F478837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 667 | 245 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10206150|Ga0065704_102061501 |
| Length | 261 |
| Sequence | VKIATWNVNSAKARLPLITDWLRAESPDVALLQEIKCETAAFPRAAFEDLGYHVTPVGQKSYNGVAFLSKALHEDVLTRLPGEPEDEQARYVEATVGGVRIASLYLPNGNPLGTEKFAYKLRWMDRLHAHARGLLAQEIPFVLGGDYNIIPEPRDVFDPAAFAGDALFQPESRAKFRALLNLGLTEAYRALHDDDHAYTFWDYQAGCWPRDLGLRIDHFLLSPQAADRLVECRIDRLPRGAEKASDHTPVLLDLCDGSDIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 12 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 13 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 17 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 22 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 23 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 24 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 25 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 26 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 27 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 28 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 29 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 30 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 31 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 32 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 33 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 34 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 35 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 36 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 37 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 38 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 39 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 40 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 41 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 42 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 43 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 44 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 45 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 46 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 47 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 48 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 49 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 50 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 51 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 52 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 53 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 54 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 55 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 56 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 57 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 58 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 59 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 60 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 61 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 62 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 63 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 64 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 65 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 66 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 67 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 68 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 69 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 70 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 71 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 72 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 73 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 74 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 75 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 76 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 77 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 78 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 79 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 80 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 81 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 82 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 83 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 84 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 85 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 86 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 87 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 88 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 89 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 90 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 91 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 92 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 93 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 94 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 95 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 96 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 97 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 98 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 99 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 100 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 101 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 102 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 103 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 104 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 105 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 106 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 107 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 108 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 109 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 110 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 111 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 112 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 113 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 114 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 115 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 116 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 117 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 118 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 119 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 120 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 121 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 122 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 123 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 124 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 125 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 126 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 127 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 128 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 129 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 130 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 131 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 132 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 133 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 134 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 135 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 136 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 137 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 138 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 139 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 140 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 141 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 142 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 143 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 144 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 145 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 146 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 147 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 148 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 149 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 150 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 151 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 152 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 153 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 154 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 155 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 156 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 157 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 158 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 159 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 160 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 161 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 162 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 163 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 164 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 165 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 166 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 167 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 168 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 169 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 170 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 171 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 172 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 173 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 174 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 175 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 176 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 177 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 178 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 179 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 180 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 181 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 182 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 183 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 184 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 185 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 186 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 187 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 188 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 189 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 190 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 191 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 192 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 193 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 194 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 195 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 196 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 197 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 198 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 199 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 200 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 201 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 202 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 203 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 204 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 205 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 206 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 207 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 208 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 209 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 210 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 211 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 212 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 213 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 214 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 215 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 216 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 217 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 218 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 219 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 220 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 221 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 222 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 223 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 224 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 225 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 226 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 227 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 228 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 229 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 230 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 231 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 232 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 233 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 234 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 235 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 236 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 237 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 238 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 239 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 240 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 241 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 242 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 243 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 244 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 245 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 246 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 247 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 248 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 249 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 250 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 251 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 252 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 253 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 254 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 255 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 256 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 257 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 258 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 259 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 260 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 261 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 262 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 263 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 264 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 265 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 266 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 267 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 268 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 269 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 270 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 271 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 272 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 273 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 274 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 275 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 276 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 277 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 278 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 279 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 280 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 281 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 282 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 283 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 284 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 285 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 286 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 287 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 288 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 289 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 290 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 291 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 292 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 293 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 294 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 295 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 296 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 297 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 298 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 299 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 300 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 301 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 302 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 303 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 304 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 305 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 306 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 307 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 308 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 309 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 310 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 311 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 312 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 313 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 314 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 315 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 316 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 317 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 318 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 319 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 320 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 321 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 322 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 323 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 324 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 325 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 326 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 327 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 328 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 329 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 330 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 331 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 332 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 333 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 334 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 335 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 336 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 337 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 338 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 339 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 340 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 341 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 342 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 343 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 344 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 345 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 346 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 347 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 348 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 349 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 350 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 351 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 352 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 353 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 354 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 355 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 356 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 357 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 358 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 359 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 360 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 361 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 362 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 363 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 364 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 365 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 366 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 367 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 368 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 369 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 370 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 371 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 372 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 373 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 374 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 375 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 376 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 377 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 378 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 379 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 380 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 381 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 382 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 383 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 384 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 385 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 386 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 387 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 388 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 389 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 390 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 391 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 392 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 393 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 394 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 395 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 396 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 397 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 398 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 399 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 400 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 401 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 402 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 403 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 404 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 405 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 406 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 407 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 408 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 409 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 410 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 411 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 412 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 413 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 414 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 415 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 416 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 417 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 418 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 419 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 420 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 421 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 422 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 423 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 424 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 425 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 426 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 427 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 428 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 429 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 430 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 431 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 432 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 433 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 434 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 435 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 436 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 437 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 438 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 439 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 440 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 441 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 442 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 443 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 444 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 445 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 446 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 447 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 448 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 449 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 450 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 451 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 452 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 453 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 454 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 455 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 456 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 457 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 458 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 459 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 460 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 461 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 462 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 463 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 464 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 465 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 466 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 467 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 468 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 469 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 470 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 471 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 472 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 473 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 474 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 475 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 476 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 477 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 478 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 479 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 480 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 481 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 482 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 483 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 484 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 485 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 486 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 487 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 488 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 489 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 490 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 491 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 492 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 493 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 494 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 495 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 498 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 499 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 500 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 501 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 502 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 503 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 504 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 505 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 506 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 507 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 508 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 509 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 510 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 511 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 512 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 513 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 514 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 515 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 516 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 517 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 518 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 519 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 520 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 521 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 522 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 523 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 525 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 526 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 527 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 528 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 529 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 530 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 531 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 532 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 533 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 534 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 535 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 536 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 537 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 538 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 539 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 540 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 541 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 542 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 543 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 545 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 549 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 551 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 554 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 555 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 556 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 581 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 582 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 584 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 585 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 586 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 587 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 588 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 589 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 590 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 591 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 592 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 593 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 594 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 595 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 596 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 597 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 598 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 599 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 600 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 601 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 602 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 603 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 604 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 605 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 606 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 607 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 608 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 617 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 618 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 619 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 620 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 621 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 622 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 623 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 624 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 633 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 634 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 635 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 636 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 637 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 639 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 640 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 641 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 642 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 643 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 644 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 645 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 647 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 648 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 649 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 650 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 651 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 652 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 653 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 654 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 655 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 656 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 657 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 658 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 659 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 660 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 661 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 662 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 663 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 664 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 665 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 666 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 667 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 32.84 |
| Metatranscriptomes | 0 |
| Isolates | 67.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.45 |
| Nodule | 61.39 |
| Rhizoplane | 0.54 |
| Rhizosphere | 20.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1010079 | 3300002705 | Bacteria | 2245 |
| 2 | JGI25157J39369_1001218 | 3300002741 | Bacteria | 10695 |
| 3 | JGI25159J45721_1000009 | 3300002987 | Bacteria | 168868 |
| 4 | JGI25151J46595_10003794 | 3300003187 | Bacteria | 8193 |
| 5 | JGI25165J46597_1005549 | 3300003214 | Bacteria | 2408 |
| 6 | JGI25153J46596_10012743 | 3300003215 | Bacteria | 3603 |
| 7 | rootH2_10006208 | 3300003320 | Bacteria | 13872 |
| 8 | JGI25160J50197_1000028 | 3300003354 | Bacteria | 179309 |
| 9 | JGI25161J50226_1000332 | 3300003374 | Bacteria | 25529 |
| 10 | Ga0055526_1017685 | 3300003771 | Bacteria | 2709 |
| 11 | Ga0055524_1000885 | 3300003775 | Bacteria | 19543 |
| 12 | Ga0055531_10008787 | 3300003794 | Bacteria | 5267 |
| 13 | Ga0055531_10021851 | 3300003794 | Bacteria | 2463 |
| 14 | Ga0055543_1000230 | 3300004625 | Bacteria | 44357 |
| 15 | Ga0065165_1000061 | 3300005262 | Bacteria | 179347 |
| 16 | Ga0065165_1000941 | 3300005262 | Bacteria | 37145 |
| 17 | Ga0065704_10206150 | 3300005289 | Bacteria | 1126 |
| 18 | Ga0070658_10023460 | 3300005327 | Bacteria | 4951 |
| 19 | Ga0070676_10069510 | 3300005328 | Bacteria | 2110 |
| 20 | Ga0070682_100306775 | 3300005337 | Bacteria | 1167 |
| 21 | Ga0068868_100058510 | 3300005338 | Bacteria | 3046 |
| 22 | Ga0070660_100004051 | 3300005339 | Bacteria | 10110 |
| 23 | Ga0070661_100002761 | 3300005344 | Bacteria | 12042 |
| 24 | Ga0070667_100118611 | 3300005367 | Bacteria | 2300 |
| 25 | Ga0068853_100000687 | 3300005539 | Bacteria | 23331 |
| 26 | Ga0068853_100036462 | 3300005539 | Bacteria | 4182 |
| 27 | Ga0068853_100346826 | 3300005539 | Bacteria | 1380 |
| 28 | Ga0070665_100060885 | 3300005548 | Bacteria | 3784 |
| 29 | Ga0070665_100276020 | 3300005548 | Bacteria | 1683 |
| 30 | Ga0070665_100395962 | 3300005548 | Bacteria | 1389 |
| 31 | Ga0068855_100127298 | 3300005563 | Bacteria | 2911 |
| 32 | Ga0068855_100151086 | 3300005563 | Bacteria | 2641 |
| 33 | Ga0068855_100286959 | 3300005563 | Bacteria | 1825 |
| 34 | Ga0068855_100415811 | 3300005563 | Bacteria | 1472 |
| 35 | Ga0070664_100312533 | 3300005564 | Bacteria | 1422 |
| 36 | Ga0068857_100070815 | 3300005577 | Bacteria | 3106 |
| 37 | Ga0068854_100002778 | 3300005578 | Bacteria | 10871 |
| 38 | Ga0068856_100022447 | 3300005614 | Bacteria | 6137 |
| 39 | Ga0068856_100192952 | 3300005614 | Bacteria | 2051 |
| 40 | Ga0068852_100017272 | 3300005616 | Bacteria | 5657 |
| 41 | Ga0068852_100034733 | 3300005616 | Bacteria | 4198 |
| 42 | Ga0068852_100217891 | 3300005616 | Bacteria | 1814 |
| 43 | Ga0068858_100137157 | 3300005842 | Bacteria | 2296 |
| 44 | Ga0075365_10040427 | 3300006038 | Bacteria | 3041 |
| 45 | Ga0075365_10068404 | 3300006038 | Bacteria | 2386 |
| 46 | Ga0075365_10079578 | 3300006038 | Bacteria | 2218 |
| 47 | Ga0075365_10283762 | 3300006038 | Bacteria | 1165 |
| 48 | Ga0075363_100223515 | 3300006048 | Bacteria | 1079 |
| 49 | Ga0075364_10007492 | 3300006051 | Bacteria | 6487 |
| 50 | Ga0075364_10153230 | 3300006051 | Bacteria | 1554 |
| 51 | Ga0075367_10024044 | 3300006178 | Bacteria | 3434 |
| 52 | Ga0075369_10052976 | 3300006186 | Bacteria | 1760 |
| 53 | Ga0075366_10238049 | 3300006195 | Bacteria | 1109 |
| 54 | Ga0075370_10155473 | 3300006353 | Bacteria | 1341 |
| 55 | Ga0099826_10164474 | 3300006948 | Bacteria | 1253 |
| 56 | Ga0105240_10088902 | 3300009093 | Bacteria | 3779 |
| 57 | Ga0105240_10346628 | 3300009093 | Bacteria | 1686 |
| 58 | Ga0105248_10892504 | 3300009177 | Bacteria | 1004 |
| 59 | Ga0105237_10000397 | 3300009545 | Bacteria | 61927 |
| 60 | Ga0105237_10278680 | 3300009545 | Bacteria | 1675 |
| 61 | Ga0105237_10359996 | 3300009545 | Bacteria | 1459 |
| 62 | Ga0105237_10518108 | 3300009545 | Bacteria | 1199 |
| 63 | Ga0105238_10019855 | 3300009551 | Bacteria | 6840 |
| 64 | Ga0105238_10030006 | 3300009551 | Bacteria | 5534 |
| 65 | Ga0105239_10052949 | 3300010375 | Bacteria | 4452 |
| 66 | Ga0105239_10076862 | 3300010375 | Bacteria | 3672 |
| 67 | Ga0105239_10106593 | 3300010375 | Bacteria | 3104 |
| 68 | Ga0105239_10109907 | 3300010375 | Bacteria | 3056 |
| 69 | Ga0105239_10222308 | 3300010375 | Bacteria | 2118 |
| 70 | Ga0105239_10367613 | 3300010375 | Bacteria | 1625 |
| 71 | Ga0157370_10280622 | 3300013104 | Bacteria | 1539 |
| 72 | Ga0171463_1012 | 3300013249 | Bacteria | 176554 |
| 73 | Ga0157374_10180164 | 3300013296 | Bacteria | 2064 |
| 74 | Ga0157374_10217214 | 3300013296 | Bacteria | 1875 |
| 75 | Ga0163162_10080508 | 3300013306 | Bacteria | 3325 |
| 76 | Ga0157372_10120621 | 3300013307 | Bacteria | 3011 |
| 77 | Ga0163163_10082008 | 3300014325 | Bacteria | 3228 |
| 78 | Ga0182008_10137889 | 3300014497 | Bacteria | 1219 |
| 79 | Ga0157376_10333966 | 3300014969 | Bacteria | 1445 |
| 80 | Ga0182007_10092218 | 3300015262 | Bacteria | 998 |
| 81 | Ga0183362_10104 | 3300015683 | Bacteria | 1298 |
| 82 | Ga0183363_1213 | 3300015690 | Bacteria | 11698 |
| 83 | Ga0214544_1000329 | 3300021320 | Bacteria | 82143 |
| 84 | Ga0214542_1000084 | 3300021321 | Bacteria | 120499 |
| 85 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 86 | Ga0214543_1000076 | 3300021327 | Bacteria | 120483 |
| 87 | Ga0228711_1017033 | 3300022739 | Bacteria | 7379 |
| 88 | Ga0228711_1041907 | 3300022739 | Bacteria | 1348 |
| 89 | Ga0228710_1000012 | 3300022740 | Bacteria | 148650 |
| 90 | Ga0228710_1041163 | 3300022740 | Bacteria | 1348 |
| 91 | Ga0209436_100100 | 3300025208 | Bacteria | 42446 |
| 92 | Ga0207427_101683 | 3300025231 | Bacteria | 7365 |
| 93 | Ga0209026_1000071 | 3300025250 | Bacteria | 205592 |
| 94 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 95 | Ga0209759_1000582 | 3300025256 | Bacteria | 35985 |
| 96 | Ga0209233_1000053 | 3300025261 | Bacteria | 444909 |
| 97 | Ga0209233_1000464 | 3300025261 | Bacteria | 25836 |
| 98 | Ga0209233_1016905 | 3300025261 | Bacteria | 2000 |
| 99 | Ga0209455_1000036 | 3300025272 | Bacteria | 473309 |
| 100 | Ga0209130_1000068 | 3300025284 | Bacteria | 179361 |
| 101 | Ga0209676_1000714 | 3300025292 | Bacteria | 45991 |
| 102 | Ga0209025_1000203 | 3300025294 | Bacteria | 145210 |
| 103 | Ga0209564_1000081 | 3300025295 | Bacteria | 261592 |
| 104 | Ga0209758_1004360 | 3300025297 | Bacteria | 11843 |
| 105 | Ga0209758_1011323 | 3300025297 | Bacteria | 5183 |
| 106 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 107 | Ga0209256_1000408 | 3300025299 | Bacteria | 67949 |
| 108 | Ga0209256_1003167 | 3300025299 | Bacteria | 11925 |
| 109 | Ga0207426_1000155 | 3300025302 | Bacteria | 179361 |
| 110 | Ga0209257_1000289 | 3300025304 | Bacteria | 110882 |
| 111 | Ga0209257_1003606 | 3300025304 | Bacteria | 13048 |
| 112 | Ga0209257_1050670 | 3300025304 | Bacteria | 1174 |
| 113 | Ga0207656_10000460 | 3300025321 | Bacteria | 13599 |
| 114 | Ga0207647_10051080 | 3300025904 | Bacteria | 2557 |
| 115 | Ga0207705_10058198 | 3300025909 | Bacteria | 2788 |
| 116 | Ga0207654_10373037 | 3300025911 | Bacteria | 987 |
| 117 | Ga0207695_10436641 | 3300025913 | Bacteria | 1193 |
| 118 | Ga0207671_10001048 | 3300025914 | Bacteria | 33586 |
| 119 | Ga0207671_10039958 | 3300025914 | Bacteria | 3473 |
| 120 | Ga0207671_10135456 | 3300025914 | Bacteria | 1893 |
| 121 | Ga0207657_10008791 | 3300025919 | Bacteria | 10217 |
| 122 | Ga0207657_10132679 | 3300025919 | Bacteria | 2040 |
| 123 | Ga0207649_10001747 | 3300025920 | Bacteria | 12467 |
| 124 | Ga0207649_10038006 | 3300025920 | Bacteria | 2912 |
| 125 | Ga0207694_10001897 | 3300025924 | Bacteria | 17328 |
| 126 | Ga0207694_10011497 | 3300025924 | Bacteria | 6681 |
| 127 | Ga0207694_10379962 | 3300025924 | Bacteria | 1172 |
| 128 | Ga0207706_10094448 | 3300025933 | Bacteria | 2630 |
| 129 | Ga0207669_10326270 | 3300025937 | Bacteria | 1177 |
| 130 | Ga0207691_10088256 | 3300025940 | Bacteria | 2781 |
| 131 | Ga0207661_10138819 | 3300025944 | Bacteria | 2090 |
| 132 | Ga0207679_10345298 | 3300025945 | Bacteria | 1296 |
| 133 | Ga0207667_10015265 | 3300025949 | Bacteria | 8734 |
| 134 | Ga0207667_10054777 | 3300025949 | Bacteria | 4195 |
| 135 | Ga0207667_10299471 | 3300025949 | Bacteria | 1643 |
| 136 | Ga0207640_10012439 | 3300025981 | Bacteria | 4846 |
| 137 | Ga0207658_10105126 | 3300025986 | Bacteria | 2220 |
| 138 | Ga0207677_10598329 | 3300026023 | Bacteria | 967 |
| 139 | Ga0207639_10000783 | 3300026041 | Bacteria | 21630 |
| 140 | Ga0207639_10001514 | 3300026041 | Bacteria | 15616 |
| 141 | Ga0207639_10461771 | 3300026041 | Bacteria | 1154 |
| 142 | Ga0207639_10626526 | 3300026041 | Bacteria | 994 |
| 143 | Ga0207639_10707195 | 3300026041 | Bacteria | 935 |
| 144 | Ga0207678_10180461 | 3300026067 | Bacteria | 1803 |
| 145 | Ga0207678_10220162 | 3300026067 | Bacteria | 1625 |
| 146 | Ga0207702_10084193 | 3300026078 | Bacteria | 2768 |
| 147 | Ga0207648_10082313 | 3300026089 | Bacteria | 2807 |
| 148 | Ga0207674_10006506 | 3300026116 | Bacteria | 13738 |
| 149 | Ga0207698_10014936 | 3300026142 | Bacteria | 5183 |
| 150 | Ga0207698_10096935 | 3300026142 | Bacteria | 2432 |
| 151 | Ga0207698_10120425 | 3300026142 | Bacteria | 2220 |
| 152 | Ga0209281_1000804 | 3300027111 | Bacteria | 28987 |
| 153 | Ga0209282_1000023 | 3300027666 | Bacteria | 173309 |
| 154 | Ga0268266_10000257 | 3300028379 | Bacteria | 89384 |
| 155 | Ga0268266_10022984 | 3300028379 | Bacteria | 5306 |
| 156 | Ga0268266_10288164 | 3300028379 | Bacteria | 1529 |
| 157 | Ga0265318_10063657 | 3300028577 | Bacteria | 1372 |
| 158 | Ga0265331_10005633 | 3300031250 | Bacteria | 7530 |
| 159 | Ga0265327_10014703 | 3300031251 | Bacteria | 5103 |
| 160 | Ga0307408_100254218 | 3300031548 | Bacteria | 1451 |
| 161 | Ga0307406_10037754 | 3300031901 | Bacteria | 2986 |
| 162 | Ga0307412_10225671 | 3300031911 | Bacteria | 1439 |
| 163 | Ga0315914_1013287 | 3300031967 | Bacteria | 9162 |
| 164 | Ga0315914_1013292 | 3300031967 | Bacteria | 9160 |
| 165 | Ga0307409_100352822 | 3300031995 | Bacteria | 1389 |
| 166 | Ga0307409_100406209 | 3300031995 | Bacteria | 1302 |
| 167 | Ga0307510_10316728 | 3300033180 | Bacteria | 1018 |
| 168 | Ga0315913_1036737 | 3300033430 | Bacteria | 2935 |
| 169 | Ga0315913_1036738 | 3300033430 | Bacteria | 2935 |
| 170 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 171 | Ga0315915_1034278 | 3300033464 | Bacteria | 2882 |
| 172 | Ga0373939_0196425 | 3300035114 | Bacteria | 761 |
| 173 | Ga0373931_0036897 | 3300035691 | Bacteria | 2550 |
| 174 | Ga0395900_0202832 | 3300037418 | Bacteria | 2006 |
| 175 | Ga0395900_0350130 | 3300037418 | Bacteria | 1451 |
| 176 | Ga0395905_0013235 | 3300037471 | Bacteria | 7916 |
| 177 | Ga0395905_0056745 | 3300037471 | Bacteria | 3663 |
| 178 | Ga0395905_0694065 | 3300037471 | Bacteria | 920 |
| 179 | Ga0395901_0018127 | 3300038443 | Bacteria | 7184 |
| 180 | Ga0395901_0099806 | 3300038443 | Bacteria | 3045 |
| 181 | Ga0395901_0586942 | 3300038443 | Bacteria | 1125 |
| 182 | Ga0436360_0974933 | 3300039438 | Bacteria | 708 |
| 183 | Ga0439436_0000581 | 3300041404 | Bacteria | 9663 |
| 184 | Ga0439438_055497 | 3300041405 | Bacteria | 999 |
| 185 | Ga0439439_0014083 | 3300041406 | Bacteria | 1944 |
| 186 | Ga0439466_0059554 | 3300041411 | Bacteria | 1233 |
| 187 | Ga0439465_0005706 | 3300041413 | Bacteria | 3962 |
| 188 | Ga0439449_0003383 | 3300042007 | Bacteria | 6217 |
| 189 | Ga0450920_012754 | 3300042122 | Bacteria | 1577 |
| 190 | Ga0439434_0092646 | 3300042435 | Bacteria | 968 |
| 191 | Ga0495638_0009326 | 3300046460 | Bacteria | 6898 |
| 192 | Ga0495610_0114850 | 3300046512 | Bacteria | 1188 |
| 193 | Ga0495620_0117049 | 3300046515 | Bacteria | 1053 |
| 194 | Ga0495643_0094224 | 3300046522 | Bacteria | 1541 |
| 195 | Ga0495668_0224615 | 3300046616 | Bacteria | 1028 |
| 196 | Ga0495625_0039222 | 3300046660 | Bacteria | 3460 |
| 197 | Ga0495671_0225112 | 3300046692 | Bacteria | 908 |
| 198 | Ga0495686_0027482 | 3300047472 | Bacteria | 3714 |
| 199 | Ga0496102_0362327 | 3300048905 | Bacteria | 1365 |
| 200 | Ga0496112_0094278 | 3300048915 | Bacteria | 2964 |
| 201 | Ga0496119_0090920 | 3300048922 | Bacteria | 1734 |
| 202 | Ga0496120_0005731 | 3300048923 | Bacteria | 9782 |
| 203 | Ga0496121_0218620 | 3300048924 | Bacteria | 1344 |
| 204 | Ga0496121_0232193 | 3300048924 | Bacteria | 1291 |
| 205 | Ga0496124_0251577 | 3300048927 | Bacteria | 1307 |
| 206 | Ga0496125_0244780 | 3300048928 | Bacteria | 1136 |
| 207 | Ga0496126_0442844 | 3300048929 | Bacteria | 1047 |
| 208 | Ga0501033_0036744 | 3300049570 | Bacteria | 3669 |
| 209 | Ga0501033_0507238 | 3300049570 | Bacteria | 834 |
| 210 | Ga0501034_0005801 | 3300049571 | Bacteria | 13429 |
| 211 | Ga0501034_0049631 | 3300049571 | Bacteria | 4234 |
| 212 | Ga0501034_0078983 | 3300049571 | Bacteria | 3294 |
| 213 | Ga0501034_0183729 | 3300049571 | Bacteria | 2055 |
| 214 | Ga0501034_0361118 | 3300049571 | Bacteria | 1379 |
| 215 | Ga0501038_0121062 | 3300049574 | Bacteria | 2158 |
| 216 | Ga0501043_0084734 | 3300049579 | Bacteria | 2491 |
| 217 | Ga0501043_0295910 | 3300049579 | Bacteria | 1238 |
| 218 | Ga0501047_0459206 | 3300049581 | Bacteria | 1102 |
| 219 | Ga0501070_0011617 | 3300049586 | Bacteria | 7434 |
| 220 | Ga0501080_0358009 | 3300049742 | Bacteria | 1317 |
| 221 | Ga0501035_0043939 | 3300049822 | Bacteria | 4025 |
| 222 | Ga0501035_0274524 | 3300049822 | Bacteria | 1426 |
| 223 | Ga0501044_0015619 | 3300049823 | Bacteria | 8178 |
| 224 | Ga0501044_0042134 | 3300049823 | Bacteria | 4751 |
| 225 | Ga0501044_0366182 | 3300049823 | Bacteria | 1359 |
| 226 | nmdc:mga03683_57156_c1 | 3300050489 | Bacteria | 1641 |
| 227 | nmdc:mga0yw44_104508_c1 | 3300050492 | Bacteria | 1808 |
| 228 | nmdc:mga0yw44_122426_c1 | 3300050492 | Bacteria | 1677 |
| 229 | nmdc:mga0yw44_160088_c1 | 3300050492 | Bacteria | 1473 |
| 230 | nmdc:mga0yw44_29108_c1 | 3300050492 | Bacteria | 1632 |
| 231 | nmdc:mga0yw44_6104_c1 | 3300050492 | Bacteria | 5783 |
| 232 | nmdc:mga07m45_7807_c1 | 3300050496 | Bacteria | 5474 |
| 233 | Ga0500610_0011018 | 3300053079 | Bacteria | 4097 |
| 234 | Ga0495655_0100423 | 3300053083 | Bacteria | 856 |
| 235 | Ga0500569_030265 | 3300053109 | Bacteria | 1514 |
| 236 | Ga0500658_0168271 | 3300053134 | Bacteria | 995 |
| 237 | Ga0500568_0129042 | 3300053139 | Bacteria | 940 |
| 238 | Ga0500604_0001955 | 3300053151 | Bacteria | 5721 |
| 239 | Ga0500616_0013418 | 3300053153 | Bacteria | 4758 |
| 240 | Ga0500620_001474 | 3300053155 | Bacteria | 4365 |
| 241 | Ga0500624_004721 | 3300053157 | Bacteria | 1801 |
| 242 | Ga0500627_0056621 | 3300053158 | Bacteria | 1718 |
| 243 | Ga0500627_0103758 | 3300053158 | Bacteria | 1277 |
| 244 | Ga0500634_0000014 | 3300053161 | Bacteria | 114625 |
| 245 | Ga0500634_0054545 | 3300053161 | Bacteria | 2141 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9626 | 1 | 258 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9589 | 1 | 258 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9587 | 1 | 258 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9545 | 1 | 258 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9514 | 1 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9688 | 1 | 258 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9614 | 1 | 258 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9533 | 1 | 258 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9461 | 1 | 258 | 3.60.10.10 |
| af_P96273_24_289_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.923 | 1 | 256 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436KS41-F1-model_v4 | deleted | 1.003 | 1 | 77 |
|
| AF-A0A349W2K4-F1-model_v4 | Exodeoxyribonuclease III | 1.001 | 1 | 69 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 |
| AF-A0A2W5ADH5-F1-model_v4 | Exodeoxyribonuclease III | 1 | 1 | 128 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A4Q2FJP5-F1-model_v4 | Exodeoxyribonuclease III | 0.9999 | 1 | 108 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 |
| AF-A0A3S1YX56-F1-model_v4 | deleted | 0.9996 | 1 | 106 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar