F478837

General Info

Members Datasets Scaffolds Average Seq Length
746 667 245 255

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10206150|Ga0065704_102061501
Length 261
Sequence VKIATWNVNSAKARLPLITDWLRAESPDVALLQEIKCETAAFPRAAFEDLGYHVTPVGQKSYNGVAFLSKALHEDVLTRLPGEPEDEQARYVEATVGGVRIASLYLPNGNPLGTEKFAYKLRWMDRLHAHARGLLAQEIPFVLGGDYNIIPEPRDVFDPAAFAGDALFQPESRAKFRALLNLGLTEAYRALHDDDHAYTFWDYQAGCWPRDLGLRIDHFLLSPQAADRLVECRIDRLPRGAEKASDHTPVLLDLCDGSDIS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
22 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
23 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
24 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
25 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
29 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
30 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
31 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
32 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
33 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
34 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
35 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
36 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
37 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
38 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
39 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
40 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
41 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
42 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
43 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
44 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
45 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
46 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
47 2643221557 Ensifer sp. Root558 Isolate Unclassified
48 2643221580 Devosia sp. Root635 Isolate Unclassified
49 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
50 2643221610 Ensifer sp. Root74 Isolate Unclassified
51 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
52 2643221629 Devosia sp. Root105 Isolate Unclassified
53 2643221662 Devosia sp. Root413D1 Isolate Unclassified
54 2643221668 Ensifer sp. Root423 Isolate Unclassified
55 2643221674 Devosia sp. Root436 Isolate Unclassified
56 2643221675 Ensifer sp. Root1298 Isolate Unclassified
57 2643221680 Ensifer sp. Root1312 Isolate Unclassified
58 2643221723 Ensifer sp. Root278 Isolate Unclassified
59 2643221726 Ensifer sp. Root954 Isolate Unclassified
60 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
61 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
62 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
63 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
64 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
65 2738543024 Aminobacter sp. AP02 Isolate Unclassified
66 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
67 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
68 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
69 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
70 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
71 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
72 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
73 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
74 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
75 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
76 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
77 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
78 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
79 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
80 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
81 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
82 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
83 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
84 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
85 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
86 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
87 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
88 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
89 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
90 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
91 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
92 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
93 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
94 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
95 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
96 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
97 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
98 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
99 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
100 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
101 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
102 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
103 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
104 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
105 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
106 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
107 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
108 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
109 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
110 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
111 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
112 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
113 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
114 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
115 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
116 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
117 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
118 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
119 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
120 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
121 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
122 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
123 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
124 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
125 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
126 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
127 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
128 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
129 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
130 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
131 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
132 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
133 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
134 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
135 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
136 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
137 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
138 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
139 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
140 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
141 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
142 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
143 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
144 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
145 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
146 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
147 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
148 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
149 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
150 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
151 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
152 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
153 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
154 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
155 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
156 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
157 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
158 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
159 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
160 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
161 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
162 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
163 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
164 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
165 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
166 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
167 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
168 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
169 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
170 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
171 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
172 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
173 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
174 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
175 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
176 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
177 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
178 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
179 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
180 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
181 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
182 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
183 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
184 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
185 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
186 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
187 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
188 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
189 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
190 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
191 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
192 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
193 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
194 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
195 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
196 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
197 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
198 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
199 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
200 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
201 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
202 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
203 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
204 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
205 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
206 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
207 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
208 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
209 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
210 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
211 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
212 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
213 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
214 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
215 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
216 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
217 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
218 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
219 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
220 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
221 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
222 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
223 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
224 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
225 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
226 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
227 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
228 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
229 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
230 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
231 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
232 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
233 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
234 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
235 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
236 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
237 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
238 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
239 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
240 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
241 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
242 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
243 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
244 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
245 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
246 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
247 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
248 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
249 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
250 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
251 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
252 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
253 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
254 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
255 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
256 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
257 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
258 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
259 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
260 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
261 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
262 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
263 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
264 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
265 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
266 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
267 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
268 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
269 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
270 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
271 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
272 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
273 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
274 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
275 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
276 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
277 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
278 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
279 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
280 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
281 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
282 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
283 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
284 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
285 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
286 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
287 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
288 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
289 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
290 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
291 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
292 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
293 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
294 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
295 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
296 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
297 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
298 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
299 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
300 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
301 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
302 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
303 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
304 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
305 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
306 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
307 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
308 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
309 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
310 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
311 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
312 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
313 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
314 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
315 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
316 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
317 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
318 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
319 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
320 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
321 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
322 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
323 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
324 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
325 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
326 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
327 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
328 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
329 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
330 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
331 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
332 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
333 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
334 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
335 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
336 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
337 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
338 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
339 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
340 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
341 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
342 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
343 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
344 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
345 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
346 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
347 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
348 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
349 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
350 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
351 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
352 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
353 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
354 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
355 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
356 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
357 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
358 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
359 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
360 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
361 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
362 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
363 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
364 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
365 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
366 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
367 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
368 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
369 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
370 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
371 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
372 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
373 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
374 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
375 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
376 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
377 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
378 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
379 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
380 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
381 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
382 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
383 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
384 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
385 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
386 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
387 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
388 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
389 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
390 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
391 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
392 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
393 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
394 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
395 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
396 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
397 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
398 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
399 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
400 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
401 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
402 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
403 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
404 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
405 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
406 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
407 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
408 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
409 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
410 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
411 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
412 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
413 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
414 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
415 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
416 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
417 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
418 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
419 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
420 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
421 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
422 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
423 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
424 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
425 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
426 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
427 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
428 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
429 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
430 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
431 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
432 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
433 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
434 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
435 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
436 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
437 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
438 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
439 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
440 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
441 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
442 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
443 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
444 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
445 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
446 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
447 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
448 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
449 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
450 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
451 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
452 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
453 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
454 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
455 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
456 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
457 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
458 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
459 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
460 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
461 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
462 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
463 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
464 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
465 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
466 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
467 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
468 3004167301 Mesorhizobium loti 582 Isolate Unclassified
469 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
470 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
471 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
472 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
473 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
474 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
475 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
476 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
477 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
478 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
479 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
480 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
481 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
482 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
483 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
484 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
485 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
486 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
487 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
488 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
489 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
490 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
491 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
492 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
493 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
494 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
495 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
496 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
497 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
498 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
499 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
500 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
501 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
502 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
503 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
504 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
505 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
506 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
507 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
508 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
509 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
510 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
511 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
512 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
513 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
514 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
515 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
516 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
517 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
518 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
519 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
520 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
521 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
522 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
523 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
524 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
525 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
526 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
527 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
528 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
529 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
530 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
531 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
532 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
533 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
534 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
535 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
536 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
537 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
538 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
539 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
540 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
541 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
542 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
543 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
545 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
546 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
548 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
549 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
550 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
551 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
552 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
554 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
555 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
574 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
581 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
582 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
584 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
585 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
586 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
587 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
588 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
589 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
590 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
591 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
592 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
593 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
594 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
595 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
596 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
597 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
598 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
599 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
600 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
601 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
602 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
603 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
604 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
605 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
606 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
607 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
608 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
609 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
610 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
611 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
612 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
613 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
614 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
615 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
616 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
617 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
618 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
619 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
620 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
621 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
622 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
623 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
624 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
630 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
631 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
633 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
634 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
635 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
636 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
637 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
638 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
639 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
640 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
641 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
642 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
643 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
644 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
645 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
646 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
647 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
648 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
649 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
650 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
651 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
652 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
653 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
654 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
655 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
656 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
657 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
658 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
659 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
660 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
661 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
662 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
663 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
664 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
665 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
666 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
667 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.84
Metatranscriptomes 0
Isolates 67.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.45
Nodule 61.39
Rhizoplane 0.54
Rhizosphere 20.91
Stem 0
Stem Tuber 0
Unclassified 8.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1010079 3300002705 Bacteria 2245
2 JGI25157J39369_1001218 3300002741 Bacteria 10695
3 JGI25159J45721_1000009 3300002987 Bacteria 168868
4 JGI25151J46595_10003794 3300003187 Bacteria 8193
5 JGI25165J46597_1005549 3300003214 Bacteria 2408
6 JGI25153J46596_10012743 3300003215 Bacteria 3603
7 rootH2_10006208 3300003320 Bacteria 13872
8 JGI25160J50197_1000028 3300003354 Bacteria 179309
9 JGI25161J50226_1000332 3300003374 Bacteria 25529
10 Ga0055526_1017685 3300003771 Bacteria 2709
11 Ga0055524_1000885 3300003775 Bacteria 19543
12 Ga0055531_10008787 3300003794 Bacteria 5267
13 Ga0055531_10021851 3300003794 Bacteria 2463
14 Ga0055543_1000230 3300004625 Bacteria 44357
15 Ga0065165_1000061 3300005262 Bacteria 179347
16 Ga0065165_1000941 3300005262 Bacteria 37145
17 Ga0065704_10206150 3300005289 Bacteria 1126
18 Ga0070658_10023460 3300005327 Bacteria 4951
19 Ga0070676_10069510 3300005328 Bacteria 2110
20 Ga0070682_100306775 3300005337 Bacteria 1167
21 Ga0068868_100058510 3300005338 Bacteria 3046
22 Ga0070660_100004051 3300005339 Bacteria 10110
23 Ga0070661_100002761 3300005344 Bacteria 12042
24 Ga0070667_100118611 3300005367 Bacteria 2300
25 Ga0068853_100000687 3300005539 Bacteria 23331
26 Ga0068853_100036462 3300005539 Bacteria 4182
27 Ga0068853_100346826 3300005539 Bacteria 1380
28 Ga0070665_100060885 3300005548 Bacteria 3784
29 Ga0070665_100276020 3300005548 Bacteria 1683
30 Ga0070665_100395962 3300005548 Bacteria 1389
31 Ga0068855_100127298 3300005563 Bacteria 2911
32 Ga0068855_100151086 3300005563 Bacteria 2641
33 Ga0068855_100286959 3300005563 Bacteria 1825
34 Ga0068855_100415811 3300005563 Bacteria 1472
35 Ga0070664_100312533 3300005564 Bacteria 1422
36 Ga0068857_100070815 3300005577 Bacteria 3106
37 Ga0068854_100002778 3300005578 Bacteria 10871
38 Ga0068856_100022447 3300005614 Bacteria 6137
39 Ga0068856_100192952 3300005614 Bacteria 2051
40 Ga0068852_100017272 3300005616 Bacteria 5657
41 Ga0068852_100034733 3300005616 Bacteria 4198
42 Ga0068852_100217891 3300005616 Bacteria 1814
43 Ga0068858_100137157 3300005842 Bacteria 2296
44 Ga0075365_10040427 3300006038 Bacteria 3041
45 Ga0075365_10068404 3300006038 Bacteria 2386
46 Ga0075365_10079578 3300006038 Bacteria 2218
47 Ga0075365_10283762 3300006038 Bacteria 1165
48 Ga0075363_100223515 3300006048 Bacteria 1079
49 Ga0075364_10007492 3300006051 Bacteria 6487
50 Ga0075364_10153230 3300006051 Bacteria 1554
51 Ga0075367_10024044 3300006178 Bacteria 3434
52 Ga0075369_10052976 3300006186 Bacteria 1760
53 Ga0075366_10238049 3300006195 Bacteria 1109
54 Ga0075370_10155473 3300006353 Bacteria 1341
55 Ga0099826_10164474 3300006948 Bacteria 1253
56 Ga0105240_10088902 3300009093 Bacteria 3779
57 Ga0105240_10346628 3300009093 Bacteria 1686
58 Ga0105248_10892504 3300009177 Bacteria 1004
59 Ga0105237_10000397 3300009545 Bacteria 61927
60 Ga0105237_10278680 3300009545 Bacteria 1675
61 Ga0105237_10359996 3300009545 Bacteria 1459
62 Ga0105237_10518108 3300009545 Bacteria 1199
63 Ga0105238_10019855 3300009551 Bacteria 6840
64 Ga0105238_10030006 3300009551 Bacteria 5534
65 Ga0105239_10052949 3300010375 Bacteria 4452
66 Ga0105239_10076862 3300010375 Bacteria 3672
67 Ga0105239_10106593 3300010375 Bacteria 3104
68 Ga0105239_10109907 3300010375 Bacteria 3056
69 Ga0105239_10222308 3300010375 Bacteria 2118
70 Ga0105239_10367613 3300010375 Bacteria 1625
71 Ga0157370_10280622 3300013104 Bacteria 1539
72 Ga0171463_1012 3300013249 Bacteria 176554
73 Ga0157374_10180164 3300013296 Bacteria 2064
74 Ga0157374_10217214 3300013296 Bacteria 1875
75 Ga0163162_10080508 3300013306 Bacteria 3325
76 Ga0157372_10120621 3300013307 Bacteria 3011
77 Ga0163163_10082008 3300014325 Bacteria 3228
78 Ga0182008_10137889 3300014497 Bacteria 1219
79 Ga0157376_10333966 3300014969 Bacteria 1445
80 Ga0182007_10092218 3300015262 Bacteria 998
81 Ga0183362_10104 3300015683 Bacteria 1298
82 Ga0183363_1213 3300015690 Bacteria 11698
83 Ga0214544_1000329 3300021320 Bacteria 82143
84 Ga0214542_1000084 3300021321 Bacteria 120499
85 Ga0214543_1000005 3300021327 Bacteria 454523
86 Ga0214543_1000076 3300021327 Bacteria 120483
87 Ga0228711_1017033 3300022739 Bacteria 7379
88 Ga0228711_1041907 3300022739 Bacteria 1348
89 Ga0228710_1000012 3300022740 Bacteria 148650
90 Ga0228710_1041163 3300022740 Bacteria 1348
91 Ga0209436_100100 3300025208 Bacteria 42446
92 Ga0207427_101683 3300025231 Bacteria 7365
93 Ga0209026_1000071 3300025250 Bacteria 205592
94 Ga0209148_1000037 3300025254 Bacteria 494767
95 Ga0209759_1000582 3300025256 Bacteria 35985
96 Ga0209233_1000053 3300025261 Bacteria 444909
97 Ga0209233_1000464 3300025261 Bacteria 25836
98 Ga0209233_1016905 3300025261 Bacteria 2000
99 Ga0209455_1000036 3300025272 Bacteria 473309
100 Ga0209130_1000068 3300025284 Bacteria 179361
101 Ga0209676_1000714 3300025292 Bacteria 45991
102 Ga0209025_1000203 3300025294 Bacteria 145210
103 Ga0209564_1000081 3300025295 Bacteria 261592
104 Ga0209758_1004360 3300025297 Bacteria 11843
105 Ga0209758_1011323 3300025297 Bacteria 5183
106 Ga0209050_1000053 3300025298 Bacteria 349521
107 Ga0209256_1000408 3300025299 Bacteria 67949
108 Ga0209256_1003167 3300025299 Bacteria 11925
109 Ga0207426_1000155 3300025302 Bacteria 179361
110 Ga0209257_1000289 3300025304 Bacteria 110882
111 Ga0209257_1003606 3300025304 Bacteria 13048
112 Ga0209257_1050670 3300025304 Bacteria 1174
113 Ga0207656_10000460 3300025321 Bacteria 13599
114 Ga0207647_10051080 3300025904 Bacteria 2557
115 Ga0207705_10058198 3300025909 Bacteria 2788
116 Ga0207654_10373037 3300025911 Bacteria 987
117 Ga0207695_10436641 3300025913 Bacteria 1193
118 Ga0207671_10001048 3300025914 Bacteria 33586
119 Ga0207671_10039958 3300025914 Bacteria 3473
120 Ga0207671_10135456 3300025914 Bacteria 1893
121 Ga0207657_10008791 3300025919 Bacteria 10217
122 Ga0207657_10132679 3300025919 Bacteria 2040
123 Ga0207649_10001747 3300025920 Bacteria 12467
124 Ga0207649_10038006 3300025920 Bacteria 2912
125 Ga0207694_10001897 3300025924 Bacteria 17328
126 Ga0207694_10011497 3300025924 Bacteria 6681
127 Ga0207694_10379962 3300025924 Bacteria 1172
128 Ga0207706_10094448 3300025933 Bacteria 2630
129 Ga0207669_10326270 3300025937 Bacteria 1177
130 Ga0207691_10088256 3300025940 Bacteria 2781
131 Ga0207661_10138819 3300025944 Bacteria 2090
132 Ga0207679_10345298 3300025945 Bacteria 1296
133 Ga0207667_10015265 3300025949 Bacteria 8734
134 Ga0207667_10054777 3300025949 Bacteria 4195
135 Ga0207667_10299471 3300025949 Bacteria 1643
136 Ga0207640_10012439 3300025981 Bacteria 4846
137 Ga0207658_10105126 3300025986 Bacteria 2220
138 Ga0207677_10598329 3300026023 Bacteria 967
139 Ga0207639_10000783 3300026041 Bacteria 21630
140 Ga0207639_10001514 3300026041 Bacteria 15616
141 Ga0207639_10461771 3300026041 Bacteria 1154
142 Ga0207639_10626526 3300026041 Bacteria 994
143 Ga0207639_10707195 3300026041 Bacteria 935
144 Ga0207678_10180461 3300026067 Bacteria 1803
145 Ga0207678_10220162 3300026067 Bacteria 1625
146 Ga0207702_10084193 3300026078 Bacteria 2768
147 Ga0207648_10082313 3300026089 Bacteria 2807
148 Ga0207674_10006506 3300026116 Bacteria 13738
149 Ga0207698_10014936 3300026142 Bacteria 5183
150 Ga0207698_10096935 3300026142 Bacteria 2432
151 Ga0207698_10120425 3300026142 Bacteria 2220
152 Ga0209281_1000804 3300027111 Bacteria 28987
153 Ga0209282_1000023 3300027666 Bacteria 173309
154 Ga0268266_10000257 3300028379 Bacteria 89384
155 Ga0268266_10022984 3300028379 Bacteria 5306
156 Ga0268266_10288164 3300028379 Bacteria 1529
157 Ga0265318_10063657 3300028577 Bacteria 1372
158 Ga0265331_10005633 3300031250 Bacteria 7530
159 Ga0265327_10014703 3300031251 Bacteria 5103
160 Ga0307408_100254218 3300031548 Bacteria 1451
161 Ga0307406_10037754 3300031901 Bacteria 2986
162 Ga0307412_10225671 3300031911 Bacteria 1439
163 Ga0315914_1013287 3300031967 Bacteria 9162
164 Ga0315914_1013292 3300031967 Bacteria 9160
165 Ga0307409_100352822 3300031995 Bacteria 1389
166 Ga0307409_100406209 3300031995 Bacteria 1302
167 Ga0307510_10316728 3300033180 Bacteria 1018
168 Ga0315913_1036737 3300033430 Bacteria 2935
169 Ga0315913_1036738 3300033430 Bacteria 2935
170 Ga0315915_1000007 3300033464 Bacteria 319225
171 Ga0315915_1034278 3300033464 Bacteria 2882
172 Ga0373939_0196425 3300035114 Bacteria 761
173 Ga0373931_0036897 3300035691 Bacteria 2550
174 Ga0395900_0202832 3300037418 Bacteria 2006
175 Ga0395900_0350130 3300037418 Bacteria 1451
176 Ga0395905_0013235 3300037471 Bacteria 7916
177 Ga0395905_0056745 3300037471 Bacteria 3663
178 Ga0395905_0694065 3300037471 Bacteria 920
179 Ga0395901_0018127 3300038443 Bacteria 7184
180 Ga0395901_0099806 3300038443 Bacteria 3045
181 Ga0395901_0586942 3300038443 Bacteria 1125
182 Ga0436360_0974933 3300039438 Bacteria 708
183 Ga0439436_0000581 3300041404 Bacteria 9663
184 Ga0439438_055497 3300041405 Bacteria 999
185 Ga0439439_0014083 3300041406 Bacteria 1944
186 Ga0439466_0059554 3300041411 Bacteria 1233
187 Ga0439465_0005706 3300041413 Bacteria 3962
188 Ga0439449_0003383 3300042007 Bacteria 6217
189 Ga0450920_012754 3300042122 Bacteria 1577
190 Ga0439434_0092646 3300042435 Bacteria 968
191 Ga0495638_0009326 3300046460 Bacteria 6898
192 Ga0495610_0114850 3300046512 Bacteria 1188
193 Ga0495620_0117049 3300046515 Bacteria 1053
194 Ga0495643_0094224 3300046522 Bacteria 1541
195 Ga0495668_0224615 3300046616 Bacteria 1028
196 Ga0495625_0039222 3300046660 Bacteria 3460
197 Ga0495671_0225112 3300046692 Bacteria 908
198 Ga0495686_0027482 3300047472 Bacteria 3714
199 Ga0496102_0362327 3300048905 Bacteria 1365
200 Ga0496112_0094278 3300048915 Bacteria 2964
201 Ga0496119_0090920 3300048922 Bacteria 1734
202 Ga0496120_0005731 3300048923 Bacteria 9782
203 Ga0496121_0218620 3300048924 Bacteria 1344
204 Ga0496121_0232193 3300048924 Bacteria 1291
205 Ga0496124_0251577 3300048927 Bacteria 1307
206 Ga0496125_0244780 3300048928 Bacteria 1136
207 Ga0496126_0442844 3300048929 Bacteria 1047
208 Ga0501033_0036744 3300049570 Bacteria 3669
209 Ga0501033_0507238 3300049570 Bacteria 834
210 Ga0501034_0005801 3300049571 Bacteria 13429
211 Ga0501034_0049631 3300049571 Bacteria 4234
212 Ga0501034_0078983 3300049571 Bacteria 3294
213 Ga0501034_0183729 3300049571 Bacteria 2055
214 Ga0501034_0361118 3300049571 Bacteria 1379
215 Ga0501038_0121062 3300049574 Bacteria 2158
216 Ga0501043_0084734 3300049579 Bacteria 2491
217 Ga0501043_0295910 3300049579 Bacteria 1238
218 Ga0501047_0459206 3300049581 Bacteria 1102
219 Ga0501070_0011617 3300049586 Bacteria 7434
220 Ga0501080_0358009 3300049742 Bacteria 1317
221 Ga0501035_0043939 3300049822 Bacteria 4025
222 Ga0501035_0274524 3300049822 Bacteria 1426
223 Ga0501044_0015619 3300049823 Bacteria 8178
224 Ga0501044_0042134 3300049823 Bacteria 4751
225 Ga0501044_0366182 3300049823 Bacteria 1359
226 nmdc:mga03683_57156_c1 3300050489 Bacteria 1641
227 nmdc:mga0yw44_104508_c1 3300050492 Bacteria 1808
228 nmdc:mga0yw44_122426_c1 3300050492 Bacteria 1677
229 nmdc:mga0yw44_160088_c1 3300050492 Bacteria 1473
230 nmdc:mga0yw44_29108_c1 3300050492 Bacteria 1632
231 nmdc:mga0yw44_6104_c1 3300050492 Bacteria 5783
232 nmdc:mga07m45_7807_c1 3300050496 Bacteria 5474
233 Ga0500610_0011018 3300053079 Bacteria 4097
234 Ga0495655_0100423 3300053083 Bacteria 856
235 Ga0500569_030265 3300053109 Bacteria 1514
236 Ga0500658_0168271 3300053134 Bacteria 995
237 Ga0500568_0129042 3300053139 Bacteria 940
238 Ga0500604_0001955 3300053151 Bacteria 5721
239 Ga0500616_0013418 3300053153 Bacteria 4758
240 Ga0500620_001474 3300053155 Bacteria 4365
241 Ga0500624_004721 3300053157 Bacteria 1801
242 Ga0500627_0056621 3300053158 Bacteria 1718
243 Ga0500627_0103758 3300053158 Bacteria 1277
244 Ga0500634_0000014 3300053161 Bacteria 114625
245 Ga0500634_0054545 3300053161 Bacteria 2141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100118611 Ga0070667_1001186113 220
2 3300025986 Ga0207658_10105126 Ga0207658_101051262 220
3 3300053083 Ga0495655_0100423 Ga0495655_0100423_126_806 226
4 3300039438 Ga0436360_0974933 Ga0436360_0974933_13_696 227
5 3300035114 Ga0373939_0196425 Ga0373939_0196425_10_696 228
6 3300003320 rootH2_10006208 rootH2_100062082 239
7 3300053157 Ga0500624_004721 Ga0500624_004721_452_1171 239
8 3300053161 Ga0500634_0000014 Ga0500634_0000014_47151_47870 239
9 3300053161 Ga0500634_0054545 Ga0500634_0054545_1332_2051 239
10 3300026067 Ga0207678_10220162 Ga0207678_102201622 242
11 3300031250 Ga0265331_10005633 Ga0265331_100056334 243
12 3300005563 Ga0068855_100286959 Ga0068855_1002869592 244
13 3300025924 Ga0207694_10379962 Ga0207694_103799622 244
14 3300026142 Ga0207698_10096935 Ga0207698_100969353 244
15 3300053158 Ga0500627_0056621 Ga0500627_0056621_779_1549 249
16 3300005548 Ga0070665_100060885 Ga0070665_1000608853 250
17 3300028379 Ga0268266_10022984 Ga0268266_100229844 250
18 iso_pu_bacteria 2503198000 2503201217 252
19 iso_pu_bacteria 2508501123 2509116190 252
20 iso_pu_bacteria 2508501127 2509145375 252
21 iso_pu_bacteria 2509276018 2509368145 252
22 iso_pu_bacteria 2509276022 2509395974 252
23 iso_pu_bacteria 2510065059 2510315811 252
24 iso_pu_bacteria 2512875016 2512931846 252
25 iso_pu_bacteria 2512875024 2512959771 252
26 iso_pu_bacteria 2513237164 2514036185 252
27 iso_pu_bacteria 2513237305 2514422239 252
28 iso_pu_bacteria 2588253730 2588517712 252
29 iso_pu_bacteria 2597490356 2599106260 252
30 iso_pu_bacteria 2643221595 2643984137 252
31 iso_pu_bacteria 2643221627 2644156758 252
32 iso_pu_bacteria 2687453392 2688598128 252
33 iso_pu_bacteria 2721755686 2723577044 252
34 iso_pu_bacteria 2738543024 2739305959 252
35 iso_pu_bacteria 2756170246 2756672244 252
36 iso_pu_bacteria 2841734538 2841738968 252
37 iso_pu_bacteria 2844002411 2844007804 252
38 iso_pu_bacteria 2844009547 2844013354 252
39 iso_pu_bacteria 2846952575 2846956058 252
40 iso_pu_bacteria 2847670302 2847671420 252
41 iso_pu_bacteria 2848858292 2848861689 252
42 iso_pu_bacteria 2856314179 2856315413 252
43 iso_pu_bacteria 2856320880 2856327015 252
44 iso_pu_bacteria 2856328259 2856333841 252
45 iso_pu_bacteria 2856334872 2856340949 252
46 iso_pu_bacteria 2856342000 2856346175 252
47 iso_pu_bacteria 2857367948 2857368490 252
48 iso_pu_bacteria 2869169390 2869176550 252
49 iso_pu_bacteria 2869234852 2869240964 252
50 iso_pu_bacteria 2869242130 2869248467 252
51 iso_pu_bacteria 2869249662 2869250310 252
52 iso_pu_bacteria 2869256925 2869259878 252
53 iso_pu_bacteria 2869264136 2869265525 252
54 iso_pu_bacteria 2869271264 2869276389 252
55 iso_pu_bacteria 2869278585 2869283437 252
56 iso_pu_bacteria 2871435913 2871439431 252
57 iso_pu_bacteria 2871451962 2871453282 252
58 iso_pu_bacteria 2871459585 2871459712 252
59 iso_pu_bacteria 2871466892 2871467628 252
60 iso_pu_bacteria 2871474448 2871475121 252
61 iso_pu_bacteria 2871481445 2871486980 252
62 iso_pu_bacteria 2874109183 2874116580 252
63 iso_pu_bacteria 2874116593 2874121982 252
64 iso_pu_bacteria 2874123672 2874129418 252
65 iso_pu_bacteria 2874131515 2874137475 252
66 iso_pu_bacteria 2874139085 2874143873 252
67 iso_pu_bacteria 2874162495 2874166339 252
68 iso_pu_bacteria 2874168670 2874169468 252
69 iso_pu_bacteria 2876363079 2876368832 252
70 iso_pu_bacteria 2876386047 2876390827 252
71 iso_pu_bacteria 2876399893 2876406650 252
72 iso_pu_bacteria 2876406927 2876412461 252
73 iso_pu_bacteria 2876420981 2876426940 252
74 iso_pu_bacteria 2878035449 2878036524 252
75 iso_pu_bacteria 2878730984 2878736929 252
76 iso_pu_bacteria 2878738818 2878744872 252
77 iso_pu_bacteria 2878774303 2878775504 252
78 iso_pu_bacteria 2878781027 2878781795 252
79 iso_pu_bacteria 2878788777 2878796821 252
80 iso_pu_bacteria 2882632389 2882633780 252
81 iso_pu_bacteria 2888337043 2888339083 252
82 iso_pu_bacteria 2888343758 2888345671 252
83 iso_pu_bacteria 2903448605 2903450939 252
84 iso_pu_bacteria 2903513507 2903518446 252
85 iso_pu_bacteria 2903521522 2903527830 252
86 iso_pu_bacteria 2903528002 2903529421 252
87 iso_pu_bacteria 2906363423 2906369956 252
88 iso_pu_bacteria 2906370794 2906372565 252
89 iso_pu_bacteria 2906378014 2906384704 252
90 iso_pu_bacteria 2906386501 2906390015 252
91 iso_pu_bacteria 2906393657 2906397624 252
92 iso_pu_bacteria 2906401398 2906403810 252
93 iso_pu_bacteria 2906408224 2906413771 252
94 iso_pu_bacteria 2906414383 2906415408 252
95 iso_pu_bacteria 2906427513 2906433725 252
96 iso_pu_bacteria 2922151315 2922155568 252
97 iso_pu_bacteria 2922172374 2922178049 252
98 iso_pu_bacteria 2922178524 2922178678 252
99 iso_pu_bacteria 2924733363 2924737186 252
100 iso_pu_bacteria 2924741084 2924743911 252
101 iso_pu_bacteria 2924748358 2924753499 252
102 iso_pu_bacteria 2924754689 2924758475 252
103 iso_pu_bacteria 2924762789 2924765963 252
104 iso_pu_bacteria 2924776078 2924783009 252
105 iso_pu_bacteria 2937822353 2937823347 252
106 iso_pu_bacteria 2937836603 2937843024 252
107 iso_pu_bacteria 2937848649 2937849202 252
108 iso_pu_bacteria 2937861824 2937863269 252
109 iso_pu_bacteria 2937868953 2937876629 252
110 iso_pu_bacteria 2937877337 2937884046 252
111 iso_pu_bacteria 2937972304 2937975847 252
112 iso_pu_bacteria 2937980651 2937986614 252
113 iso_pu_bacteria 2958034702 2958039950 252
114 iso_pu_bacteria 2958041894 2958054294 252
115 iso_pu_bacteria 2958064165 2958069179 252
116 iso_pu_bacteria 2958071322 2958072158 252
117 iso_pu_bacteria 2958084443 2958091357 252
118 iso_pu_bacteria 2958108152 2958109664 252
119 iso_pu_bacteria 2958122699 2958122921 252
120 iso_pu_bacteria 2958144490 2958149485 252
121 iso_pu_bacteria 2958158011 2958162880 252
122 iso_pu_bacteria 2961136820 2961139709 252
123 iso_pu_bacteria 2961183825 2961188851 252
124 iso_pu_bacteria 2963644680 2963647363 252
125 iso_pu_bacteria 2965025482 2965028403 252
126 iso_pu_bacteria 2965032056 2965040079 252
127 iso_pu_bacteria 2965040258 2965042477 252
128 iso_pu_bacteria 2965047637 2965052316 252
129 iso_pu_bacteria 2965089291 2965090803 252
130 iso_pu_bacteria 2965102966 2965107319 252
131 iso_pu_bacteria 2965110997 2965119328 252
132 iso_pu_bacteria 2968016561 2968018797 252
133 iso_pu_bacteria 2968083720 2968087805 252
134 iso_pu_bacteria 2968138860 2968141960 252
135 iso_pu_bacteria 2970469710 2970471030 252
136 iso_pu_bacteria 2970489779 2970493198 252
137 iso_pu_bacteria 2970510686 2970518161 252
138 iso_pu_bacteria 2970524798 2970528394 252
139 iso_pu_bacteria 2970532167 2970536229 252
140 iso_pu_bacteria 2970547951 2970553116 252
141 iso_pu_bacteria 2970593180 2970598137 252
142 iso_pu_bacteria 2970619444 2970620290 252
143 iso_pu_bacteria 2970627176 2970632883 252
144 iso_pu_bacteria 2977851361 2977852321 252
145 iso_pu_bacteria 2977872689 2977877575 252
146 iso_pu_bacteria 2977907340 2977910651 252
147 iso_pu_bacteria 2977915119 2977919331 252
148 iso_pu_bacteria 2977922695 2977922719 252
149 iso_pu_bacteria 2977935797 2977939686 252
150 iso_pu_bacteria 2977950692 2977955130 252
151 iso_pu_bacteria 2977957713 2977959717 252
152 iso_pu_bacteria 2977986579 2977988740 252
153 iso_pu_bacteria 2979764755 2979767052 252
154 iso_pu_bacteria 2979772303 2979777678 252
155 iso_pu_bacteria 2979793036 2979797239 252
156 iso_pu_bacteria 2987645492 2987646291 252
157 iso_pu_bacteria 2987666974 2987668520 252
158 iso_pu_bacteria 2987673487 2987678290 252
159 iso_pu_bacteria 2996348954 2996349654 252
160 iso_pu_bacteria 2996386984 2996389007 252
161 iso_pu_bacteria 3000135777 3000136413 252
162 iso_pu_bacteria 3004167301 3004168476 252
163 iso_pu_bacteria 3004195979 3004203794 252
164 iso_pu_bacteria 3004211236 3004212041 252
165 iso_pu_bacteria 3004218560 3004224706 252
166 iso_pu_bacteria 3004232784 3004239589 252
167 iso_pu_bacteria 3004239961 3004240755 252
168 iso_pu_bacteria 3004248173 3004249432 252
169 iso_pu_bacteria 3004268573 3004272880 252
170 iso_pu_bacteria 3004275668 3004276360 252
171 iso_pu_bacteria 3004334049 3004334871 252
172 iso_pu_bacteria 637000159 637074951 252
173 iso_pu_bacteria 649633066 649872666 252
174 iso_pu_bacteria 8004300914 8004305323 252
175 iso_pu_bacteria 8004312739 8004316796 252
176 iso_pu_bacteria 8004361976 8004363371 252
177 iso_pu_bacteria 8004395343 8004395372 252
178 iso_pu_bacteria 8004633249 8004637098 252
179 iso_pu_bacteria 8004695233 8004695787 252
180 iso_pu_bacteria 8004727605 8004732446 252
181 iso_pu_bacteria 8055617313 8055620563 252
182 iso_pu_bacteria 2510065057 2510305706 253
183 iso_pu_bacteria 2511231052 2511497542 253
184 iso_pu_bacteria 2512047086 2512529985 253
185 iso_pu_bacteria 2512875026 2512969774 253
186 iso_pu_bacteria 2513237086 2513581855 253
187 iso_pu_bacteria 2513237089 2513603070 253
188 iso_pu_bacteria 2513237090 2513609468 253
189 iso_pu_bacteria 2513237091 2513615333 253
190 iso_pu_bacteria 2513237140 2513884585 253
191 iso_pu_bacteria 2513237143 2513901417 253
192 iso_pu_bacteria 2513237156 2513985858 253
193 iso_pu_bacteria 2513237160 2514004559 253
194 iso_pu_bacteria 2515154107 2515609827 253
195 iso_pu_bacteria 2516143018 2516207767 253
196 iso_pu_bacteria 2516653046 2516896805 253
197 iso_pu_bacteria 2517487022 2517565347 253
198 iso_pu_bacteria 2524023207 2524451418 253
199 iso_pu_bacteria 2551306084 2551675520 253
200 iso_pu_bacteria 2551306085 2551688406 253
201 iso_pu_bacteria 2551306086 2551697014 253
202 iso_pu_bacteria 2551306087 2551697556 253
203 iso_pu_bacteria 2551306089 2551711816 253
204 iso_pu_bacteria 2551306090 2551720369 253
205 iso_pu_bacteria 2551306091 2551727181 253
206 iso_pu_bacteria 2551306092 2551733971 253
207 iso_pu_bacteria 2551306093 2551744826 253
208 iso_pu_bacteria 2582581866 2585395659 253
209 iso_pu_bacteria 2599185352 2600197641 253
210 iso_pu_bacteria 2643221557 2643809227 253
211 iso_pu_bacteria 2643221580 2643911846 253
212 iso_pu_bacteria 2643221610 2644064371 253
213 iso_pu_bacteria 2643221629 2644167953 253
214 iso_pu_bacteria 2643221662 2644348648 253
215 iso_pu_bacteria 2643221668 2644378821 253
216 iso_pu_bacteria 2643221674 2644412437 253
217 iso_pu_bacteria 2643221675 2644416203 253
218 iso_pu_bacteria 2643221680 2644449243 253
219 iso_pu_bacteria 2643221723 2644672178 253
220 iso_pu_bacteria 2643221726 2644688467 253
221 iso_pu_bacteria 2690316117 2692319301 253
222 iso_pu_bacteria 2693429783 2694629362 253
223 iso_pu_bacteria 2693429784 2694635406 253
224 iso_pu_bacteria 2751185821 2753458972 253
225 iso_pu_bacteria 2791355082 2792584678 253
226 iso_pu_bacteria 2791355091 2792621492 253
227 iso_pu_bacteria 2791355092 2792627820 253
228 iso_pu_bacteria 2791355123 2792752427 253
229 iso_pu_bacteria 2802428858 2802716200 253
230 iso_pu_bacteria 2802428859 2802722762 253
231 iso_pu_bacteria 2802428860 2802729093 253
232 iso_pu_bacteria 2802428861 2802735487 253
233 iso_pu_bacteria 2802428862 2802741937 253
234 iso_pu_bacteria 2802428863 2802748387 253
235 iso_pu_bacteria 2838074704 2838075676 253
236 iso_pu_bacteria 2838661181 2838664657 253
237 iso_pu_bacteria 2847417321 2847422192 253
238 iso_pu_bacteria 2848992105 2848998309 253
239 iso_pu_bacteria 2850079185 2850085371 253
240 iso_pu_bacteria 2855825444 2855828374 253
241 iso_pu_bacteria 2855839649 2855843485 253
242 iso_pu_bacteria 2855872281 2855875635 253
243 iso_pu_bacteria 2856356410 2856363755 253
244 iso_pu_bacteria 2856364286 2856370344 253
245 iso_pu_bacteria 2857349434 2857356312 253
246 iso_pu_bacteria 2858800743 2858806247 253
247 iso_pu_bacteria 2869162929 2869167883 253
248 iso_pu_bacteria 2869285874 2869291929 253
249 iso_pu_bacteria 2871429161 2871435138 253
250 iso_pu_bacteria 2871488783 2871492034 253
251 iso_pu_bacteria 2874146452 2874149530 253
252 iso_pu_bacteria 2874155637 2874157792 253
253 iso_pu_bacteria 2876413966 2876415996 253
254 iso_pu_bacteria 2878745973 2878752273 253
255 iso_pu_bacteria 2878753008 2878755751 253
256 iso_pu_bacteria 2881147464 2881153220 253
257 iso_pu_bacteria 2881845957 2881852030 253
258 iso_pu_bacteria 2882912400 2882917012 253
259 iso_pu_bacteria 2888350351 2888357546 253
260 iso_pu_bacteria 2889010040 2889012495 253
261 iso_pu_bacteria 2889016732 2889022608 253
262 iso_pu_bacteria 2896384573 2896388183 253
263 iso_pu_bacteria 2903492973 2903493169 253
264 iso_pu_bacteria 2903492973 2903503597 253
265 iso_pu_bacteria 2903540706 2903541914 253
266 iso_pu_bacteria 2906308376 2906314667 253
267 iso_pu_bacteria 2906321335 2906327835 253
268 iso_pu_bacteria 2913295892 2913296602 253
269 iso_pu_bacteria 2915980308 2915984208 253
270 iso_pu_bacteria 2915986958 2915988969 253
271 iso_pu_bacteria 2915993759 2916000114 253
272 iso_pu_bacteria 2916000859 2916004776 253
273 iso_pu_bacteria 2916007675 2916013106 253
274 iso_pu_bacteria 2916014648 2916018906 253
275 iso_pu_bacteria 2916021584 2916027464 253
276 iso_pu_bacteria 2916028427 2916029985 253
277 iso_pu_bacteria 2916035215 2916037128 253
278 iso_pu_bacteria 2916041962 2916046025 253
279 iso_pu_bacteria 2916048683 2916050176 253
280 iso_pu_bacteria 2916055098 2916058822 253
281 iso_pu_bacteria 2916061851 2916066600 253
282 iso_pu_bacteria 2916068649 2916071059 253
283 iso_pu_bacteria 2916076590 2916082813 253
284 iso_pu_bacteria 2920760137 2920764290 253
285 iso_pu_bacteria 2920822456 2920826503 253
286 iso_pu_bacteria 2921201388 2921206947 253
287 iso_pu_bacteria 2921208531 2921214879 253
288 iso_pu_bacteria 2921237296 2921237860 253
289 iso_pu_bacteria 2921244191 2921247350 253
290 iso_pu_bacteria 2921250672 2921253362 253
291 iso_pu_bacteria 2921257292 2921259875 253
292 iso_pu_bacteria 2921263974 2921265356 253
293 iso_pu_bacteria 2921282425 2921282640 253
294 iso_pu_bacteria 2921289301 2921296001 253
295 iso_pu_bacteria 2921296804 2921301986 253
296 iso_pu_bacteria 2922185730 2922190033 253
297 iso_pu_bacteria 2924144063 2924148946 253
298 iso_pu_bacteria 2924150972 2924155362 253
299 iso_pu_bacteria 2924158325 2924158614 253
300 iso_pu_bacteria 2924165586 2924171898 253
301 iso_pu_bacteria 2924172951 2924176380 253
302 iso_pu_bacteria 2924179722 2924186080 253
303 iso_pu_bacteria 2924186466 2924192824 253
304 iso_pu_bacteria 2924193448 2924198496 253
305 iso_pu_bacteria 2924200457 2924204715 253
306 iso_pu_bacteria 2924207177 2924210067 253
307 iso_pu_bacteria 2924214083 2924214407 253
308 iso_pu_bacteria 2936996657 2936996702 253
309 iso_pu_bacteria 2937002841 2937004726 253
310 iso_pu_bacteria 2937009748 2937013457 253
311 iso_pu_bacteria 2937016420 2937016763 253
312 iso_pu_bacteria 2937023124 2937026625 253
313 iso_pu_bacteria 2937029754 2937032343 253
314 iso_pu_bacteria 2937036028 2937038329 253
315 iso_pu_bacteria 2937042894 2937047933 253
316 iso_pu_bacteria 2937049772 2937055223 253
317 iso_pu_bacteria 2937056579 2937060167 253
318 iso_pu_bacteria 2937063883 2937067951 253
319 iso_pu_bacteria 2937071275 2937076723 253
320 iso_pu_bacteria 2937078374 2937081806 253
321 iso_pu_bacteria 2937084907 2937085110 253
322 iso_pu_bacteria 2937091812 2937096546 253
323 iso_pu_bacteria 2937098957 2937099134 253
324 iso_pu_bacteria 2937106411 2937113038 253
325 iso_pu_bacteria 2937113482 2937117305 253
326 iso_pu_bacteria 2937119839 2937122432 253
327 iso_pu_bacteria 2937813078 2937816030 253
328 iso_pu_bacteria 2937843397 2937845349 253
329 iso_pu_bacteria 2938014810 2938015037 253
330 iso_pu_bacteria 2941499720 2941503338 253
331 iso_pu_bacteria 2957375807 2957377394 253
332 iso_pu_bacteria 2957382221 2957388243 253
333 iso_pu_bacteria 2957388812 2957392171 253
334 iso_pu_bacteria 2957395598 2957395853 253
335 iso_pu_bacteria 2957402308 2957402650 253
336 iso_pu_bacteria 2957408893 2957411130 253
337 iso_pu_bacteria 2957415311 2957417857 253
338 iso_pu_bacteria 2957422303 2957422553 253
339 iso_pu_bacteria 2957430029 2957434122 253
340 iso_pu_bacteria 2957437181 2957439125 253
341 iso_pu_bacteria 2957443900 2957444104 253
342 iso_pu_bacteria 2957450854 2957455036 253
343 iso_pu_bacteria 2957457609 2957462612 253
344 iso_pu_bacteria 2957464669 2957466932 253
345 iso_pu_bacteria 2957471148 2957472837 253
346 iso_pu_bacteria 2957478035 2957479255 253
347 iso_pu_bacteria 2957484790 2957486480 253
348 iso_pu_bacteria 2957491536 2957494919 253
349 iso_pu_bacteria 2957498199 2957503766 253
350 iso_pu_bacteria 2957505466 2957511953 253
351 iso_pu_bacteria 2958100919 2958104549 253
352 iso_pu_bacteria 2958130278 2958136327 253
353 iso_pu_bacteria 2958172287 2958176575 253
354 iso_pu_bacteria 2958179912 2958185795 253
355 iso_pu_bacteria 2960584000 2960588118 253
356 iso_pu_bacteria 2960591022 2960596689 253
357 iso_pu_bacteria 2960597568 2960599633 253
358 iso_pu_bacteria 2960603979 2960607562 253
359 iso_pu_bacteria 2960610863 2960616264 253
360 iso_pu_bacteria 2960617483 2960619269 253
361 iso_pu_bacteria 2960624210 2960631044 253
362 iso_pu_bacteria 2960631154 2960634585 253
363 iso_pu_bacteria 2960637947 2960644847 253
364 iso_pu_bacteria 2960645483 2960648825 253
365 iso_pu_bacteria 2960652885 2960657025 253
366 iso_pu_bacteria 2960660292 2960662575 253
367 iso_pu_bacteria 2960667422 2960672332 253
368 iso_pu_bacteria 2960674078 2960678785 253
369 iso_pu_bacteria 2960680706 2960684841 253
370 iso_pu_bacteria 2960687367 2960688935 253
371 iso_pu_bacteria 2960693952 2960694991 253
372 iso_pu_bacteria 2961077736 2961084172 253
373 iso_pu_bacteria 2961170736 2961173911 253
374 iso_pu_bacteria 2964607997 2964613946 253
375 iso_pu_bacteria 2964615318 2964620654 253
376 iso_pu_bacteria 2964621998 2964622221 253
377 iso_pu_bacteria 2964636051 2964640318 253
378 iso_pu_bacteria 2964643177 2964647513 253
379 iso_pu_bacteria 2964649959 2964652049 253
380 iso_pu_bacteria 2964656573 2964658543 253
381 iso_pu_bacteria 2964663802 2964668620 253
382 iso_pu_bacteria 2964670856 2964677795 253
383 iso_pu_bacteria 2964678106 2964681529 253
384 iso_pu_bacteria 2964685014 2964687548 253
385 iso_pu_bacteria 2964691889 2964693389 253
386 iso_pu_bacteria 2964698721 2964703875 253
387 iso_pu_bacteria 2964705432 2964711232 253
388 iso_pu_bacteria 2964712639 2964716034 253
389 iso_pu_bacteria 2964719344 2964720141 253
390 iso_pu_bacteria 2965119406 2965123956 253
391 iso_pu_bacteria 2967664464 2967671203 253
392 iso_pu_bacteria 2967671571 2967678221 253
393 iso_pu_bacteria 2967678726 2967679650 253
394 iso_pu_bacteria 2967686174 2967688970 253
395 iso_pu_bacteria 2967693043 2967694768 253
396 iso_pu_bacteria 2967699805 2967706397 253
397 iso_pu_bacteria 2967706974 2967710866 253
398 iso_pu_bacteria 2967714385 2967717084 253
399 iso_pu_bacteria 2967721400 2967723979 253
400 iso_pu_bacteria 2967728569 2967731750 253
401 iso_pu_bacteria 2967735183 2967738627 253
402 iso_pu_bacteria 2967742019 2967742731 253
403 iso_pu_bacteria 2967748971 2967753340 253
404 iso_pu_bacteria 2967755722 2967759789 253
405 iso_pu_bacteria 2967762386 2967766208 253
406 iso_pu_bacteria 2967769361 2967771887 253
407 iso_pu_bacteria 2967775926 2967780478 253
408 iso_pu_bacteria 2967996073 2967999081 253
409 iso_pu_bacteria 2968003550 2968006765 253
410 iso_pu_bacteria 2968117919 2968124315 253
411 iso_pu_bacteria 2970019648 2970023875 253
412 iso_pu_bacteria 2970026789 2970028465 253
413 iso_pu_bacteria 2970033650 2970034876 253
414 iso_pu_bacteria 2970040964 2970045822 253
415 iso_pu_bacteria 2970047711 2970048448 253
416 iso_pu_bacteria 2970054988 2970055243 253
417 iso_pu_bacteria 2970061556 2970064154 253
418 iso_pu_bacteria 2970068827 2970070163 253
419 iso_pu_bacteria 2970076120 2970079836 253
420 iso_pu_bacteria 2970082768 2970083069 253
421 iso_pu_bacteria 2970088815 2970094876 253
422 iso_pu_bacteria 2970095765 2970102097 253
423 iso_pu_bacteria 2970102677 2970104978 253
424 iso_pu_bacteria 2970109326 2970109614 253
425 iso_pu_bacteria 2970116247 2970121013 253
426 iso_pu_bacteria 2970122695 2970124968 253
427 iso_pu_bacteria 2970129317 2970132551 253
428 iso_pu_bacteria 2970136068 2970140222 253
429 iso_pu_bacteria 2970143518 2970147057 253
430 iso_pu_bacteria 2970149975 2970149997 253
431 iso_pu_bacteria 2970156795 2970161036 253
432 iso_pu_bacteria 2970164137 2970169851 253
433 iso_pu_bacteria 2970170962 2970175561 253
434 iso_pu_bacteria 2970177841 2970184059 253
435 iso_pu_bacteria 2970184632 2970184896 253
436 iso_pu_bacteria 2970191845 2970197051 253
437 iso_pu_bacteria 2970503327 2970506500 253
438 iso_pu_bacteria 2977516862 2977523046 253
439 iso_pu_bacteria 2977523885 2977526867 253
440 iso_pu_bacteria 2977530762 2977533139 253
441 iso_pu_bacteria 2977537788 2977538311 253
442 iso_pu_bacteria 2977544691 2977546211 253
443 iso_pu_bacteria 2977551784 2977554101 253
444 iso_pu_bacteria 2977558990 2977562889 253
445 iso_pu_bacteria 2977565890 2977567970 253
446 iso_pu_bacteria 2977572785 2977572925 253
447 iso_pu_bacteria 2977579622 2977581759 253
448 iso_pu_bacteria 2977821940 2977824970 253
449 iso_pu_bacteria 2977843712 2977846266 253
450 iso_pu_bacteria 2977864932 2977869321 253
451 iso_pu_bacteria 2977942078 2977948073 253
452 iso_pu_bacteria 2979742915 2979751949 253
453 iso_pu_bacteria 2979808191 2979811148 253
454 iso_pu_bacteria 2987636660 2987640124 253
455 iso_pu_bacteria 2987652177 2987655446 253
456 iso_pu_bacteria 2996310559 2996310642 253
457 iso_pu_bacteria 3004203850 3004207696 253
458 iso_pu_bacteria 643692032 643823903 253
459 iso_pu_bacteria 648276728 648739803 253
460 iso_pu_bacteria 8003992118 8003996064 253
461 iso_pu_bacteria 8003999396 8004003829 253
462 iso_pu_bacteria 8004374579 8004377333 253
463 iso_pu_bacteria 8004387939 8004394345 253
464 iso_pu_bacteria 8004640170 8004643909 253
465 iso_pu_bacteria 8004714634 8004720928 253
466 iso_pu_bacteria 8049293176 8049296809 253
467 iso_pu_bacteria 2599185301 2599939326 254
468 iso_pu_bacteria 2856349417 2856352862 254
469 iso_pu_bacteria 2871444079 2871444665 254
470 iso_pu_bacteria 2876369609 2876377248 254
471 iso_pu_bacteria 2876392853 2876393312 254
472 iso_pu_bacteria 2881155292 2881156969 254
473 iso_pu_bacteria 2881161766 2881162409 254
474 iso_pu_bacteria 2885305155 2885311221 254
475 iso_pu_bacteria 2885312484 2885318190 254
476 iso_pu_bacteria 2885326080 2885333622 254
477 iso_pu_bacteria 2885334103 2885339175 254
478 iso_pu_bacteria 2885342637 2885349389 254
479 iso_pu_bacteria 2885350715 2885354613 254
480 iso_pu_bacteria 2904659560 2904659818 254
481 iso_pu_bacteria 2924726620 2924731882 254
482 iso_pu_bacteria 2961114664 2961115143 254
483 iso_pu_bacteria 2961127735 2961131758 254
484 iso_pu_bacteria 2968110612 2968110875 254
485 3300005337 Ga0070682_100306775 Ga0070682_1003067751 255
486 3300026041 Ga0207639_10001514 Ga0207639_100015144 255
487 3300028577 Ga0265318_10063657 Ga0265318_100636571 255
488 3300031901 Ga0307406_10037754 Ga0307406_100377543 255
489 3300049570 Ga0501033_0036744 Ga0501033_0036744_260_1027 255
490 3300049571 Ga0501034_0078983 Ga0501034_0078983_1703_2470 255
491 3300049574 Ga0501038_0121062 Ga0501038_0121062_797_1564 255
492 3300049579 Ga0501043_0084734 Ga0501043_0084734_68_835 255
493 3300049579 Ga0501043_0295910 Ga0501043_0295910_125_892 255
494 3300049581 Ga0501047_0459206 Ga0501047_0459206_241_1008 255
495 3300049586 Ga0501070_0011617 Ga0501070_0011617_5855_6622 255
496 3300049822 Ga0501035_0043939 Ga0501035_0043939_3049_3816 255
497 3300049823 Ga0501044_0015619 Ga0501044_0015619_4970_5737 255
498 3300049823 Ga0501044_0042134 Ga0501044_0042134_1844_2611 255
499 3300003214 JGI25165J46597_1005549 JGI25165J46597_10055492 256
500 3300005289 Ga0065704_10206150 Ga0065704_102061501 256
501 3300005548 Ga0070665_100276020 Ga0070665_1002760202 256
502 3300005548 Ga0070665_100395962 Ga0070665_1003959622 256
503 3300005563 Ga0068855_100127298 Ga0068855_1001272983 256
504 3300005563 Ga0068855_100415811 Ga0068855_1004158112 256
505 3300005614 Ga0068856_100192952 Ga0068856_1001929522 256
506 3300005616 Ga0068852_100217891 Ga0068852_1002178912 256
507 3300006038 Ga0075365_10040427 Ga0075365_100404271 256
508 3300006038 Ga0075365_10068404 Ga0075365_100684042 256
509 3300006038 Ga0075365_10079578 Ga0075365_100795782 256
510 3300006038 Ga0075365_10283762 Ga0075365_102837621 256
511 3300006048 Ga0075363_100223515 Ga0075363_1002235151 256
512 3300006051 Ga0075364_10007492 Ga0075364_100074925 256
513 3300006051 Ga0075364_10153230 Ga0075364_101532302 256
514 3300006178 Ga0075367_10024044 Ga0075367_100240442 256
515 3300006186 Ga0075369_10052976 Ga0075369_100529762 256
516 3300009093 Ga0105240_10346628 Ga0105240_103466282 256
517 3300009177 Ga0105248_10892504 Ga0105248_108925041 256
518 3300009545 Ga0105237_10359996 Ga0105237_103599962 256
519 3300010375 Ga0105239_10222308 Ga0105239_102223082 256
520 3300010375 Ga0105239_10367613 Ga0105239_103676131 256
521 3300013296 Ga0157374_10217214 Ga0157374_102172142 256
522 3300014497 Ga0182008_10137889 Ga0182008_101378892 256
523 3300015262 Ga0182007_10092218 Ga0182007_100922181 256
524 3300025231 Ga0207427_101683 Ga0207427_1016836 256
525 3300025254 Ga0209148_1000037 Ga0209148_1000037255 256
526 3300025261 Ga0209233_1000464 Ga0209233_100046416 256
527 3300025261 Ga0209233_1016905 Ga0209233_10169052 256
528 3300025272 Ga0209455_1000036 Ga0209455_1000036232 256
529 3300025909 Ga0207705_10058198 Ga0207705_100581983 256
530 3300025911 Ga0207654_10373037 Ga0207654_103730372 256
531 3300025913 Ga0207695_10436641 Ga0207695_104366412 256
532 3300025919 Ga0207657_10132679 Ga0207657_101326792 256
533 3300025937 Ga0207669_10326270 Ga0207669_103262701 256
534 3300025949 Ga0207667_10015265 Ga0207667_100152653 256
535 3300025949 Ga0207667_10299471 Ga0207667_102994711 256
536 3300026023 Ga0207677_10598329 Ga0207677_105983292 256
537 3300026041 Ga0207639_10461771 Ga0207639_104617712 256
538 3300026067 Ga0207678_10180461 Ga0207678_101804612 256
539 3300026142 Ga0207698_10120425 Ga0207698_101204252 256
540 3300028379 Ga0268266_10288164 Ga0268266_102881641 256
541 3300031251 Ga0265327_10014703 Ga0265327_100147033 256
542 3300031548 Ga0307408_100254218 Ga0307408_1002542182 256
543 3300031911 Ga0307412_10225671 Ga0307412_102256712 256
544 3300033180 Ga0307510_10316728 Ga0307510_103167282 256
545 3300037418 Ga0395900_0202832 Ga0395900_0202832_435_1205 256
546 3300038443 Ga0395901_0099806 Ga0395901_0099806_2121_2891 256
547 3300046512 Ga0495610_0114850 Ga0495610_0114850_317_1087 256
548 3300046515 Ga0495620_0117049 Ga0495620_0117049_67_837 256
549 3300046522 Ga0495643_0094224 Ga0495643_0094224_375_1145 256
550 3300046660 Ga0495625_0039222 Ga0495625_0039222_1981_2751 256
551 3300048915 Ga0496112_0094278 Ga0496112_0094278_1856_2626 256
552 3300048927 Ga0496124_0251577 Ga0496124_0251577_359_1129 256
553 3300048928 Ga0496125_0244780 Ga0496125_0244780_120_890 256
554 3300049570 Ga0501033_0507238 Ga0501033_0507238_38_808 256
555 3300050492 nmdc:mga0yw44_104508_c1 nmdc:mga0yw44_104508_c1_829_1599 256
556 3300050492 nmdc:mga0yw44_122426_c1 nmdc:mga0yw44_122426_c1_882_1652 256
557 3300050492 nmdc:mga0yw44_160088_c1 nmdc:mga0yw44_160088_c1_563_1333 256
558 3300050492 nmdc:mga0yw44_29108_c1 nmdc:mga0yw44_29108_c1_424_1194 256
559 3300050492 nmdc:mga0yw44_6104_c1 nmdc:mga0yw44_6104_c1_3884_4654 256
560 3300050496 nmdc:mga07m45_7807_c1 nmdc:mga07m45_7807_c1_2374_3144 256
561 3300053079 Ga0500610_0011018 Ga0500610_0011018_1864_2634 256
562 3300053134 Ga0500658_0168271 Ga0500658_0168271_31_801 256
563 3300053155 Ga0500620_001474 Ga0500620_001474_3343_4113 256
564 3300053158 Ga0500627_0103758 Ga0500627_0103758_203_973 256
565 iso_pu_bacteria 2597489875 2597813086 256
566 iso_pu_bacteria 2881861095 2881866670 256
567 iso_pu_bacteria 2924784321 2924787525 256
568 iso_pu_bacteria 2970540015 2970543709 256
569 iso_pu_bacteria 2977828996 2977836013 256
570 3300002987 JGI25159J45721_1000009 JGI25159J45721_1000009144 257
571 3300003187 JGI25151J46595_10003794 JGI25151J46595_100037946 257
572 3300003215 JGI25153J46596_10012743 JGI25153J46596_100127433 257
573 3300003354 JGI25160J50197_1000028 JGI25160J50197_100002825 257
574 3300003374 JGI25161J50226_1000332 JGI25161J50226_100033218 257
575 3300003771 Ga0055526_1017685 Ga0055526_10176852 257
576 3300003775 Ga0055524_1000885 Ga0055524_10008855 257
577 3300003794 Ga0055531_10008787 Ga0055531_100087872 257
578 3300003794 Ga0055531_10021851 Ga0055531_100218511 257
579 3300004625 Ga0055543_1000230 Ga0055543_100023027 257
580 3300005262 Ga0065165_1000061 Ga0065165_100006125 257
581 3300005262 Ga0065165_1000941 Ga0065165_100094132 257
582 3300005344 Ga0070661_100002761 Ga0070661_1000027612 257
583 3300005539 Ga0068853_100000687 Ga0068853_10000068712 257
584 3300005539 Ga0068853_100346826 Ga0068853_1003468261 257
585 3300005563 Ga0068855_100151086 Ga0068855_1001510862 257
586 3300005564 Ga0070664_100312533 Ga0070664_1003125332 257
587 3300005578 Ga0068854_100002778 Ga0068854_1000027788 257
588 3300005614 Ga0068856_100022447 Ga0068856_1000224472 257
589 3300005616 Ga0068852_100017272 Ga0068852_1000172724 257
590 3300005842 Ga0068858_100137157 Ga0068858_1001371573 257
591 3300006948 Ga0099826_10164474 Ga0099826_101644742 257
592 3300009093 Ga0105240_10088902 Ga0105240_100889023 257
593 3300009545 Ga0105237_10000397 Ga0105237_1000039736 257
594 3300009545 Ga0105237_10278680 Ga0105237_102786802 257
595 3300009551 Ga0105238_10019855 Ga0105238_100198555 257
596 3300009551 Ga0105238_10030006 Ga0105238_100300065 257
597 3300010375 Ga0105239_10052949 Ga0105239_100529492 257
598 3300010375 Ga0105239_10076862 Ga0105239_100768624 257
599 3300010375 Ga0105239_10109907 Ga0105239_101099072 257
600 3300013249 Ga0171463_1012 Ga0171463_101273 257
601 3300013296 Ga0157374_10180164 Ga0157374_101801642 257
602 3300013306 Ga0163162_10080508 Ga0163162_100805082 257
603 3300015683 Ga0183362_10104 Ga0183362_101042 257
604 3300015690 Ga0183363_1213 Ga0183363_12134 257
605 3300021320 Ga0214544_1000329 Ga0214544_100032914 257
606 3300021321 Ga0214542_1000084 Ga0214542_100008414 257
607 3300021327 Ga0214543_1000005 Ga0214543_1000005249 257
608 3300021327 Ga0214543_1000076 Ga0214543_100007614 257
609 3300022739 Ga0228711_1017033 Ga0228711_10170336 257
610 3300022739 Ga0228711_1041907 Ga0228711_10419071 257
611 3300022740 Ga0228710_1000012 Ga0228710_1000012128 257
612 3300022740 Ga0228710_1041163 Ga0228710_10411631 257
613 3300025208 Ga0209436_100100 Ga0209436_1001008 257
614 3300025284 Ga0209130_1000068 Ga0209130_1000068146 257
615 3300025292 Ga0209676_1000714 Ga0209676_100071422 257
616 3300025294 Ga0209025_1000203 Ga0209025_1000203109 257
617 3300025295 Ga0209564_1000081 Ga0209564_100008152 257
618 3300025297 Ga0209758_1004360 Ga0209758_10043606 257
619 3300025298 Ga0209050_1000053 Ga0209050_1000053264 257
620 3300025299 Ga0209256_1000408 Ga0209256_100040829 257
621 3300025299 Ga0209256_1003167 Ga0209256_10031674 257
622 3300025302 Ga0207426_1000155 Ga0207426_1000155146 257
623 3300025304 Ga0209257_1000289 Ga0209257_100028911 257
624 3300025304 Ga0209257_1003606 Ga0209257_100360611 257
625 3300025304 Ga0209257_1050670 Ga0209257_10506702 257
626 3300025321 Ga0207656_10000460 Ga0207656_100004603 257
627 3300025914 Ga0207671_10001048 Ga0207671_1000104819 257
628 3300025914 Ga0207671_10039958 Ga0207671_100399584 257
629 3300025914 Ga0207671_10135456 Ga0207671_101354562 257
630 3300025920 Ga0207649_10001747 Ga0207649_1000174711 257
631 3300025920 Ga0207649_10038006 Ga0207649_100380063 257
632 3300025924 Ga0207694_10001897 Ga0207694_100018977 257
633 3300025924 Ga0207694_10011497 Ga0207694_100114974 257
634 3300025945 Ga0207679_10345298 Ga0207679_103452982 257
635 3300025949 Ga0207667_10054777 Ga0207667_100547773 257
636 3300025981 Ga0207640_10012439 Ga0207640_100124392 257
637 3300026041 Ga0207639_10000783 Ga0207639_1000078313 257
638 3300026041 Ga0207639_10707195 Ga0207639_107071951 257
639 3300026078 Ga0207702_10084193 Ga0207702_100841932 257
640 3300026142 Ga0207698_10014936 Ga0207698_100149365 257
641 3300027111 Ga0209281_1000804 Ga0209281_10008045 257
642 3300027666 Ga0209282_1000023 Ga0209282_100002323 257
643 3300028379 Ga0268266_10000257 Ga0268266_1000025757 257
644 3300031967 Ga0315914_1013287 Ga0315914_10132876 257
645 3300031967 Ga0315914_1013292 Ga0315914_10132926 257
646 3300031995 Ga0307409_100352822 Ga0307409_1003528222 257
647 3300031995 Ga0307409_100406209 Ga0307409_1004062091 257
648 3300033430 Ga0315913_1036737 Ga0315913_10367371 257
649 3300033430 Ga0315913_1036738 Ga0315913_10367381 257
650 3300033464 Ga0315915_1000007 Ga0315915_100000758 257
651 3300033464 Ga0315915_1034278 Ga0315915_10342781 257
652 3300037418 Ga0395900_0350130 Ga0395900_0350130_436_1209 257
653 3300037471 Ga0395905_0013235 Ga0395905_0013235_3815_4588 257
654 3300037471 Ga0395905_0056745 Ga0395905_0056745_177_950 257
655 3300038443 Ga0395901_0018127 Ga0395901_0018127_4814_5587 257
656 3300038443 Ga0395901_0586942 Ga0395901_0586942_283_1056 257
657 3300041404 Ga0439436_0000581 Ga0439436_0000581_266_1069 257
658 3300041405 Ga0439438_055497 Ga0439438_055497_93_866 257
659 3300041406 Ga0439439_0014083 Ga0439439_0014083_61_864 257
660 3300041411 Ga0439466_0059554 Ga0439466_0059554_113_916 257
661 3300041413 Ga0439465_0005706 Ga0439465_0005706_1747_2550 257
662 3300042007 Ga0439449_0003383 Ga0439449_0003383_519_1292 257
663 3300042122 Ga0450920_012754 Ga0450920_012754_636_1439 257
664 3300042435 Ga0439434_0092646 Ga0439434_0092646_139_942 257
665 3300046460 Ga0495638_0009326 Ga0495638_0009326_5891_6664 257
666 3300046616 Ga0495668_0224615 Ga0495668_0224615_144_941 257
667 3300046692 Ga0495671_0225112 Ga0495671_0225112_81_857 257
668 3300047472 Ga0495686_0027482 Ga0495686_0027482_1457_2269 257
669 3300048905 Ga0496102_0362327 Ga0496102_0362327_54_827 257
670 3300048922 Ga0496119_0090920 Ga0496119_0090920_152_925 257
671 3300048923 Ga0496120_0005731 Ga0496120_0005731_8945_9718 257
672 3300048924 Ga0496121_0218620 Ga0496121_0218620_440_1216 257
673 3300048924 Ga0496121_0232193 Ga0496121_0232193_474_1247 257
674 3300048929 Ga0496126_0442844 Ga0496126_0442844_192_965 257
675 3300049571 Ga0501034_0005801 Ga0501034_0005801_2912_3685 257
676 3300049571 Ga0501034_0361118 Ga0501034_0361118_129_902 257
677 3300049822 Ga0501035_0274524 Ga0501035_0274524_227_1000 257
678 3300053109 Ga0500569_030265 Ga0500569_030265_266_1039 257
679 3300053139 Ga0500568_0129042 Ga0500568_0129042_55_828 257
680 3300053151 Ga0500604_0001955 Ga0500604_0001955_746_1525 257
681 iso_pu_bacteria 2508501122 2509110581 257
682 iso_pu_bacteria 2509276019 2509377233 257
683 iso_pu_bacteria 2513237159 2514002299 257
684 iso_pu_bacteria 2558860100 2558862242 257
685 iso_pu_bacteria 2842521101 2842525854 257
686 iso_pu_bacteria 2871495908 2871497119 257
687 iso_pu_bacteria 2878760144 2878761340 257
688 iso_pu_bacteria 2878767105 2878768307 257
689 iso_pu_bacteria 2937994558 2937995770 257
690 iso_pu_bacteria 2958165035 2958166242 257
691 iso_pu_bacteria 2961163497 2961164704 257
692 iso_pu_bacteria 2965018300 2965019530 257
693 iso_pu_bacteria 2968171901 2968173106 257
694 iso_pu_bacteria 2970554993 2970556196 257
695 iso_pu_bacteria 2987659509 2987660713 257
696 iso_pu_bacteria 3004188549 3004189761 257
697 3300002705 JGI25156J39149_1010079 JGI25156J39149_10100792 258
698 3300002741 JGI25157J39369_1001218 JGI25157J39369_100121810 258
699 3300005327 Ga0070658_10023460 Ga0070658_100234602 258
700 3300005328 Ga0070676_10069510 Ga0070676_100695102 258
701 3300005338 Ga0068868_100058510 Ga0068868_1000585102 258
702 3300005339 Ga0070660_100004051 Ga0070660_1000040511 258
703 3300005539 Ga0068853_100036462 Ga0068853_1000364625 258
704 3300005577 Ga0068857_100070815 Ga0068857_1000708151 258
705 3300005616 Ga0068852_100034733 Ga0068852_1000347332 258
706 3300006195 Ga0075366_10238049 Ga0075366_102380492 258
707 3300006353 Ga0075370_10155473 Ga0075370_101554731 258
708 3300009545 Ga0105237_10518108 Ga0105237_105181081 258
709 3300010375 Ga0105239_10106593 Ga0105239_101065934 258
710 3300013104 Ga0157370_10280622 Ga0157370_102806222 258
711 3300013307 Ga0157372_10120621 Ga0157372_101206212 258
712 3300014325 Ga0163163_10082008 Ga0163163_100820083 258
713 3300014969 Ga0157376_10333966 Ga0157376_103339662 258
714 3300025250 Ga0209026_1000071 Ga0209026_1000071148 258
715 3300025256 Ga0209759_1000582 Ga0209759_100058214 258
716 3300025261 Ga0209233_1000053 Ga0209233_1000053290 258
717 3300025297 Ga0209758_1011323 Ga0209758_10113234 258
718 3300025904 Ga0207647_10051080 Ga0207647_100510802 258
719 3300025919 Ga0207657_10008791 Ga0207657_100087913 258
720 3300025933 Ga0207706_10094448 Ga0207706_100944482 258
721 3300025940 Ga0207691_10088256 Ga0207691_100882562 258
722 3300025944 Ga0207661_10138819 Ga0207661_101388192 258
723 3300026041 Ga0207639_10626526 Ga0207639_106265261 258
724 3300026089 Ga0207648_10082313 Ga0207648_100823133 258
725 3300026116 Ga0207674_10006506 Ga0207674_100065064 258
726 3300035691 Ga0373931_0036897 Ga0373931_0036897_712_1488 258
727 3300037471 Ga0395905_0694065 Ga0395905_0694065_79_855 258
728 3300049571 Ga0501034_0049631 Ga0501034_0049631_1017_1793 258
729 3300049571 Ga0501034_0183729 Ga0501034_0183729_688_1464 258
730 3300049742 Ga0501080_0358009 Ga0501080_0358009_305_1123 258
731 3300049823 Ga0501044_0366182 Ga0501044_0366182_126_905 258
732 3300050489 nmdc:mga03683_57156_c1 nmdc:mga03683_57156_c1_255_1031 258
733 3300053153 Ga0500616_0013418 Ga0500616_0013418_2104_2901 258
734 iso_pu_bacteria 2847686936 2847687573 258
735 iso_pu_bacteria 2874102143 2874103806 258
736 iso_pu_bacteria 2906328253 2906332412 258
737 iso_pu_bacteria 2922158528 2922158819 258
738 iso_pu_bacteria 2937891427 2937892139 258
739 iso_pu_bacteria 2958115193 2958117445 258
740 iso_pu_bacteria 2968091066 2968092959 258
741 iso_pu_bacteria 2968097103 2968099445 258
742 iso_pu_bacteria 2968128360 2968132112 258
743 iso_pu_bacteria 2979779861 2979785667 258
744 iso_pu_bacteria 2996341866 2996342944 258
745 iso_pu_bacteria 8004445564 8004446434 258
746 iso_pu_bacteria 8004703790 8004711330 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

4

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9626 1 258
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9589 1 258
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9587 1 258
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9545 1 258
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9514 1 258
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9688 1 258 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9614 1 258 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9533 1 258 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9461 1 258 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.923 1 256 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A436KS41-F1-model_v4 deleted 1.003 1 77
AF-A0A349W2K4-F1-model_v4 Exodeoxyribonuclease III 1.001 1 69 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A2W5ADH5-F1-model_v4 Exodeoxyribonuclease III 1 1 128 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A4Q2FJP5-F1-model_v4 Exodeoxyribonuclease III 0.9999 1 108 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A3S1YX56-F1-model_v4 deleted 0.9996 1 106

Feature Viewer

pLDDT pTM Quality
96.82 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map