810 Ga0495660_0007163 Ga0495660_0007163_4521_5123 200
430 3300046810 Ga0495660_0014962 Ga0495660_0014962_1780_2382 200
431 3300046810 Ga0495660_0023871 Ga0495660_0023871_1792_2394 200
432 3300046810 Ga0495660_0024026 Ga0495660_0024026_1691_2293 200
433 3300046810 Ga0495660_0187726 Ga0495660_0187726_344_946 200
434 3300046810 Ga0495660_0239615 Ga0495660_0239615_185_787 200
435 3300047317 Ga0495604_0004795 Ga0495604_0004795_32_634 200
436 3300047320 Ga0495672_0000550 Ga0495672_0000550_15543_16145 200
437 3300047320 Ga0495672_0001014 Ga0495672_0001014_15124_15726 200
438 3300047320 Ga0495672_0001418 Ga0495672_0001418_4648_5250 200
439 3300047320 Ga0495672_0006963 Ga0495672_0006963_4579_5181 200
440 3300047320 Ga0495672_0008403 Ga0495672_0008403_2033_2635 200
441 3300047320 Ga0495672_0023216 Ga0495672_0023216_742_1344 200
442 3300047320 Ga0495672_0047679 Ga0495672_0047679_1933_2535 200
443 3300047320 Ga0495672_0079434 Ga0495672_0079434_1110_1712 200
444 3300047320 Ga0495672_0247097 Ga0495672_0247097_216_818 200
445 3300047321 Ga0495676_0000039 Ga0495676_0000039_33821_34423 200
446 3300047322 Ga0495680_0011661 Ga0495680_0011661_7120_7722 200
447 3300047322 Ga0495680_0034506 Ga0495680_0034506_3230_3832 200
448 3300047322 Ga0495680_0073114 Ga0495680_0073114_1825_2427 200
449 3300047323 Ga0495683_0000135 Ga0495683_0000135_18205_18807 200
450 3300047323 Ga0495683_0000503 Ga0495683_0000503_3821_4423 200
451 3300047323 Ga0495683_0024244 Ga0495683_0024244_1729_2331 200
452 3300047323 Ga0495683_0051125 Ga0495683_0051125_780_1382 200
453 3300047323 Ga0495683_0171163 Ga0495683_0171163_359_961 200
454 3300047444 Ga0495675_0057013 Ga0495675_0057013_1846_2448 200
455 3300047446 Ga0495679_000086 Ga0495679_000086_3630_4232 200
456 3300047446 Ga0495679_000284 Ga0495679_000284_34140_34742 200
457 3300047446 Ga0495679_020527 Ga0495679_020527_1551_2153 200
458 3300047469 Ga0495673_0000261 Ga0495673_0000261_229_831 200
459 3300047469 Ga0495673_0000429 Ga0495673_0000429_32491_33093 200
460 3300047469 Ga0495673_0000619 Ga0495673_0000619_16939_17541 200
461 3300047469 Ga0495673_0001441 Ga0495673_0001441_15249_15851 200
462 3300047469 Ga0495673_0001957 Ga0495673_0001957_1447_2049 200
463 3300047469 Ga0495673_0008814 Ga0495673_0008814_723_1325 200
464 3300047469 Ga0495673_0012220 Ga0495673_0012220_1802_2404 200
465 3300047469 Ga0495673_0015133 Ga0495673_0015133_1272_1874 200
466 3300047469 Ga0495673_0019949 Ga0495673_0019949_2118_2720 200
467 3300047469 Ga0495673_0024299 Ga0495673_0024299_791_1393 200
468 3300047469 Ga0495673_0036420 Ga0495673_0036420_933_1535 200
469 3300047470 Ga0495681_0000235 Ga0495681_0000235_2356_2958 200
470 3300047470 Ga0495681_0000501 Ga0495681_0000501_10625_11227 200
471 3300047470 Ga0495681_0000652 Ga0495681_0000652_16208_16810 200
472 3300047470 Ga0495681_0001649 Ga0495681_0001649_14183_14785 200
473 3300047470 Ga0495681_0004113 Ga0495681_0004113_4520_5122 200
474 3300047470 Ga0495681_0005085 Ga0495681_0005085_7712_8314 200
475 3300047470 Ga0495681_0008204 Ga0495681_0008204_50_652 200
476 3300047470 Ga0495681_0026829 Ga0495681_0026829_125_727 200
477 3300047470 Ga0495681_0035376 Ga0495681_0035376_111_713 200
478 3300047470 Ga0495681_0047969 Ga0495681_0047969_1328_1930 200
479 3300047470 Ga0495681_0088234 Ga0495681_0088234_673_1275 200
480 3300047471 Ga0495684_0108806 Ga0495684_0108806_554_1156 200
481 3300047472 Ga0495686_0013427 Ga0495686_0013427_2484_3086 200
482 3300047472 Ga0495686_0021108 Ga0495686_0021108_359_961 200
483 3300047472 Ga0495686_0088478 Ga0495686_0088478_989_1591 200
484 3300047472 Ga0495686_0098338 Ga0495686_0098338_1081_1683 200
485 3300047472 Ga0495686_0101224 Ga0495686_0101224_1048_1650 200
486 3300047472 Ga0495686_0102142 Ga0495686_0102142_350_952 200
487 3300047673 Ga0495593_0000018 Ga0495593_0000018_17295_17897 200
488 3300048091 Ga0495626_0000086 Ga0495626_0000086_117225_117827 200
489 3300048091 Ga0495626_0000112 Ga0495626_0000112_24356_24958 200
490 3300048091 Ga0495626_0000143 Ga0495626_0000143_86677_87279 200
491 3300048905 Ga0496102_0056252 Ga0496102_0056252_225_827 200
492 3300048913 Ga0496110_0041968 Ga0496110_0041968_398_1000 200
493 3300048913 Ga0496110_0099490 Ga0496110_0099490_1045_1647 200
494 3300048914 Ga0496111_0306866 Ga0496111_0306866_191_793 200
495 3300048915 Ga0496112_0303748 Ga0496112_0303748_433_1035 200
496 3300048921 Ga0496118_0031378 Ga0496118_0031378_1813_2415 200
497 3300048921 Ga0496118_0085981 Ga0496118_0085981_347_949 200
498 3300048924 Ga0496121_0000316 Ga0496121_0000316_90416_91018 200
499 3300048924 Ga0496121_0000487 Ga0496121_0000487_36349_36951 200
500 3300048924 Ga0496121_0002636 Ga0496121_0002636_3318_3920 200
501 3300048924 Ga0496121_0457936 Ga0496121_0457936_73_675 200
502 3300048925 Ga0496122_0000292 Ga0496122_0000292_102077_102679 200
503 3300048925 Ga0496122_0009795 Ga0496122_0009795_3768_4370 200
504 3300048926 Ga0496123_0000037 Ga0496123_0000037_253492_254094 200
505 3300048926 Ga0496123_0017382 Ga0496123_0017382_3608_4210 200
506 3300048927 Ga0496124_0000580 Ga0496124_0000580_42842_43444 200
507 3300048927 Ga0496124_0000838 Ga0496124_0000838_34125_34727 200
508 3300048927 Ga0496124_0020419 Ga0496124_0020419_3049_3651 200
509 3300048927 Ga0496124_0208207 Ga0496124_0208207_441_1043 200
510 3300048928 Ga0496125_0004331 Ga0496125_0004331_13745_14347 200
511 3300048929 Ga0496126_0004195 Ga0496126_0004195_2051_2653 200
512 3300049459 Ga0495678_000083 Ga0495678_000083_47075_47677 200
513 3300049459 Ga0495678_001806 Ga0495678_001806_12186_12788 200
514 3300049459 Ga0495678_004167 Ga0495678_004167_4285_4887 200
515 3300049459 Ga0495678_006617 Ga0495678_006617_476_1078 200
516 3300049459 Ga0495678_035245 Ga0495678_035245_1397_1999 200
517 3300049459 Ga0495678_047771 Ga0495678_047771_784_1386 200
518 3300049460 Ga0495682_0000457 Ga0495682_0000457_9427_10029 200
519 3300049460 Ga0495682_0001442 Ga0495682_0001442_9050_9652 200
520 3300049460 Ga0495682_0059766 Ga0495682_0059766_173_775 200
521 3300050514 nmdc:mga08x19_88927_c1 nmdc:mga08x19_88927_c1_1277_1879 200
522 3300053140 Ga0500573_0002921 Ga0500573_0002921_5821_6429 200
523 2124908027 MRS2a_Contig_1414 MRS2a_00304670 201
524 3300002771 JGI25163J39215_1000021 JGI25163J39215_100002127 201
525 3300002771 JGI25163J39215_1000507 JGI25163J39215_10005078 201
526 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005216 201
527 3300002772 JGI25164J39214_1000121 JGI25164J39214_100012151 201
528 3300003214 JGI25165J46597_1000099 JGI25165J46597_10000993 201
529 3300003214 JGI25165J46597_1000240 JGI25165J46597_100024021 201
530 3300003781 Ga0055536_1000059 Ga0055536_100005943 201
531 3300003781 Ga0055536_1029510 Ga0055536_10295102 201
532 3300003791 Ga0055530_10000096 Ga0055530_1000009632 201
533 3300003792 Ga0055540_1000650 Ga0055540_10006503 201
534 3300005289 Ga0065704_10080381 Ga0065704_100803814 201
535 3300005289 Ga0065704_10084836 Ga0065704_100848361 201
536 3300005289 Ga0065704_10089809 Ga0065704_100898091 201
537 3300006058 Ga0075432_10026201 Ga0075432_100262013 201
538 3300006914 Ga0075436_100422457 Ga0075436_1004224571 201
539 3300006944 Ga0099823_1000188 Ga0099823_100018822 201
540 3300009011 Ga0105251_10001933 Ga0105251_1000193320 201
541 3300009011 Ga0105251_10053384 Ga0105251_100533842 201
542 3300009036 Ga0105244_10000456 Ga0105244_1000045611 201
543 3300009036 Ga0105244_10012905 Ga0105244_100129054 201
544 3300009036 Ga0105244_10015041 Ga0105244_100150413 201
545 3300009036 Ga0105244_10018747 Ga0105244_100187473 201
546 3300009036 Ga0105244_10062573 Ga0105244_100625732 201
547 3300009092 Ga0105250_10000130 Ga0105250_1000013025 201
548 3300009092 Ga0105250_10012007 Ga0105250_100120073 201
549 3300009092 Ga0105250_10073304 Ga0105250_100733042 201
550 3300009148 Ga0105243_10000115 Ga0105243_1000011542 201
551 3300009148 Ga0105243_10006536 Ga0105243_100065365 201
552 3300013100 Ga0157373_10247337 Ga0157373_102473372 201
553 3300013102 Ga0157371_10000185 Ga0157371_1000018563 201
554 3300013102 Ga0157371_10000282 Ga0157371_1000028222 201
555 3300013102 Ga0157371_10021424 Ga0157371_100214242 201
556 3300013104 Ga0157370_10000199 Ga0157370_1000019924 201
557 3300013104 Ga0157370_10074041 Ga0157370_100740412 201
558 3300013105 Ga0157369_11359780 Ga0157369_113597802 201
559 3300014497 Ga0182008_10013933 Ga0182008_100139334 201
560 3300014497 Ga0182008_10112428 Ga0182008_101124282 201
561 3300015261 Ga0182006_1000101 Ga0182006_100010143 201
562 3300015261 Ga0182006_1022562 Ga0182006_10225623 201
563 3300015262 Ga0182007_10000034 Ga0182007_1000003443 201
564 3300015265 Ga0182005_1000226 Ga0182005_100022626 201
565 3300017792 Ga0163161_10002413 Ga0163161_100024139 201
566 3300025207 Ga0209760_100007 Ga0209760_100007203 201
567 3300025207 Ga0209760_100102 Ga0209760_10010220 201
568 3300025231 Ga0207427_100018 Ga0207427_100018380 201
569 3300025231 Ga0207427_100056 Ga0207427_100056163 201
570 3300025233 Ga0209437_100031 Ga0209437_100031380 201
571 3300025233 Ga0209437_100065 Ga0209437_100065163 201
572 3300025261 Ga0209233_1000012 Ga0209233_1000012377 201
573 3300025261 Ga0209233_1000085 Ga0209233_1000085163 201
574 3300025292 Ga0209676_1000313 Ga0209676_100031332 201
575 3300025292 Ga0209676_1000805 Ga0209676_100080528 201
576 3300025298 Ga0209050_1000106 Ga0209050_1000106156 201
577 3300025303 Ga0209051_1000139 Ga0209051_100013973 201
578 3300025711 Ga0207696_1000022 Ga0207696_1000022361 201
579 3300025711 Ga0207696_1000255 Ga0207696_100025534 201
580 3300025711 Ga0207696_1002754 Ga0207696_10027543 201
581 3300025711 Ga0207696_1009579 Ga0207696_10095794 201
582 3300025728 Ga0207655_1000015 Ga0207655_100001525 201
583 3300025728 Ga0207655_1000162 Ga0207655_1000162103 201
584 3300025728 Ga0207655_1000224 Ga0207655_100022425 201
585 3300025728 Ga0207655_1000383 Ga0207655_100038325 201
586 3300025728 Ga0207655_1021713 Ga0207655_10217133 201
587 3300025728 Ga0207655_1027789 Ga0207655_10277893 201
588 3300025728 Ga0207655_1031575 Ga0207655_10315752 201
589 3300025735 Ga0207713_1000049 Ga0207713_100004972 201
590 3300025735 Ga0207713_1015450 Ga0207713_10154502 201
591 3300025735 Ga0207713_1049653 Ga0207713_10496532 201
592 3300025735 Ga0207713_1057871 Ga0207713_10578712 201
593 3300025935 Ga0207709_10000127 Ga0207709_1000012763 201
594 3300025935 Ga0207709_10006418 Ga0207709_100064184 201
595 3300025935 Ga0207709_10015777 Ga0207709_100157772 201
596 3300025935 Ga0207709_10028847 Ga0207709_100288473 201
597 3300025961 Ga0207712_10332402 Ga0207712_103324021 201
598 3300025972 Ga0207668_10927688 Ga0207668_109276881 201
599 3300027296 Ga0209389_1000002 Ga0209389_100000223 201
600 3300027296 Ga0209389_1107658 Ga0209389_11076582 201
601 3300027312 Ga0209371_1001305 Ga0209371_10013053 201
602 3300027312 Ga0209371_1011908 Ga0209371_10119082 201
603 3300027360 Ga0209969_1003257 Ga0209969_10032573 201
604 3300027395 Ga0209996_1000824 Ga0209996_10008243 201
605 3300027471 Ga0209995_1002536 Ga0209995_10025363 201
606 3300027552 Ga0209982_1016709 Ga0209982_10167092 201
607 3300027614 Ga0209970_1043773 Ga0209970_10437731 201
608 3300027665 Ga0209983_1026335 Ga0209983_10263352 201
609 3300027682 Ga0209971_1013784 Ga0209971_10137842 201
610 3300027876 Ga0209974_10009353 Ga0209974_100093531 201
611 3300030500 Ga0268256_1001429 Ga0268256_10014293 201
612 3300030500 Ga0268256_1009453 Ga0268256_10094532 201
613 3300031548 Ga0307408_100000013 Ga0307408_100000013344 201
614 3300031731 Ga0307405_10363346 Ga0307405_103633462 201
615 3300032004 Ga0307414_10185873 Ga0307414_101858732 201
616 3300041405 Ga0439438_002103 Ga0439438_002103_5963_6568 201
617 3300041407 Ga0439447_004532 Ga0439447_004532_274_879 201
618 3300041411 Ga0439466_0000126 Ga0439466_0000126_6822_7427 201
619 3300041411 Ga0439466_0006460 Ga0439466_0006460_2852_3457 201
620 3300041411 Ga0439466_0024235 Ga0439466_0024235_313_921 201
621 3300042013 Ga0439456_000013 Ga0439456_000013_33187_33792 201
622 3300042016 Ga0439463_000178 Ga0439463_000178_6481_7086 201
623 3300042137 Ga0450902_000185 Ga0450902_000185_5542_6147 201
624 3300042142 Ga0450905_000015 Ga0450905_000015_11202_11807 201
625 3300042142 Ga0450905_005113 Ga0450905_005113_524_1129 201
626 3300042156 Ga0439446_0000588 Ga0439446_0000588_881_1489 201
627 3300042156 Ga0439446_0003519 Ga0439446_0003519_2436_3041 201
628 3300042435 Ga0439434_0000671 Ga0439434_0000671_1284_1889 201
629 3300042439 Ga0439464_0032894 Ga0439464_0032894_222_827 201
630 3300042439 Ga0439464_0101393 Ga0439464_0101393_224_832 201
631 3300042533 Ga0450901_004005 Ga0450901_004005_287_892 201
632 3300042993 Ga0439440_0000515 Ga0439440_0000515_4430_5035 201
633 3300046455 Ga0495603_0007419 Ga0495603_0007419_3413_4018 201
634 3300046457 Ga0495590_0000156 Ga0495590_0000156_24611_25216 201
635 3300046458 Ga0495591_020770 Ga0495591_020770_188_793 201
636 3300046460 Ga0495638_0133143 Ga0495638_0133143_294_899 201
637 3300046463 Ga0495653_0000332 Ga0495653_0000332_29214_29819 201
638 3300046471 Ga0495650_0036585 Ga0495650_0036585_774_1379 201
639 3300046472 Ga0495580_0260359 Ga0495580_0260359_95_700 201
640 3300046474 Ga0495605_0002830 Ga0495605_0002830_8009_8614 201
641 3300046475 Ga0495639_0000004 Ga0495639_0000004_54301_54906 201
642 3300046492 Ga0495585_0103941 Ga0495585_0103941_76_681 201
643 3300046499 Ga0495594_0000720 Ga0495594_0000720_5304_5909 201
644 3300046501 Ga0495607_0000661 Ga0495607_0000661_8516_9121 201
645 3300046501 Ga0495607_0004274 Ga0495607_0004274_1877_2482 201
646 3300046507 Ga0495606_0000271 Ga0495606_0000271_47519_48124 201
647 3300046507 Ga0495606_0001537 Ga0495606_0001537_8008_8613 201
648 3300046513 Ga0495616_0000381 Ga0495616_0000381_15825_16430 201
649 3300046513 Ga0495616_0023576 Ga0495616_0023576_752_1357 201
650 3300046515 Ga0495620_0000052 Ga0495620_0000052_31817_32422 201
651 3300046518 Ga0495631_0000472 Ga0495631_0000472_18261_18866 201
652 3300046519 Ga0495632_0000540 Ga0495632_0000540_27593_28198 201
653 3300046519 Ga0495632_0008838 Ga0495632_0008838_48_653 201
654 3300046520 Ga0495637_0005180 Ga0495637_0005180_946_1551 201
655 3300046522 Ga0495643_0000175 Ga0495643_0000175_52120_52773 201
656 3300046522 Ga0495643_0001593 Ga0495643_0001593_16826_17431 201
657 3300046522 Ga0495643_0001686 Ga0495643_0001686_15964_16569 201
658 3300046522 Ga0495643_0002450 Ga0495643_0002450_2230_2835 201
659 3300046524 Ga0495648_0000611 Ga0495648_0000611_5862_6467 201
660 3300046526 Ga0495666_0009312 Ga0495666_0009312_1001_1606 201
661 3300046529 Ga0495652_0129095 Ga0495652_0129095_272_877 201
662 3300046530 Ga0495654_0000385 Ga0495654_0000385_20158_20763 201
663 3300046530 Ga0495654_0001231 Ga0495654_0001231_4647_5252 201
664 3300046530 Ga0495654_0024823 Ga0495654_0024823_2396_3001 201
665 3300046557 Ga0495622_0000777 Ga0495622_0000777_11743_12348 201
666 3300046558 Ga0495633_0032661 Ga0495633_0032661_1184_1789 201
667 3300046664 Ga0495659_0000013 Ga0495659_0000013_51758_52363 201
668 3300046665 Ga0495661_0000075 Ga0495661_0000075_113414_114019 201
669 3300046665 Ga0495661_0094553 Ga0495661_0094553_905_1510 201
670 3300046691 Ga0495670_0129157 Ga0495670_0129157_680_1285 201
671 3300046692 Ga0495671_0000692 Ga0495671_0000692_240_845 201
672 3300046692 Ga0495671_0003368 Ga0495671_0003368_8413_9018 201
673 3300046692 Ga0495671_0089400 Ga0495671_0089400_225_830 201
674 3300046694 Ga0495649_0000186 Ga0495649_0000186_46251_46904 201
675 3300046694 Ga0495649_0001536 Ga0495649_0001536_16698_17303 201
676 3300046694 Ga0495649_0001772 Ga0495649_0001772_4163_4768 201
677 3300046694 Ga0495649_0036903 Ga0495649_0036903_1100_1705 201
678 3300046794 Ga0495589_0003431 Ga0495589_0003431_7122_7727 201
679 3300046810 Ga0495660_0040175 Ga0495660_0040175_866_1471 201
680 3300046810 Ga0495660_0229618 Ga0495660_0229618_211_816 201
681 3300047315 Ga0495581_0000210 Ga0495581_0000210_6174_6779 201
682 3300047320 Ga0495672_0000360 Ga0495672_0000360_53443_54048 201
683 3300047320 Ga0495672_0004334 Ga0495672_0004334_6791_7396 201
684 3300047320 Ga0495672_0019944 Ga0495672_0019944_3005_3610 201
685 3300047320 Ga0495672_0068858 Ga0495672_0068858_1298_1903 201
686 3300047321 Ga0495676_0002451 Ga0495676_0002451_14922_15527 201
687 3300047323 Ga0495683_0000043 Ga0495683_0000043_90170_90775 201
688 3300047443 Ga0495687_000948 Ga0495687_000948_27241_27846 201
689 3300047469 Ga0495673_0006333 Ga0495673_0006333_4081_4686 201
690 3300047472 Ga0495686_0208386 Ga0495686_0208386_236_841 201
691 3300047673 Ga0495593_0034609 Ga0495593_0034609_1655_2260 201
692 3300048091 Ga0495626_0000235 Ga0495626_0000235_53164_53769 201
693 3300048908 Ga0496105_0239666 Ga0496105_0239666_328_933 201
694 3300048909 Ga0496106_0015149 Ga0496106_0015149_5027_5632 201
695 3300048910 Ga0496107_0168849 Ga0496107_0168849_448_1053 201
696 3300048913 Ga0496110_0153570 Ga0496110_0153570_35_640 201
697 3300048915 Ga0496112_0068965 Ga0496112_0068965_2205_2810 201
698 3300048917 Ga0496114_0001680 Ga0496114_0001680_13126_13731 201
699 3300048917 Ga0496114_0003874 Ga0496114_0003874_502_1107 201
700 3300048919 Ga0496116_0000258 Ga0496116_0000258_87441_88046 201
701 3300048919 Ga0496116_0000267 Ga0496116_0000267_49087_49692 201
702 3300048919 Ga0496116_0003215 Ga0496116_0003215_15103_15708 201
703 3300048920 Ga0496117_0000345 Ga0496117_0000345_41607_42212 201
704 3300048920 Ga0496117_0003106 Ga0496117_0003106_2702_3307 201
705 3300048920 Ga0496117_0012755 Ga0496117_0012755_2679_3284 201
706 3300048920 Ga0496117_0202354 Ga0496117_0202354_80_685 201
707 3300048921 Ga0496118_0002944 Ga0496118_0002944_19853_20458 201
708 3300048921 Ga0496118_0003187 Ga0496118_0003187_16370_16975 201
709 3300048921 Ga0496118_0181289 Ga0496118_0181289_80_685 201
710 3300048922 Ga0496119_0000011 Ga0496119_0000011_44718_45323 201
711 3300048923 Ga0496120_0000306 Ga0496120_0000306_23488_24093 201
712 3300048924 Ga0496121_0000366 Ga0496121_0000366_49179_49784 201
713 3300048924 Ga0496121_0001079 Ga0496121_0001079_18413_19018 201
714 3300048924 Ga0496121_0063699 Ga0496121_0063699_2287_2892 201
715 3300048924 Ga0496121_0140295 Ga0496121_0140295_1124_1729 201
716 3300048925 Ga0496122_0001617 Ga0496122_0001617_23685_24290 201
717 3300048925 Ga0496122_0001775 Ga0496122_0001775_25221_25826 201
718 3300048925 Ga0496122_0004613 Ga0496122_0004613_11864_12469 201
719 3300048925 Ga0496122_0062617 Ga0496122_0062617_1828_2433 201
720 3300048926 Ga0496123_0002675 Ga0496123_0002675_4740_5345 201
721 3300048926 Ga0496123_0006000 Ga0496123_0006000_4353_4958 201
722 3300048926 Ga0496123_0039288 Ga0496123_0039288_1680_2288 201
723 3300048926 Ga0496123_0233852 Ga0496123_0233852_277_882 201
724 3300048927 Ga0496124_0001078 Ga0496124_0001078_3399_4004 201
725 3300048927 Ga0496124_0003076 Ga0496124_0003076_4061_4666 201
726 3300048927 Ga0496124_0013052 Ga0496124_0013052_6531_7136 201
727 3300048927 Ga0496124_0023557 Ga0496124_0023557_4226_4831 201
728 3300048927 Ga0496124_0104548 Ga0496124_0104548_395_1000 201
729 3300048927 Ga0496124_0447786 Ga0496124_0447786_137_742 201
730 3300048928 Ga0496125_0000240 Ga0496125_0000240_78609_79214 201
731 3300048928 Ga0496125_0037486 Ga0496125_0037486_1398_2003 201
732 3300048928 Ga0496125_0052533 Ga0496125_0052533_1160_1765 201
733 3300048928 Ga0496125_0132322 Ga0496125_0132322_650_1255 201
734 3300048929 Ga0496126_0027264 Ga0496126_0027264_1779_2384 201
735 3300048929 Ga0496126_0036947 Ga0496126_0036947_2074_2679 201
736 3300048929 Ga0496126_0674613 Ga0496126_0674613_13_618 201
737 3300049459 Ga0495678_018635 Ga0495678_018635_1404_2009 201
738 3300049460 Ga0495682_0000118 Ga0495682_0000118_36347_36952 201
739 3300049460 Ga0495682_0098421 Ga0495682_0098421_130_735 201
740 3300049568 Ga0501031_0125480 Ga0501031_0125480_985_1590 201
741 3300049571 Ga0501034_0000330 Ga0501034_0000330_56496_57101 201
742 3300049573 Ga0501037_0054561 Ga0501037_0054561_653_1258 201
743 3300049574 Ga0501038_0060240 Ga0501038_0060240_2367_2972 201
744 3300053125 Ga0500618_004037 Ga0500618_004037_1884_2489 201
745 3300053135 Ga0500659_0001851 Ga0500659_0001851_90_695 201
746 3300053145 Ga0500586_139802 Ga0500586_139802_20_625 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

40

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.8715 2 197
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.863 2 197
3pcd-assembly1.cif.gz_M protocatechuate 3,4-dioxygenase y447h mutant 0.8597 37 185
2pcd-assembly1.cif.gz_N-2 structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution 0.8549 37 185
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8515 5 197
ID Description Score Start End Superfamily
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8734 2 197 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.865 2 197 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8512 35 189 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8094 37 196 2.60.130.10
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8091 51 141 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A423HBD0-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9901 39 182 GO:0008199
GO:0009056
GO:0018578
AF-A0A4Q7GW69-F1-model_v4 deleted 0.9896 71 197
AF-F3CFA5-F1-model_v4 Protocatechuate 3,4-dioxygenase, alpha subunit 0.9893 105 197 GO:0005506
GO:0009056
GO:0018578
AF-A0A0Q0K060-F1-model_v4 deleted 0.9861 42 197
AF-A0A2A2M1X2-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9855 119 197 GO:0005506
GO:0016702

Feature Viewer

pLDDT pTM Quality
84.28 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map