F478756

General Info

Members Datasets Scaffolds Average Seq Length
744 311 617 174

Family's Representative Sequence

Representative Sequence 3300042129|Ga0450891_008872|Ga0450891_008872_176_664
Length 162
Sequence MKVVVLTGPESAGKSWLAKQLQEQFGGLRVDEYVRHFMERHRRDTCLADIPDIAAGQLAWEDAARVLSNILWSQTLFGDCPHWLEPALLARHYDLHLLLSPEQVDWTGDGLRCQPDLKERMAFFEAIEQWLVRHHRPYQVIEGDWTQRRDQVFAAVARLLRT

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231014 Pseudomonas sp. GM48 Isolate Nodule
5 2511231015 Pseudomonas sp. GM49 Isolate Nodule
6 2511231017 Pseudomonas sp. GM55 Isolate Nodule
7 2511231020 Pseudomonas sp. GM74 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
11 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
12 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
13 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
14 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
15 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
16 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
17 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
18 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
19 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
20 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
21 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
22 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
23 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
24 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
25 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
26 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
27 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
28 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
29 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
30 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
31 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
32 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
33 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
34 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
35 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
36 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
37 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
38 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
39 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
40 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
41 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
42 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
43 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
44 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
45 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
46 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
47 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
48 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
49 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
50 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
51 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
52 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
53 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
54 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
55 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
56 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
57 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
58 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
59 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
60 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
61 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
62 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
63 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
64 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
65 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
66 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
67 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
68 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
69 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
70 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
71 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
72 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
73 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
74 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
75 2773857673 Pseudomonas sp. 443 Isolate Unclassified
76 2784132063 Pseudomonas sp. 424 Isolate Unclassified
77 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
78 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
79 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
80 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
81 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
82 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
83 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
84 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
85 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
86 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
87 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
88 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
89 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
90 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
91 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
92 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
93 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
94 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
95 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
96 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
97 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
98 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
99 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
100 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
101 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
102 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
103 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
104 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
105 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
106 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
107 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
108 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
109 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
110 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
111 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
112 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
113 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
114 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
115 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
116 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
117 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
118 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
119 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
120 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
121 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
122 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
123 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
124 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
125 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
126 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
127 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
128 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
129 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
130 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
133 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
139 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
140 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
141 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
190 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
191 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
195 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
201 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
202 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
203 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
204 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
205 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
206 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
207 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
208 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
209 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
210 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
214 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
215 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
216 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
296 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
302 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
303 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
304 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
305 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
306 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
307 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
308 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
309 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
310 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
311 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0
Isolates 17.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 2.55
Rhizoplane 7.26
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000004 3300002737 Bacteria 441040
2 JGI25163J39215_1000047 3300002771 Bacteria 53654
3 JGI25163J39215_1000309 3300002771 Bacteria 16438
4 JGI25164J39214_1000031 3300002772 Bacteria 144582
5 JGI25164J39214_1000038 3300002772 Bacteria 131082
6 JGI25165J46597_1000011 3300003214 Bacteria 441040
7 JGI25165J46597_1000126 3300003214 Bacteria 131083
8 rootH1_10181755 3300003323 Bacteria 2978
9 Ga0055536_1000014 3300003781 Bacteria 240624
10 Ga0055536_1000047 3300003781 Bacteria 117289
11 Ga0055536_1000066 3300003781 Bacteria 97166
12 Ga0055530_10000009 3300003791 Bacteria 174044
13 Ga0055530_10000019 3300003791 Bacteria 140299
14 Ga0055530_10000260 3300003791 Bacteria 47714
15 Ga0055540_1000006 3300003792 Bacteria 372018
16 Ga0055540_1000055 3300003792 Bacteria 140299
17 Ga0055540_1000342 3300003792 Bacteria 39754
18 Ga0055531_10000099 3300003794 Bacteria 93823
19 Ga0055531_10000126 3300003794 Bacteria 85918
20 Ga0065714_10001451 3300005288 Bacteria 9617
21 Ga0065714_10016846 3300005288 Bacteria 2274
22 Ga0065714_10066538 3300005288 Bacteria 6679
23 Ga0065714_10160669 3300005288 Bacteria 1053
24 Ga0065704_10071346 3300005289 Bacteria 11600
25 Ga0070669_100035828 3300005353 Bacteria 3595
26 Ga0070662_100116638 3300005457 Bacteria 2041
27 Ga0070665_100182627 3300005548 Bacteria 2098
28 Ga0075363_100238880 3300006048 Bacteria 1044
29 Ga0075364_10082983 3300006051 Bacteria 2121
30 Ga0075432_10009192 3300006058 Bacteria 3366
31 Ga0075432_10009806 3300006058 Bacteria 3256
32 Ga0075432_10017096 3300006058 Bacteria 2475
33 Ga0075432_10082653 3300006058 Bacteria 1166
34 Ga0075362_10063307 3300006177 Bacteria 1677
35 Ga0075362_10065800 3300006177 Bacteria 1646
36 Ga0075362_10189527 3300006177 Bacteria 998
37 Ga0075369_10019870 3300006186 Bacteria 2746
38 Ga0075436_100123601 3300006914 Bacteria 1812
39 Ga0079104_1000235 3300006946 Bacteria 74576
40 Ga0079104_1014386 3300006946 Bacteria 2388
41 Ga0079104_1016543 3300006946 Bacteria 2152
42 Ga0099826_10052808 3300006948 Bacteria 2711
43 Ga0105251_10000001 3300009011 Bacteria 466643
44 Ga0105251_10004238 3300009011 Bacteria 9901
45 Ga0105251_10126196 3300009011 Bacteria 1161
46 Ga0105251_10296441 3300009011 Bacteria 733
47 Ga0105244_10003273 3300009036 Bacteria 11663
48 Ga0105244_10004328 3300009036 Bacteria 9816
49 Ga0105244_10011703 3300009036 Bacteria 5236
50 Ga0105244_10023650 3300009036 Bacteria 3366
51 Ga0105244_10030611 3300009036 Bacteria 2862
52 Ga0105244_10049418 3300009036 Bacteria 2149
53 Ga0105244_10051795 3300009036 Bacteria 2091
54 Ga0105244_10110624 3300009036 Bacteria 1337
55 Ga0105244_10133825 3300009036 Bacteria 1196
56 Ga0105250_10001069 3300009092 Bacteria 15571
57 Ga0105250_10014243 3300009092 Bacteria 3270
58 Ga0105250_10029066 3300009092 Bacteria 2224
59 Ga0105250_10074209 3300009092 Bacteria 1376
60 Ga0105250_10087102 3300009092 Bacteria 1268
61 Ga0105250_10157357 3300009092 Bacteria 947
62 Ga0105243_10000026 3300009148 Bacteria 191522
63 Ga0105243_10006152 3300009148 Bacteria 9281
64 Ga0105243_10037251 3300009148 Bacteria 3779
65 Ga0105243_10148936 3300009148 Bacteria 2005
66 Ga0105246_10000009 3300011119 Bacteria 79055
67 Ga0157345_1000047 3300012498 Bacteria 28178
68 Ga0157373_10001411 3300013100 Bacteria 18378
69 Ga0157373_10012229 3300013100 Bacteria 6311
70 Ga0157373_10024286 3300013100 Bacteria 4392
71 Ga0157373_10024473 3300013100 Bacteria 4373
72 Ga0157373_10153251 3300013100 Bacteria 1621
73 Ga0157373_10195433 3300013100 Bacteria 1426
74 Ga0157373_10345213 3300013100 Bacteria 1061
75 Ga0157373_10474590 3300013100 Bacteria 902
76 Ga0157371_10003166 3300013102 Bacteria 15144
77 Ga0157371_10004269 3300013102 Bacteria 12558
78 Ga0157370_10004472 3300013104 Bacteria 16014
79 Ga0157370_10164833 3300013104 Bacteria 2061
80 Ga0157370_10620986 3300013104 Bacteria 989
81 Ga0157369_10091194 3300013105 Bacteria 3253
82 Ga0157369_10163861 3300013105 Bacteria 2345
83 Ga0157369_10714623 3300013105 Bacteria 1032
84 Ga0163162_10005958 3300013306 Bacteria 11802
85 Ga0163162_10015467 3300013306 Bacteria 7456
86 Ga0163162_10246787 3300013306 Bacteria 1917
87 Ga0157372_10007608 3300013307 Bacteria 11518
88 Ga0157375_10022998 3300013308 Bacteria 5745
89 Ga0182008_10000862 3300014497 Bacteria 21050
90 Ga0182008_10004640 3300014497 Bacteria 7994
91 Ga0182008_10007234 3300014497 Bacteria 6138
92 Ga0182008_10053179 3300014497 Bacteria 2006
93 Ga0182008_10367938 3300014497 Bacteria 766
94 Ga0182006_1001493 3300015261 Bacteria 14032
95 Ga0182006_1003466 3300015261 Bacteria 8050
96 Ga0182006_1023939 3300015261 Bacteria 2525
97 Ga0182006_1065134 3300015261 Bacteria 1365
98 Ga0182005_1006208 3300015265 Bacteria 3671
99 Ga0182005_1008215 3300015265 Bacteria 3086
100 Ga0182005_1010089 3300015265 Bacteria 2723
101 Ga0182005_1015836 3300015265 Bacteria 2101
102 Ga0182005_1021009 3300015265 Bacteria 1793
103 Ga0182005_1032356 3300015265 Bacteria 1423
104 Ga0163161_10001142 3300017792 Bacteria 19974
105 Ga0163161_10003618 3300017792 Bacteria 10844
106 Ga0163161_10014808 3300017792 Bacteria 5433
107 Ga0163161_10307088 3300017792 Bacteria 1251
108 Ga0209760_100032 3300025207 Bacteria 138015
109 Ga0209760_100036 3300025207 Bacteria 130845
110 Ga0209563_100262 3300025230 Bacteria 23574
111 Ga0207427_100003 3300025231 Bacteria 1035004
112 Ga0207427_100004 3300025231 Bacteria 939600
113 Ga0209437_100002 3300025233 Bacteria 1574801
114 Ga0209437_100025 3300025233 Bacteria 561333
115 Ga0209233_1000004 3300025261 Bacteria 1574798
116 Ga0209233_1000145 3300025261 Bacteria 188955
117 Ga0209675_1006638 3300025291 Bacteria 4601
118 Ga0209676_1000002 3300025292 Bacteria 1732948
119 Ga0209676_1000003 3300025292 Bacteria 1454178
120 Ga0209676_1000158 3300025292 Bacteria 162469
121 Ga0209676_1003638 3300025292 Bacteria 9265
122 Ga0209050_1000004 3300025298 Bacteria 1600040
123 Ga0209050_1000006 3300025298 Bacteria 1359702
124 Ga0209050_1000013 3300025298 Bacteria 811408
125 Ga0209051_1000001 3300025303 Bacteria 1732974
126 Ga0209051_1000006 3300025303 Bacteria 1015785
127 Ga0209051_1000007 3300025303 Bacteria 811408
128 Ga0209257_1000029 3300025304 Bacteria 695617
129 Ga0209257_1011660 3300025304 Bacteria 4193
130 Ga0207696_1000002 3300025711 Bacteria 1098043
131 Ga0207696_1005013 3300025711 Bacteria 5576
132 Ga0207696_1008159 3300025711 Bacteria 4034
133 Ga0207696_1018932 3300025711 Bacteria 2252
134 Ga0207655_1000022 3300025728 Bacteria 483933
135 Ga0207655_1000379 3300025728 Bacteria 62077
136 Ga0207655_1002110 3300025728 Bacteria 16627
137 Ga0207655_1007288 3300025728 Bacteria 7194
138 Ga0207655_1017128 3300025728 Bacteria 3922
139 Ga0207655_1037712 3300025728 Bacteria 2124
140 Ga0207713_1000107 3300025735 Bacteria 137841
141 Ga0207713_1008948 3300025735 Bacteria 5695
142 Ga0207713_1010025 3300025735 Bacteria 5284
143 Ga0207713_1017848 3300025735 Bacteria 3535
144 Ga0207713_1020434 3300025735 Bacteria 3208
145 Ga0207713_1048696 3300025735 Bacteria 1705
146 Ga0207713_1097623 3300025735 Bacteria 1020
147 Ga0207706_10133158 3300025933 Bacteria 2186
148 Ga0207709_10000004 3300025935 Bacteria 825156
149 Ga0207709_10003056 3300025935 Bacteria 10122
150 Ga0207709_10036717 3300025935 Bacteria 2905
151 Ga0207709_10085565 3300025935 Bacteria 2045
152 Ga0209281_1000009 3300027111 Bacteria 771717
153 Ga0209281_1000046 3300027111 Bacteria 327042
154 Ga0209281_1009163 3300027111 Bacteria 2341
155 Ga0209281_1011740 3300027111 Bacteria 1949
156 Ga0209281_1014925 3300027111 Bacteria 1632
157 Ga0209281_1024558 3300027111 Bacteria 1131
158 Ga0209281_1025009 3300027111 Bacteria 1117
159 Ga0207428_10013522 3300027907 Bacteria 7127
160 Ga0207428_10039237 3300027907 Bacteria 3845
161 Ga0207428_10077633 3300027907 Bacteria 2600
162 Ga0207428_10145150 3300027907 Bacteria 1809
163 Ga0207428_10222295 3300027907 Bacteria 1415
164 Ga0268266_10017088 3300028379 Bacteria 6195
165 Ga0307511_10127912 3300030521 Bacteria 1542
166 Ga0307511_10249150 3300030521 Bacteria 856
167 Ga0316181_1093407 3300030744 Bacteria 1050
168 Ga0307408_100002496 3300031548 Bacteria 12877
169 Ga0307408_100012760 3300031548 Bacteria 5573
170 Ga0307408_100026059 3300031548 Bacteria 4010
171 Ga0307408_100029730 3300031548 Bacteria 3788
172 Ga0307408_100066794 3300031548 Bacteria 2642
173 Ga0307408_100752274 3300031548 Bacteria 880
174 Ga0307516_10516871 3300031730 Bacteria 848
175 Ga0307405_10009186 3300031731 Bacteria 5055
176 Ga0307406_10212705 3300031901 Bacteria 1431
177 Ga0307407_10165816 3300031903 Bacteria 1450
178 Ga0307407_10254168 3300031903 Bacteria 1206
179 Ga0307412_10002602 3300031911 Bacteria 10025
180 Ga0307412_10005232 3300031911 Bacteria 7273
181 Ga0307412_10035334 3300031911 Bacteria 3192
182 Ga0307412_10103033 3300031911 Bacteria 2022
183 Ga0307412_10236032 3300031911 Bacteria 1411
184 Ga0307412_10249098 3300031911 Bacteria 1378
185 Ga0307412_10557582 3300031911 Bacteria 963
186 Ga0307409_100235690 3300031995 Bacteria 1662
187 Ga0307416_100924060 3300032002 Bacteria 973
188 Ga0307416_101677963 3300032002 Bacteria 740
189 Ga0307414_10042967 3300032004 Bacteria 3075
190 Ga0307411_10009535 3300032005 Bacteria 5112
191 Ga0307411_10780919 3300032005 Bacteria 839
192 Ga0307510_10005559 3300033180 Bacteria 15026
193 Ga0237819_01613 3300038705 Bacteria 5599
194 Ga0439438_000033 3300041405 Bacteria 69839
195 Ga0439438_000602 3300041405 Bacteria 16237
196 Ga0439438_001291 3300041405 Bacteria 11080
197 Ga0439438_002841 3300041405 Bacteria 7215
198 Ga0439438_002922 3300041405 Bacteria 7095
199 Ga0439438_003150 3300041405 Bacteria 6764
200 Ga0439438_003978 3300041405 Bacteria 5809
201 Ga0439438_008861 3300041405 Bacteria 3296
202 Ga0439447_002247 3300041407 Bacteria 7081
203 Ga0439447_016487 3300041407 Bacteria 2026
204 Ga0439466_0005263 3300041411 Bacteria 4950
205 Ga0439466_0007234 3300041411 Bacteria 4201
206 Ga0439466_0013623 3300041411 Bacteria 2974
207 Ga0439466_0027547 3300041411 Bacteria 1967
208 Ga0439431_0000950 3300041997 Bacteria 6298
209 Ga0439437_000138 3300042000 Bacteria 5971
210 Ga0439443_010270 3300042003 Bacteria 1355
211 Ga0439445_0015468 3300042004 Bacteria 1868
212 Ga0439432_000429 3300042006 Bacteria 15692
213 Ga0439432_004048 3300042006 Bacteria 5376
214 Ga0439432_007045 3300042006 Bacteria 3998
215 Ga0439432_032469 3300042006 Bacteria 1683
216 Ga0439432_033339 3300042006 Bacteria 1657
217 Ga0439432_033854 3300042006 Bacteria 1642
218 Ga0439432_047059 3300042006 Bacteria 1353
219 Ga0439432_065757 3300042006 Bacteria 1111
220 Ga0439451_034380 3300042009 Bacteria 1019
221 Ga0439452_000236 3300042010 Bacteria 38327
222 Ga0439452_000723 3300042010 Bacteria 15987
223 Ga0439452_001102 3300042010 Bacteria 11894
224 Ga0439452_006972 3300042010 Bacteria 3495
225 Ga0439456_000991 3300042013 Bacteria 5658
226 Ga0439456_003684 3300042013 Bacteria 3115
227 Ga0439463_001301 3300042016 Bacteria 6636
228 Ga0439463_004678 3300042016 Bacteria 3419
229 Ga0439463_020989 3300042016 Bacteria 1630
230 Ga0439463_021396 3300042016 Bacteria 1615
231 Ga0439463_037727 3300042016 Bacteria 1225
232 Ga0450911_000219 3300042115 Bacteria 22254
233 Ga0450914_003674 3300042118 Bacteria 1195
234 Ga0450922_000134 3300042124 Bacteria 7582
235 Ga0450891_008872 3300042129 Bacteria 924
236 Ga0450902_003102 3300042137 Bacteria 2402
237 Ga0450902_032415 3300042137 Bacteria 881
238 Ga0450903_001464 3300042138 Bacteria 4406
239 Ga0450903_005368 3300042138 Bacteria 2145
240 Ga0450904_001072 3300042139 Bacteria 4225
241 Ga0450904_001779 3300042139 Bacteria 2829
242 Ga0450906_002134 3300042145 Bacteria 4324
243 Ga0450906_002286 3300042145 Bacteria 4196
244 Ga0450907_014327 3300042146 Bacteria 1323
245 Ga0450907_036031 3300042146 Bacteria 845
246 Ga0439446_0007713 3300042156 Bacteria 2836
247 Ga0439464_0239703 3300042439 Bacteria 584
248 Ga0450916_001809 3300042530 Bacteria 2186
249 Ga0450916_007797 3300042530 Bacteria 1292
250 Ga0450918_011606 3300042531 Bacteria 1535
251 Ga0450893_0001820 3300042532 Bacteria 3284
252 Ga0439440_0010264 3300042993 Bacteria 1953
253 Ga0439440_0012065 3300042993 Bacteria 1832
254 Ga0453684_0202873 3300044712 Bacteria 2310
255 Ga0495617_001725 3300046452 Bacteria 9362
256 Ga0495617_012008 3300046452 Bacteria 2953
257 Ga0495617_016529 3300046452 Bacteria 2496
258 Ga0495617_025012 3300046452 Bacteria 2013
259 Ga0495617_027823 3300046452 Bacteria 1901
260 Ga0495617_028165 3300046452 Bacteria 1888
261 Ga0495617_031509 3300046452 Bacteria 1780
262 Ga0495617_048180 3300046452 Bacteria 1418
263 Ga0495617_053990 3300046452 Bacteria 1334
264 Ga0495617_125428 3300046452 Bacteria 825
265 Ga0495627_000526 3300046453 Bacteria 31735
266 Ga0495627_003123 3300046453 Bacteria 7504
267 Ga0495627_003208 3300046453 Bacteria 7359
268 Ga0495627_015090 3300046453 Bacteria 2674
269 Ga0495627_094564 3300046453 Bacteria 857
270 Ga0495627_107563 3300046453 Bacteria 793
271 Ga0495592_0072863 3300046454 Bacteria 2498
272 Ga0495590_0001440 3300046457 Bacteria 10271
273 Ga0495591_000217 3300046458 Bacteria 57816
274 Ga0495591_000221 3300046458 Bacteria 56635
275 Ga0495591_002183 3300046458 Bacteria 11179
276 Ga0495591_003994 3300046458 Bacteria 7381
277 Ga0495591_008777 3300046458 Bacteria 4098
278 Ga0495591_009414 3300046458 Bacteria 3888
279 Ga0495591_014101 3300046458 Bacteria 2889
280 Ga0495591_014394 3300046458 Bacteria 2846
281 Ga0495591_024836 3300046458 Bacteria 1890
282 Ga0495638_0003901 3300046460 Bacteria 11540
283 Ga0495638_0007483 3300046460 Bacteria 7826
284 Ga0495638_0009433 3300046460 Bacteria 6851
285 Ga0495638_0010691 3300046460 Bacteria 6356
286 Ga0495638_0041390 3300046460 Bacteria 2915
287 Ga0495638_0050735 3300046460 Bacteria 2590
288 Ga0495638_0072827 3300046460 Bacteria 2098
289 Ga0495638_0121812 3300046460 Bacteria 1540
290 Ga0495653_0003922 3300046463 Bacteria 12029
291 Ga0495650_0002813 3300046471 Bacteria 13354
292 Ga0495650_0004151 3300046471 Bacteria 10085
293 Ga0495650_0009249 3300046471 Bacteria 5630
294 Ga0495650_0025602 3300046471 Bacteria 2760
295 Ga0495650_0048266 3300046471 Bacteria 1775
296 Ga0495650_0096642 3300046471 Bacteria 1114
297 Ga0495605_0001217 3300046474 Bacteria 17155
298 Ga0495605_0002711 3300046474 Bacteria 10821
299 Ga0495605_0007676 3300046474 Bacteria 6115
300 Ga0495605_0017848 3300046474 Bacteria 3812
301 Ga0495605_0024361 3300046474 Bacteria 3167
302 Ga0495605_0040541 3300046474 Bacteria 2324
303 Ga0495639_0006247 3300046475 Bacteria 5119
304 Ga0495584_0011208 3300046491 Bacteria 4593
305 Ga0495584_0012104 3300046491 Bacteria 4410
306 Ga0495584_0021267 3300046491 Bacteria 3296
307 Ga0495584_0024422 3300046491 Bacteria 3065
308 Ga0495584_0034524 3300046491 Bacteria 2558
309 Ga0495584_0059737 3300046491 Bacteria 1917
310 Ga0495585_0006273 3300046492 Bacteria 7397
311 Ga0495585_0007031 3300046492 Bacteria 6926
312 Ga0495585_0018763 3300046492 Bacteria 3989
313 Ga0495585_0018925 3300046492 Bacteria 3972
314 Ga0495585_0022378 3300046492 Bacteria 3628
315 Ga0495585_0031157 3300046492 Bacteria 3030
316 Ga0495585_0063161 3300046492 Bacteria 2033
317 Ga0495594_0001641 3300046499 Bacteria 11641
318 Ga0495596_0025408 3300046500 Bacteria 2393
319 Ga0495596_0026886 3300046500 Bacteria 2317
320 Ga0495596_0034547 3300046500 Bacteria 2007
321 Ga0495607_0003241 3300046501 Bacteria 12543
322 Ga0495607_0003656 3300046501 Bacteria 11675
323 Ga0495607_0003814 3300046501 Bacteria 11371
324 Ga0495607_0013570 3300046501 Bacteria 5333
325 Ga0495607_0018559 3300046501 Bacteria 4432
326 Ga0495607_0059009 3300046501 Bacteria 2190
327 Ga0495607_0067117 3300046501 Bacteria 2016
328 Ga0495607_0085517 3300046501 Bacteria 1722
329 Ga0495607_0100685 3300046501 Bacteria 1548
330 Ga0495607_0338640 3300046501 Bacteria 697
331 Ga0495583_0003197 3300046506 Bacteria 12845
332 Ga0495606_0002514 3300046507 Bacteria 21134
333 Ga0495606_0004699 3300046507 Bacteria 13482
334 Ga0495606_0007684 3300046507 Bacteria 9557
335 Ga0495606_0030628 3300046507 Bacteria 3755
336 Ga0495606_0080236 3300046507 Bacteria 2030
337 Ga0495606_0414133 3300046507 Bacteria 698
338 Ga0495610_0006331 3300046512 Bacteria 8187
339 Ga0495610_0008712 3300046512 Bacteria 6524
340 Ga0495610_0014407 3300046512 Bacteria 4643
341 Ga0495610_0032014 3300046512 Bacteria 2737
342 Ga0495610_0032594 3300046512 Bacteria 2704
343 Ga0495610_0035950 3300046512 Bacteria 2537
344 Ga0495616_0000893 3300046513 Bacteria 21535
345 Ga0495616_0003092 3300046513 Bacteria 10781
346 Ga0495616_0007274 3300046513 Bacteria 6627
347 Ga0495616_0013673 3300046513 Bacteria 4570
348 Ga0495616_0016326 3300046513 Bacteria 4113
349 Ga0495616_0022361 3300046513 Bacteria 3415
350 Ga0495616_0039776 3300046513 Bacteria 2406
351 Ga0495616_0111853 3300046513 Bacteria 1268
352 Ga0495616_0240828 3300046513 Bacteria 780
353 Ga0495620_0000599 3300046515 Bacteria 22581
354 Ga0495620_0000669 3300046515 Bacteria 21147
355 Ga0495620_0001608 3300046515 Bacteria 13382
356 Ga0495620_0009422 3300046515 Bacteria 5196
357 Ga0495620_0014572 3300046515 Bacteria 3992
358 Ga0495620_0016483 3300046515 Bacteria 3705
359 Ga0495620_0028389 3300046515 Bacteria 2602
360 Ga0495620_0031236 3300046515 Bacteria 2442
361 Ga0495620_0042008 3300046515 Bacteria 2001
362 Ga0495620_0083816 3300046515 Bacteria 1286
363 Ga0495631_0000565 3300046518 Bacteria 24889
364 Ga0495631_0001729 3300046518 Bacteria 12973
365 Ga0495631_0051283 3300046518 Bacteria 1803
366 Ga0495631_0056831 3300046518 Bacteria 1704
367 Ga0495631_0059219 3300046518 Bacteria 1664
368 Ga0495631_0097722 3300046518 Bacteria 1264
369 Ga0495631_0123109 3300046518 Bacteria 1115
370 Ga0495631_0152693 3300046518 Bacteria 991
371 Ga0495632_0001203 3300046519 Bacteria 21962
372 Ga0495632_0003322 3300046519 Bacteria 11474
373 Ga0495632_0007002 3300046519 Bacteria 7153
374 Ga0495632_0154823 3300046519 Bacteria 1058
375 Ga0495632_0160985 3300046519 Bacteria 1034
376 Ga0495632_0180256 3300046519 Bacteria 968
377 Ga0495637_0001999 3300046520 Bacteria 11520
378 Ga0495637_0005001 3300046520 Bacteria 6818
379 Ga0495637_0005542 3300046520 Bacteria 6409
380 Ga0495637_0013340 3300046520 Bacteria 3900
381 Ga0495637_0016540 3300046520 Bacteria 3446
382 Ga0495637_0021429 3300046520 Bacteria 2963
383 Ga0495637_0030814 3300046520 Bacteria 2376
384 Ga0495637_0057598 3300046520 Bacteria 1604
385 Ga0495637_0063662 3300046520 Bacteria 1506
386 Ga0495637_0075912 3300046520 Bacteria 1347
387 Ga0495637_0104093 3300046520 Bacteria 1106
388 Ga0495643_0006558 3300046522 Bacteria 7656
389 Ga0495643_0030251 3300046522 Bacteria 3025
390 Ga0495643_0095871 3300046522 Bacteria 1525
391 Ga0495643_0359994 3300046522 Bacteria 649
392 Ga0495644_0001336 3300046523 Bacteria 10093
393 Ga0495648_0000042 3300046524 Bacteria 179918
394 Ga0495648_0002710 3300046524 Bacteria 16002
395 Ga0495648_0002983 3300046524 Bacteria 15180
396 Ga0495648_0004180 3300046524 Bacteria 12414
397 Ga0495648_0004206 3300046524 Bacteria 12362
398 Ga0495648_0011301 3300046524 Bacteria 6737
399 Ga0495648_0011471 3300046524 Bacteria 6670
400 Ga0495648_0014407 3300046524 Bacteria 5790
401 Ga0495648_0030154 3300046524 Bacteria 3590
402 Ga0495648_0050379 3300046524 Bacteria 2544
403 Ga0495648_0084332 3300046524 Bacteria 1798
404 Ga0495642_0000856 3300046528 Bacteria 14470
405 Ga0495654_0000846 3300046530 Bacteria 23172
406 Ga0495654_0005323 3300046530 Bacteria 7499
407 Ga0495654_0012049 3300046530 Bacteria 4659
408 Ga0495654_0018566 3300046530 Bacteria 3642
409 Ga0495654_0019863 3300046530 Bacteria 3507
410 Ga0495654_0045913 3300046530 Bacteria 2154
411 Ga0495654_0070754 3300046530 Bacteria 1653
412 Ga0495654_0102047 3300046530 Bacteria 1319
413 Ga0495654_0109425 3300046530 Bacteria 1262
414 Ga0495587_0356230 3300046536 Bacteria 815
415 Ga0495609_0005803 3300046538 Bacteria 6408
416 Ga0495609_0005907 3300046538 Bacteria 6325
417 Ga0495609_0010321 3300046538 Bacteria 4484
418 Ga0495609_0013211 3300046538 Bacteria 3904
419 Ga0495609_0014071 3300046538 Bacteria 3768
420 Ga0495609_0016777 3300046538 Bacteria 3410
421 Ga0495609_0076156 3300046538 Bacteria 1470
422 Ga0495609_0185412 3300046538 Bacteria 874
423 Ga0495597_0003616 3300046542 Bacteria 8892
424 Ga0495597_0011450 3300046542 Bacteria 4300
425 Ga0495597_0032745 3300046542 Bacteria 2357
426 Ga0495597_0075202 3300046542 Bacteria 1450
427 Ga0495597_0078598 3300046542 Bacteria 1413
428 Ga0495597_0106236 3300046542 Bacteria 1180
429 Ga0495645_0031027 3300046543 Bacteria 3893
430 Ga0495622_0001382 3300046557 Bacteria 12374
431 Ga0495622_0006971 3300046557 Bacteria 5246
432 Ga0495633_0004263 3300046558 Bacteria 9139
433 Ga0495633_0004510 3300046558 Bacteria 8813
434 Ga0495668_0010559 3300046616 Bacteria 5581
435 Ga0495668_0119872 3300046616 Bacteria 1439
436 Ga0495668_0398466 3300046616 Bacteria 756
437 Ga0495634_0042155 3300046642 Bacteria 3097
438 Ga0495611_0000279 3300046648 Bacteria 34844
439 Ga0495611_0048479 3300046648 Bacteria 1909
440 Ga0495611_0131902 3300046648 Bacteria 1165
441 Ga0495625_0003170 3300046660 Bacteria 16739
442 Ga0495625_0005996 3300046660 Bacteria 10919
443 Ga0495625_0007727 3300046660 Bacteria 9301
444 Ga0495625_0018142 3300046660 Bacteria 5500
445 Ga0495625_0064317 3300046660 Bacteria 2587
446 Ga0495625_0098979 3300046660 Bacteria 2005
447 Ga0495625_0147029 3300046660 Bacteria 1586
448 Ga0495625_0700727 3300046660 Bacteria 598
449 Ga0495661_0001563 3300046665 Bacteria 18869
450 Ga0495661_0012767 3300046665 Bacteria 5668
451 Ga0495661_0021330 3300046665 Bacteria 4224
452 Ga0495661_0032078 3300046665 Bacteria 3324
453 Ga0495661_0035745 3300046665 Bacteria 3115
454 Ga0495661_0058942 3300046665 Bacteria 2286
455 Ga0495661_0138198 3300046665 Bacteria 1328
456 Ga0495588_0236199 3300046674 Bacteria 964
457 Ga0495646_0007762 3300046680 Bacteria 6816
458 Ga0495669_0017549 3300046684 Bacteria 3072
459 Ga0495613_0029335 3300046689 Bacteria 4090
460 Ga0495613_0082251 3300046689 Bacteria 2339
461 Ga0495624_0001132 3300046690 Bacteria 21106
462 Ga0495624_0147729 3300046690 Bacteria 1438
463 Ga0495670_0000341 3300046691 Bacteria 22294
464 Ga0495670_0001896 3300046691 Bacteria 10305
465 Ga0495670_0003131 3300046691 Bacteria 8151
466 Ga0495670_0004379 3300046691 Bacteria 6923
467 Ga0495670_0008464 3300046691 Bacteria 5059
468 Ga0495671_0002629 3300046692 Bacteria 11294
469 Ga0495671_0005124 3300046692 Bacteria 7712
470 Ga0495671_0006906 3300046692 Bacteria 6513
471 Ga0495671_0016132 3300046692 Bacteria 3994
472 Ga0495671_0045077 3300046692 Bacteria 2208
473 Ga0495671_0049387 3300046692 Bacteria 2097
474 Ga0495671_0056357 3300046692 Bacteria 1945
475 Ga0495671_0368527 3300046692 Bacteria 688
476 Ga0495649_0002330 3300046694 Bacteria 13443
477 Ga0495649_0013048 3300046694 Bacteria 4805
478 Ga0495649_0013057 3300046694 Bacteria 4803
479 Ga0495649_0016101 3300046694 Bacteria 4243
480 Ga0495649_0028694 3300046694 Bacteria 3083
481 Ga0495649_0030490 3300046694 Bacteria 2978
482 Ga0495649_0039000 3300046694 Bacteria 2604
483 Ga0495649_0055093 3300046694 Bacteria 2149
484 Ga0495649_0086373 3300046694 Bacteria 1674
485 Ga0495589_0001102 3300046794 Bacteria 16098
486 Ga0495589_0002197 3300046794 Bacteria 10980
487 Ga0495589_0018042 3300046794 Bacteria 3621
488 Ga0495589_0020201 3300046794 Bacteria 3408
489 Ga0495589_0320313 3300046794 Bacteria 716
490 Ga0495600_0001741 3300046809 Bacteria 12161
491 Ga0495660_0005776 3300046810 Bacteria 7392
492 Ga0495660_0014625 3300046810 Bacteria 4538
493 Ga0495660_0016677 3300046810 Bacteria 4232
494 Ga0495660_0040420 3300046810 Bacteria 2585
495 Ga0495660_0047858 3300046810 Bacteria 2339
496 Ga0495660_0080949 3300046810 Bacteria 1703
497 Ga0495660_0086674 3300046810 Bacteria 1634
498 Ga0495660_0114695 3300046810 Bacteria 1370
499 Ga0495660_0131634 3300046810 Bacteria 1254
500 Ga0495660_0133884 3300046810 Bacteria 1240
501 Ga0495660_0246627 3300046810 Bacteria 830
502 Ga0495660_0320306 3300046810 Bacteria 697
503 Ga0495604_0004784 3300047317 Bacteria 10731
504 Ga0495672_0001619 3300047320 Bacteria 21950
505 Ga0495672_0001840 3300047320 Bacteria 20251
506 Ga0495672_0002716 3300047320 Bacteria 15884
507 Ga0495672_0015027 3300047320 Bacteria 5271
508 Ga0495672_0020267 3300047320 Bacteria 4363
509 Ga0495672_0026600 3300047320 Bacteria 3690
510 Ga0495672_0034212 3300047320 Bacteria 3142
511 Ga0495672_0167509 3300047320 Bacteria 1123
512 Ga0495676_0004902 3300047321 Bacteria 12274
513 Ga0495676_0037142 3300047321 Bacteria 4058
514 Ga0495680_0033821 3300047322 Bacteria 4136
515 Ga0495683_0000669 3300047323 Bacteria 25346
516 Ga0495683_0001163 3300047323 Bacteria 18028
517 Ga0495683_0017795 3300047323 Bacteria 3679
518 Ga0495683_0023939 3300047323 Bacteria 3136
519 Ga0495683_0030509 3300047323 Bacteria 2750
520 Ga0495683_0039116 3300047323 Bacteria 2398
521 Ga0495683_0054458 3300047323 Bacteria 1994
522 Ga0495687_003088 3300047443 Bacteria 12474
523 Ga0495687_003921 3300047443 Bacteria 10423
524 Ga0495679_001980 3300047446 Bacteria 10890
525 Ga0495679_004530 3300047446 Bacteria 6374
526 Ga0495679_007738 3300047446 Bacteria 4446
527 Ga0495673_0001005 3300047469 Bacteria 24974
528 Ga0495673_0001180 3300047469 Bacteria 22048
529 Ga0495673_0001453 3300047469 Bacteria 18840
530 Ga0495673_0001533 3300047469 Bacteria 18171
531 Ga0495673_0003268 3300047469 Bacteria 10794
532 Ga0495673_0004435 3300047469 Bacteria 8787
533 Ga0495673_0007220 3300047469 Bacteria 6421
534 Ga0495673_0027326 3300047469 Bacteria 2717
535 Ga0495673_0032918 3300047469 Bacteria 2411
536 Ga0495673_0036501 3300047469 Bacteria 2254
537 Ga0495681_0001420 3300047470 Bacteria 18007
538 Ga0495681_0003595 3300047470 Bacteria 10789
539 Ga0495681_0004503 3300047470 Bacteria 9510
540 Ga0495681_0007122 3300047470 Bacteria 7206
541 Ga0495681_0007700 3300047470 Bacteria 6834
542 Ga0495681_0014715 3300047470 Bacteria 4468
543 Ga0495681_0015879 3300047470 Bacteria 4249
544 Ga0495681_0019080 3300047470 Bacteria 3756
545 Ga0495681_0020298 3300047470 Bacteria 3608
546 Ga0495681_0086815 3300047470 Bacteria 1388
547 Ga0495684_0025102 3300047471 Bacteria 4583
548 Ga0495686_0007180 3300047472 Bacteria 8387
549 Ga0495686_0011921 3300047472 Bacteria 6109
550 Ga0495686_0031784 3300047472 Bacteria 3419
551 Ga0495686_0335063 3300047472 Bacteria 826
552 Ga0495602_0042988 3300048088 Bacteria 4113
553 Ga0495626_0000878 3300048091 Bacteria 26717
554 Ga0495626_0001166 3300048091 Bacteria 21883
555 Ga0495626_0002319 3300048091 Bacteria 13448
556 Ga0495626_0010298 3300048091 Bacteria 5001
557 Ga0495626_0012987 3300048091 Bacteria 4343
558 Ga0495626_0013521 3300048091 Bacteria 4239
559 Ga0495626_0164941 3300048091 Bacteria 926
560 Ga0496106_0036176 3300048909 Bacteria 3694
561 Ga0496112_0005396 3300048915 Bacteria 11051
562 Ga0496113_0619894 3300048916 Bacteria 866
563 Ga0496116_0000967 3300048919 Bacteria 35447
564 Ga0496116_0001797 3300048919 Bacteria 23299
565 Ga0496116_0004486 3300048919 Bacteria 13293
566 Ga0496117_0030570 3300048920 Bacteria 4129
567 Ga0496117_0037277 3300048920 Bacteria 3624
568 Ga0496117_0267552 3300048920 Bacteria 923
569 Ga0496118_0009636 3300048921 Bacteria 9716
570 Ga0496118_0034458 3300048921 Bacteria 4129
571 Ga0496118_0047066 3300048921 Bacteria 3348
572 Ga0496118_0111787 3300048921 Bacteria 1810
573 Ga0496118_0515279 3300048921 Bacteria 591
574 Ga0496120_0063297 3300048923 Bacteria 2058
575 Ga0496121_0000149 3300048924 Bacteria 153667
576 Ga0496121_0005030 3300048924 Bacteria 17288
577 Ga0496121_0032806 3300048924 Bacteria 4712
578 Ga0496121_0132252 3300048924 Bacteria 1865
579 Ga0496121_0212414 3300048924 Bacteria 1369
580 Ga0496121_0327435 3300048924 Bacteria 1029
581 Ga0496122_0001797 3300048925 Bacteria 32860
582 Ga0496122_0002387 3300048925 Bacteria 26853
583 Ga0496123_0000079 3300048926 Bacteria 191201
584 Ga0496123_0001620 3300048926 Bacteria 30319
585 Ga0496123_0029728 3300048926 Bacteria 4013
586 Ga0496124_0018537 3300048927 Bacteria 6515
587 Ga0496124_0087937 3300048927 Bacteria 2540
588 Ga0496124_0102952 3300048927 Bacteria 2309
589 Ga0496124_0555332 3300048927 Bacteria 757
590 Ga0496125_0045891 3300048928 Bacteria 3672
591 Ga0496125_0087247 3300048928 Bacteria 2357
592 Ga0496125_0202413 3300048928 Bacteria 1298
593 Ga0495678_001417 3300049459 Bacteria 18998
594 Ga0495678_005728 3300049459 Bacteria 6754
595 Ga0495678_012763 3300049459 Bacteria 3969
596 Ga0495678_014399 3300049459 Bacteria 3679
597 Ga0495678_025856 3300049459 Bacteria 2514
598 Ga0495678_026766 3300049459 Bacteria 2455
599 Ga0495678_042352 3300049459 Bacteria 1815
600 Ga0495678_049199 3300049459 Bacteria 1640
601 Ga0495678_049411 3300049459 Bacteria 1634
602 Ga0495678_057160 3300049459 Bacteria 1479
603 Ga0495682_0003039 3300049460 Bacteria 7623
604 Ga0495682_0003103 3300049460 Bacteria 7529
605 Ga0495682_0019984 3300049460 Bacteria 2515
606 Ga0495682_0038422 3300049460 Bacteria 1759
607 Ga0495682_0074956 3300049460 Bacteria 1217
608 Ga0501241_001416 3300049758 Bacteria 4898
609 Ga0501226_004230 3300049853 Bacteria 1668
610 nmdc:mga03683_53911_c1 3300050489 Bacteria 1685
611 nmdc:mga00v17_39016_c1 3300050491 Bacteria 2842
612 nmdc:mga08x19_1032860_c1 3300050514 Bacteria 584
613 nmdc:mga0sz30_164758_c1 3300050516 Bacteria 982
614 nmdc:mga0sz30_31302_c1 3300050516 Bacteria 2201
615 Ga0500572_001869 3300053111 Bacteria 5317
616 Ga0500586_014768 3300053145 Bacteria 2332
617 Ga0500586_149056 3300053145 Bacteria 800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0001203 Ga0495632_0001203_1387_1911 155
2 3300046530 Ga0495654_0070754 Ga0495654_0070754_29_553 155
3 3300046538 Ga0495609_0016777 Ga0495609_0016777_2476_3000 155
4 3300046691 Ga0495670_0000341 Ga0495670_0000341_2844_3368 155
5 3300046692 Ga0495671_0056357 Ga0495671_0056357_1360_1884 155
6 3300013100 Ga0157373_10024473 Ga0157373_100244733 157
7 3300042016 Ga0439463_001301 Ga0439463_001301_4933_5457 157
8 3300046452 Ga0495617_048180 Ga0495617_048180_430_954 157
9 3300046458 Ga0495591_009414 Ga0495591_009414_1352_1876 157
10 3300046501 Ga0495607_0013570 Ga0495607_0013570_2341_2865 157
11 3300046665 Ga0495661_0032078 Ga0495661_0032078_1388_1912 157
12 3300046810 Ga0495660_0016677 Ga0495660_0016677_2234_2758 157
13 3300047321 Ga0495676_0004902 Ga0495676_0004902_2713_3237 157
14 3300003781 Ga0055536_1000014 Ga0055536_1000014142 158
15 3300003791 Ga0055530_10000009 Ga0055530_10000009142 158
16 3300003792 Ga0055540_1000342 Ga0055540_10003427 158
17 3300025292 Ga0209676_1000003 Ga0209676_1000003761 158
18 3300025298 Ga0209050_1000004 Ga0209050_1000004743 158
19 3300025303 Ga0209051_1000006 Ga0209051_1000006232 158
20 3300030521 Ga0307511_10249150 Ga0307511_102491502 159
21 3300046453 Ga0495627_000526 Ga0495627_000526_15274_15798 159
22 3300046458 Ga0495591_002183 Ga0495591_002183_1476_2000 159
23 3300046458 Ga0495591_024836 Ga0495591_024836_675_1199 159
24 3300046513 Ga0495616_0016326 Ga0495616_0016326_1387_1911 159
25 3300046515 Ga0495620_0028389 Ga0495620_0028389_1252_1776 159
26 3300046518 Ga0495631_0152693 Ga0495631_0152693_372_896 159
27 3300046520 Ga0495637_0005001 Ga0495637_0005001_2425_2949 159
28 3300046794 Ga0495589_0320313 Ga0495589_0320313_86_610 159
29 3300047320 Ga0495672_0026600 Ga0495672_0026600_678_1202 159
30 3300047470 Ga0495681_0007122 Ga0495681_0007122_1247_1771 159
31 3300047472 Ga0495686_0031784 Ga0495686_0031784_411_935 159
32 3300033180 Ga0307510_10005559 Ga0307510_100055597 160
33 3300046491 Ga0495584_0021267 Ga0495584_0021267_1345_1869 160
34 3300046492 Ga0495585_0018763 Ga0495585_0018763_1246_1770 160
35 3300046500 Ga0495596_0025408 Ga0495596_0025408_634_1158 160
36 3300046515 Ga0495620_0083816 Ga0495620_0083816_54_578 160
37 3300046524 Ga0495648_0050379 Ga0495648_0050379_634_1158 160
38 3300047323 Ga0495683_0023939 Ga0495683_0023939_1431_1955 160
39 3300049460 Ga0495682_0074956 Ga0495682_0074956_434_958 160
40 3300005548 Ga0070665_100182627 Ga0070665_1001826272 161
41 3300009092 Ga0105250_10157357 Ga0105250_101573572 161
42 3300028379 Ga0268266_10017088 Ga0268266_100170883 161
43 3300046513 Ga0495616_0111853 Ga0495616_0111853_159_683 161
44 3300046692 Ga0495671_0045077 Ga0495671_0045077_421_972 161
45 3300047446 Ga0495679_004530 Ga0495679_004530_4452_4976 161
46 3300048091 Ga0495626_0012987 Ga0495626_0012987_2341_2865 161
47 3300009011 Ga0105251_10004238 Ga0105251_100042388 162
48 3300009011 Ga0105251_10296441 Ga0105251_102964411 162
49 3300009036 Ga0105244_10004328 Ga0105244_100043289 162
50 3300009092 Ga0105250_10087102 Ga0105250_100871022 162
51 3300009148 Ga0105243_10037251 Ga0105243_100372513 162
52 3300025728 Ga0207655_1000022 Ga0207655_1000022103 162
53 3300025735 Ga0207713_1017848 Ga0207713_10178481 162
54 3300025735 Ga0207713_1020434 Ga0207713_10204344 162
55 3300025935 Ga0207709_10036717 Ga0207709_100367173 162
56 3300042016 Ga0439463_004678 Ga0439463_004678_1147_1671 162
57 3300042129 Ga0450891_008872 Ga0450891_008872_176_664 162
58 3300042993 Ga0439440_0012065 Ga0439440_0012065_169_693 162
59 3300046616 Ga0495668_0119872 Ga0495668_0119872_88_612 162
60 3300042006 Ga0439432_004048 Ga0439432_004048_2989_3513 163
61 3300009036 Ga0105244_10051795 Ga0105244_100517953 164
62 3300013308 Ga0157375_10022998 Ga0157375_100229986 164
63 3300017792 Ga0163161_10001142 Ga0163161_100011428 164
64 3300046452 Ga0495617_012008 Ga0495617_012008_459_1010 164
65 3300046471 Ga0495650_0096642 Ga0495650_0096642_409_933 164
66 3300046491 Ga0495584_0059737 Ga0495584_0059737_983_1507 164
67 3300046492 Ga0495585_0063161 Ga0495585_0063161_1313_1837 164
68 3300046501 Ga0495607_0018559 Ga0495607_0018559_1387_1911 164
69 3300046506 Ga0495583_0003197 Ga0495583_0003197_634_1158 164
70 3300046512 Ga0495610_0008712 Ga0495610_0008712_1387_1911 164
71 3300046515 Ga0495620_0000599 Ga0495620_0000599_12921_13445 164
72 3300046518 Ga0495631_0051283 Ga0495631_0051283_156_680 164
73 3300046520 Ga0495637_0057598 Ga0495637_0057598_670_1194 164
74 3300046522 Ga0495643_0006558 Ga0495643_0006558_1526_2077 164
75 3300046523 Ga0495644_0001336 Ga0495644_0001336_2808_3332 164
76 3300046538 Ga0495609_0005907 Ga0495609_0005907_411_935 164
77 3300046648 Ga0495611_0000279 Ga0495611_0000279_14299_14850 164
78 3300046660 Ga0495625_0007727 Ga0495625_0007727_7391_7915 164
79 3300046660 Ga0495625_0147029 Ga0495625_0147029_458_982 164
80 3300046665 Ga0495661_0021330 Ga0495661_0021330_2299_2823 164
81 3300046692 Ga0495671_0368527 Ga0495671_0368527_62_586 164
82 3300046694 Ga0495649_0055093 Ga0495649_0055093_902_1426 164
83 3300046794 Ga0495589_0002197 Ga0495589_0002197_9172_9696 164
84 3300046810 Ga0495660_0114695 Ga0495660_0114695_411_935 164
85 3300046810 Ga0495660_0133884 Ga0495660_0133884_306_830 164
86 3300047470 Ga0495681_0015879 Ga0495681_0015879_2475_2999 164
87 3300049459 Ga0495678_049411 Ga0495678_049411_729_1253 164
88 3300025711 Ga0207696_1018932 Ga0207696_10189322 165
89 3300003323 rootH1_10181755 rootH1_101817553 166
90 3300041405 Ga0439438_001291 Ga0439438_001291_4953_5477 166
91 3300046491 Ga0495584_0024422 Ga0495584_0024422_2132_2656 166
92 3300044712 Ga0453684_0202873 Ga0453684_0202873_1619_2173 167
93 3300031731 Ga0307405_10009186 Ga0307405_100091862 168
94 iso_pu_bacteria 2511231006 2511265885 170
95 iso_pu_bacteria 2511231010 2511291589 170
96 iso_pu_bacteria 2511231011 2511295834 170
97 iso_pu_bacteria 2511231014 2511312345 170
98 iso_pu_bacteria 2511231015 2511322793 170
99 iso_pu_bacteria 2511231017 2511335073 170
100 iso_pu_bacteria 2511231020 2511352930 170
101 iso_pu_bacteria 2511231031 2511413892 170
102 iso_pu_bacteria 2512047018 2512323807 170
103 iso_pu_bacteria 2582580891 2583791936 170
104 iso_pu_bacteria 2597489887 2597858030 170
105 iso_pu_bacteria 2599185160 2599352875 170
106 iso_pu_bacteria 2599185161 2599359220 170
107 iso_pu_bacteria 2599185162 2599365259 170
108 iso_pu_bacteria 2599185163 2599371914 170
109 iso_pu_bacteria 2599185164 2599377983 170
110 iso_pu_bacteria 2599185165 2599384640 170
111 iso_pu_bacteria 2599185166 2599390772 170
112 iso_pu_bacteria 2599185168 2599402957 170
113 iso_pu_bacteria 2599185181 2599459709 170
114 iso_pu_bacteria 2599185182 2599465952 170
115 iso_pu_bacteria 2599185185 2599485063 170
116 iso_pu_bacteria 2599185186 2599488730 170
117 iso_pu_bacteria 2599185212 2599612891 170
118 iso_pu_bacteria 2599185248 2599773649 170
119 iso_pu_bacteria 2599185257 2599802675 170
120 iso_pu_bacteria 2599185289 2599889173 170
121 iso_pu_bacteria 2599185291 2599901227 170
122 iso_pu_bacteria 2599185302 2599943520 170
123 iso_pu_bacteria 2599185304 2599954631 170
124 iso_pu_bacteria 2599185305 2599962271 170
125 iso_pu_bacteria 2599185306 2599969348 170
126 iso_pu_bacteria 2599185308 2599979391 170
127 iso_pu_bacteria 2599185309 2599985186 170
128 iso_pu_bacteria 2599185310 2599988563 170
129 iso_pu_bacteria 2599185311 2599993402 170
130 iso_pu_bacteria 2599185312 2600002911 170
131 iso_pu_bacteria 2599185313 2600008232 170
132 iso_pu_bacteria 2599185314 2600014526 170
133 iso_pu_bacteria 2599185315 2600016160 170
134 iso_pu_bacteria 2599185316 2600021985 170
135 iso_pu_bacteria 2599185317 2600028501 170
136 iso_pu_bacteria 2599185318 2600037585 170
137 iso_pu_bacteria 2599185319 2600042819 170
138 iso_pu_bacteria 2599185320 2600049823 170
139 iso_pu_bacteria 2599185321 2600051366 170
140 iso_pu_bacteria 2599185322 2600060028 170
141 iso_pu_bacteria 2599185323 2600063250 170
142 iso_pu_bacteria 2599185324 2600070568 170
143 iso_pu_bacteria 2599185325 2600075259 170
144 iso_pu_bacteria 2599185356 2600212315 170
145 iso_pu_bacteria 2600254930 2600357668 170
146 iso_pu_bacteria 2600254931 2600366601 170
147 iso_pu_bacteria 2600255313 2601772483 170
148 iso_pu_bacteria 2600255318 2601799623 170
149 iso_pu_bacteria 2603880185 2606078143 170
150 iso_pu_bacteria 2603880199 2606130251 170
151 iso_pu_bacteria 2623620443 2624480650 170
152 iso_pu_bacteria 2643221650 2644283700 170
153 iso_pu_bacteria 2651869719 2652548566 170
154 iso_pu_bacteria 2667528170 2671094541 170
155 iso_pu_bacteria 2667528171 2671095548 170
156 iso_pu_bacteria 2667528176 2671126332 170
157 iso_pu_bacteria 2671180172 2671769704 170
158 iso_pu_bacteria 2713897148 2715751571 170
159 iso_pu_bacteria 2713897149 2715756609 170
160 iso_pu_bacteria 2718217725 2718634214 170
161 iso_pu_bacteria 2738543004 2739199482 170
162 iso_pu_bacteria 2738543015 2739257226 170
163 iso_pu_bacteria 2738543025 2739311918 170
164 iso_pu_bacteria 2740892503 2743737496 170
165 iso_pu_bacteria 2744054620 2745009985 170
166 iso_pu_bacteria 2773857673 2774133935 170
167 iso_pu_bacteria 2784132063 2784264295 170
168 iso_pu_bacteria 2791355520 2794597353 170
169 iso_pu_bacteria 2808606361 2808853751 170
170 iso_pu_bacteria 2808606376 2808922175 170
171 iso_pu_bacteria 2808606378 2808933626 170
172 iso_pu_bacteria 2808606380 2808944842 170
173 iso_pu_bacteria 2808606382 2808959472 170
174 iso_pu_bacteria 2808606383 2808962100 170
175 iso_pu_bacteria 2808606389 2808997143 170
176 iso_pu_bacteria 2808606445 2809214922 170
177 iso_pu_bacteria 2818991456 2819659557 170
178 iso_pu_bacteria 2818991464 2819700974 170
179 iso_pu_bacteria 2842832357 2842834614 170
180 iso_pu_bacteria 2842843487 2842848828 170
181 iso_pu_bacteria 2844665904 2844670710 170
182 iso_pu_bacteria 2852657418 2852657620 170
183 iso_pu_bacteria 2878029506 2878032525 170
184 iso_pu_bacteria 2904518522 2904519960 170
185 iso_pu_bacteria 2904550169 2904550292 170
186 iso_pu_bacteria 2917070673 2917073914 170
187 iso_pu_bacteria 2919063839 2919065097 170
188 iso_pu_bacteria 2919385768 2919386987 170
189 iso_pu_bacteria 2919487758 2919489067 170
190 iso_pu_bacteria 2923153595 2923156537 170
191 iso_pu_bacteria 2929144301 2929147527 170
192 iso_pu_bacteria 2931369376 2931369386 170
193 iso_pu_bacteria 2935353572 2935357031 170
194 iso_pu_bacteria 2939636861 2939638952 170
195 iso_pu_bacteria 2974289157 2974290952 170
196 iso_pu_bacteria 2984286254 2984289537 170
197 iso_pu_bacteria 2998139840 2998142868 170
198 iso_pu_bacteria 3007395558 3007395921 170
199 iso_pu_bacteria 3007419365 3007422956 170
200 iso_pu_bacteria 3007614139 3007614253 170
201 iso_pu_bacteria 3007718800 3007719176 170
202 iso_pu_bacteria 3007855910 3007856887 170
203 iso_pu_bacteria 3007861166 3007862016 170
204 iso_pu_bacteria 637000220 637320456 170
205 iso_pu_bacteria 8015687852 8015690731 170
206 iso_pu_bacteria 8029995093 8029997926 170
207 iso_pu_bacteria 8055770955 8055773868 170
208 iso_pu_bacteria 8056166840 8056168331 170
209 iso_pu_bacteria 8056172158 8056174130 170
210 iso_pu_bacteria 8056569372 8056574406 170
211 iso_pu_bacteria 8057798959 8057800616 170
212 3300042000 Ga0439437_000138 Ga0439437_000138_743_1291 173
213 3300042003 Ga0439443_010270 Ga0439443_010270_454_1002 173
214 3300042118 Ga0450914_003674 Ga0450914_003674_390_938 173
215 3300042137 Ga0450902_032415 Ga0450902_032415_84_605 173
216 3300042139 Ga0450904_001072 Ga0450904_001072_1640_2188 173
217 3300042439 Ga0439464_0239703 Ga0439464_0239703_22_543 173
218 3300042530 Ga0450916_001809 Ga0450916_001809_295_843 173
219 3300042530 Ga0450916_007797 Ga0450916_007797_116_664 173
220 3300042532 Ga0450893_0001820 Ga0450893_0001820_1328_1876 173
221 3300046542 Ga0495597_0078598 Ga0495597_0078598_280_801 173
222 3300047320 Ga0495672_0002716 Ga0495672_0002716_8729_9250 173
223 3300002737 JGI25162J39368_1000004 JGI25162J39368_100000412 174
224 3300002771 JGI25163J39215_1000047 JGI25163J39215_10000477 174
225 3300002771 JGI25163J39215_1000309 JGI25163J39215_100030910 174
226 3300002772 JGI25164J39214_1000031 JGI25164J39214_100003112 174
227 3300002772 JGI25164J39214_1000038 JGI25164J39214_100003837 174
228 3300003214 JGI25165J46597_1000011 JGI25165J46597_100001112 174
229 3300003214 JGI25165J46597_1000126 JGI25165J46597_100012637 174
230 3300003781 Ga0055536_1000047 Ga0055536_100004711 174
231 3300003781 Ga0055536_1000066 Ga0055536_100006671 174
232 3300003791 Ga0055530_10000019 Ga0055530_1000001966 174
233 3300003791 Ga0055530_10000260 Ga0055530_1000026035 174
234 3300003792 Ga0055540_1000006 Ga0055540_1000006228 174
235 3300003792 Ga0055540_1000055 Ga0055540_100005555 174
236 3300003794 Ga0055531_10000099 Ga0055531_1000009973 174
237 3300003794 Ga0055531_10000126 Ga0055531_1000012649 174
238 3300005288 Ga0065714_10001451 Ga0065714_1000145110 174
239 3300005288 Ga0065714_10016846 Ga0065714_100168462 174
240 3300005288 Ga0065714_10066538 Ga0065714_100665386 174
241 3300005288 Ga0065714_10160669 Ga0065714_101606691 174
242 3300005289 Ga0065704_10071346 Ga0065704_100713465 174
243 3300005353 Ga0070669_100035828 Ga0070669_1000358283 174
244 3300005457 Ga0070662_100116638 Ga0070662_1001166383 174
245 3300006048 Ga0075363_100238880 Ga0075363_1002388802 174
246 3300006051 Ga0075364_10082983 Ga0075364_100829832 174
247 3300006058 Ga0075432_10009192 Ga0075432_100091925 174
248 3300006058 Ga0075432_10009806 Ga0075432_100098062 174
249 3300006058 Ga0075432_10017096 Ga0075432_100170963 174
250 3300006058 Ga0075432_10082653 Ga0075432_100826531 174
251 3300006177 Ga0075362_10063307 Ga0075362_100633072 174
252 3300006177 Ga0075362_10065800 Ga0075362_100658001 174
253 3300006177 Ga0075362_10189527 Ga0075362_101895272 174
254 3300006186 Ga0075369_10019870 Ga0075369_100198702 174
255 3300006914 Ga0075436_100123601 Ga0075436_1001236013 174
256 3300006946 Ga0079104_1000235 Ga0079104_100023527 174
257 3300006946 Ga0079104_1014386 Ga0079104_10143862 174
258 3300006946 Ga0079104_1016543 Ga0079104_10165433 174
259 3300006948 Ga0099826_10052808 Ga0099826_100528083 174
260 3300009011 Ga0105251_10000001 Ga0105251_1000000117 174
261 3300009011 Ga0105251_10126196 Ga0105251_101261962 174
262 3300009036 Ga0105244_10003273 Ga0105244_100032734 174
263 3300009036 Ga0105244_10011703 Ga0105244_100117036 174
264 3300009036 Ga0105244_10023650 Ga0105244_100236502 174
265 3300009036 Ga0105244_10030611 Ga0105244_100306113 174
266 3300009036 Ga0105244_10049418 Ga0105244_100494183 174
267 3300009036 Ga0105244_10110624 Ga0105244_101106242 174
268 3300009036 Ga0105244_10133825 Ga0105244_101338252 174
269 3300009092 Ga0105250_10001069 Ga0105250_1000106916 174
270 3300009092 Ga0105250_10014243 Ga0105250_100142433 174
271 3300009092 Ga0105250_10029066 Ga0105250_100290663 174
272 3300009092 Ga0105250_10074209 Ga0105250_100742092 174
273 3300009148 Ga0105243_10000026 Ga0105243_10000026168 174
274 3300009148 Ga0105243_10006152 Ga0105243_100061528 174
275 3300009148 Ga0105243_10148936 Ga0105243_101489362 174
276 3300011119 Ga0105246_10000009 Ga0105246_1000000946 174
277 3300012498 Ga0157345_1000047 Ga0157345_100004710 174
278 3300013100 Ga0157373_10001411 Ga0157373_1000141110 174
279 3300013100 Ga0157373_10012229 Ga0157373_100122292 174
280 3300013100 Ga0157373_10024286 Ga0157373_100242863 174
281 3300013100 Ga0157373_10153251 Ga0157373_101532512 174
282 3300013100 Ga0157373_10195433 Ga0157373_101954332 174
283 3300013100 Ga0157373_10345213 Ga0157373_103452132 174
284 3300013100 Ga0157373_10474590 Ga0157373_104745901 174
285 3300013102 Ga0157371_10003166 Ga0157371_1000316611 174
286 3300013102 Ga0157371_10004269 Ga0157371_100042693 174
287 3300013104 Ga0157370_10004472 Ga0157370_1000447211 174
288 3300013104 Ga0157370_10164833 Ga0157370_101648333 174
289 3300013104 Ga0157370_10620986 Ga0157370_106209862 174
290 3300013105 Ga0157369_10091194 Ga0157369_100911944 174
291 3300013105 Ga0157369_10163861 Ga0157369_101638613 174
292 3300013105 Ga0157369_10714623 Ga0157369_107146231 174
293 3300013306 Ga0163162_10005958 Ga0163162_1000595811 174
294 3300013306 Ga0163162_10015467 Ga0163162_100154677 174
295 3300013306 Ga0163162_10246787 Ga0163162_102467872 174
296 3300013307 Ga0157372_10007608 Ga0157372_1000760812 174
297 3300014497 Ga0182008_10000862 Ga0182008_100008625 174
298 3300014497 Ga0182008_10004640 Ga0182008_100046407 174
299 3300014497 Ga0182008_10007234 Ga0182008_100072343 174
300 3300014497 Ga0182008_10053179 Ga0182008_100531793 174
301 3300014497 Ga0182008_10367938 Ga0182008_103679381 174
302 3300015261 Ga0182006_1001493 Ga0182006_10014932 174
303 3300015261 Ga0182006_1003466 Ga0182006_10034667 174
304 3300015261 Ga0182006_1023939 Ga0182006_10239393 174
305 3300015261 Ga0182006_1065134 Ga0182006_10651342 174
306 3300015265 Ga0182005_1006208 Ga0182005_10062083 174
307 3300015265 Ga0182005_1008215 Ga0182005_10082154 174
308 3300015265 Ga0182005_1010089 Ga0182005_10100892 174
309 3300015265 Ga0182005_1015836 Ga0182005_10158363 174
310 3300015265 Ga0182005_1021009 Ga0182005_10210092 174
311 3300015265 Ga0182005_1032356 Ga0182005_10323561 174
312 3300017792 Ga0163161_10003618 Ga0163161_1000361811 174
313 3300017792 Ga0163161_10014808 Ga0163161_100148083 174
314 3300017792 Ga0163161_10307088 Ga0163161_103070882 174
315 3300025207 Ga0209760_100032 Ga0209760_100032125 174
316 3300025207 Ga0209760_100036 Ga0209760_10003634 174
317 3300025230 Ga0209563_100262 Ga0209563_10026212 174
318 3300025231 Ga0207427_100003 Ga0207427_10000312 174
319 3300025231 Ga0207427_100004 Ga0207427_100004130 174
320 3300025233 Ga0209437_100002 Ga0209437_1000021001 174
321 3300025233 Ga0209437_100025 Ga0209437_100025353 174
322 3300025261 Ga0209233_1000004 Ga0209233_1000004424 174
323 3300025261 Ga0209233_1000145 Ga0209233_1000145130 174
324 3300025291 Ga0209675_1006638 Ga0209675_10066383 174
325 3300025292 Ga0209676_1000002 Ga0209676_10000021192 174
326 3300025292 Ga0209676_1000158 Ga0209676_100015868 174
327 3300025292 Ga0209676_1003638 Ga0209676_10036384 174
328 3300025298 Ga0209050_1000006 Ga0209050_1000006378 174
329 3300025298 Ga0209050_1000013 Ga0209050_100001367 174
330 3300025303 Ga0209051_1000001 Ga0209051_10000011192 174
331 3300025303 Ga0209051_1000007 Ga0209051_100000767 174
332 3300025304 Ga0209257_1000029 Ga0209257_1000029378 174
333 3300025304 Ga0209257_1011660 Ga0209257_10116606 174
334 3300025711 Ga0207696_1000002 Ga0207696_1000002647 174
335 3300025711 Ga0207696_1005013 Ga0207696_10050137 174
336 3300025711 Ga0207696_1008159 Ga0207696_10081593 174
337 3300025728 Ga0207655_1000379 Ga0207655_10003794 174
338 3300025728 Ga0207655_1002110 Ga0207655_100211014 174
339 3300025728 Ga0207655_1007288 Ga0207655_10072886 174
340 3300025728 Ga0207655_1017128 Ga0207655_10171283 174
341 3300025728 Ga0207655_1037712 Ga0207655_10377123 174
342 3300025735 Ga0207713_1000107 Ga0207713_100010753 174
343 3300025735 Ga0207713_1008948 Ga0207713_10089483 174
344 3300025735 Ga0207713_1010025 Ga0207713_10100252 174
345 3300025735 Ga0207713_1048696 Ga0207713_10486962 174
346 3300025735 Ga0207713_1097623 Ga0207713_10976232 174
347 3300025933 Ga0207706_10133158 Ga0207706_101331583 174
348 3300025935 Ga0207709_10000004 Ga0207709_10000004306 174
349 3300025935 Ga0207709_10003056 Ga0207709_100030563 174
350 3300025935 Ga0207709_10085565 Ga0207709_100855653 174
351 3300027111 Ga0209281_1000009 Ga0209281_1000009407 174
352 3300027111 Ga0209281_1000046 Ga0209281_1000046250 174
353 3300027111 Ga0209281_1009163 Ga0209281_10091633 174
354 3300027111 Ga0209281_1011740 Ga0209281_10117403 174
355 3300027111 Ga0209281_1014925 Ga0209281_10149252 174
356 3300027111 Ga0209281_1024558 Ga0209281_10245581 174
357 3300027111 Ga0209281_1025009 Ga0209281_10250091 174
358 3300027907 Ga0207428_10013522 Ga0207428_100135226 174
359 3300027907 Ga0207428_10039237 Ga0207428_100392372 174
360 3300027907 Ga0207428_10077633 Ga0207428_100776334 174
361 3300027907 Ga0207428_10145150 Ga0207428_101451502 174
362 3300027907 Ga0207428_10222295 Ga0207428_102222952 174
363 3300030521 Ga0307511_10127912 Ga0307511_101279122 174
364 3300030744 Ga0316181_1093407 Ga0316181_10934072 174
365 3300031548 Ga0307408_100002496 Ga0307408_1000024967 174
366 3300031548 Ga0307408_100012760 Ga0307408_1000127605 174
367 3300031548 Ga0307408_100026059 Ga0307408_1000260593 174
368 3300031548 Ga0307408_100029730 Ga0307408_1000297304 174
369 3300031548 Ga0307408_100066794 Ga0307408_1000667943 174
370 3300031548 Ga0307408_100752274 Ga0307408_1007522741 174
371 3300031730 Ga0307516_10516871 Ga0307516_105168712 174
372 3300031901 Ga0307406_10212705 Ga0307406_102127052 174
373 3300031903 Ga0307407_10165816 Ga0307407_101658162 174
374 3300031903 Ga0307407_10254168 Ga0307407_102541682 174
375 3300031911 Ga0307412_10002602 Ga0307412_100026028 174
376 3300031911 Ga0307412_10005232 Ga0307412_100052327 174
377 3300031911 Ga0307412_10035334 Ga0307412_100353344 174
378 3300031911 Ga0307412_10103033 Ga0307412_101030332 174
379 3300031911 Ga0307412_10236032 Ga0307412_102360322 174
380 3300031911 Ga0307412_10249098 Ga0307412_102490982 174
381 3300031911 Ga0307412_10557582 Ga0307412_105575822 174
382 3300031995 Ga0307409_100235690 Ga0307409_1002356902 174
383 3300032002 Ga0307416_100924060 Ga0307416_1009240602 174
384 3300032002 Ga0307416_101677963 Ga0307416_1016779632 174
385 3300032004 Ga0307414_10042967 Ga0307414_100429672 174
386 3300032005 Ga0307411_10009535 Ga0307411_100095353 174
387 3300032005 Ga0307411_10780919 Ga0307411_107809192 174
388 3300038705 Ga0237819_01613 Ga0237819_01613_1804_2328 174
389 3300041405 Ga0439438_000033 Ga0439438_000033_23291_23815 174
390 3300041405 Ga0439438_000602 Ga0439438_000602_9132_9656 174
391 3300041405 Ga0439438_002841 Ga0439438_002841_5932_6456 174
392 3300041405 Ga0439438_002922 Ga0439438_002922_1167_1718 174
393 3300041405 Ga0439438_003150 Ga0439438_003150_3628_4152 174
394 3300041405 Ga0439438_003978 Ga0439438_003978_2203_2727 174
395 3300041405 Ga0439438_008861 Ga0439438_008861_1159_1683 174
396 3300041407 Ga0439447_002247 Ga0439447_002247_4385_4909 174
397 3300041407 Ga0439447_016487 Ga0439447_016487_1438_1962 174
398 3300041411 Ga0439466_0005263 Ga0439466_0005263_1634_2158 174
399 3300041411 Ga0439466_0007234 Ga0439466_0007234_2990_3514 174
400 3300041411 Ga0439466_0013623 Ga0439466_0013623_631_1155 174
401 3300041411 Ga0439466_0027547 Ga0439466_0027547_41_565 174
402 3300041997 Ga0439431_0000950 Ga0439431_0000950_2843_3367 174
403 3300042004 Ga0439445_0015468 Ga0439445_0015468_1266_1790 174
404 3300042006 Ga0439432_000429 Ga0439432_000429_4904_5428 174
405 3300042006 Ga0439432_007045 Ga0439432_007045_1366_1917 174
406 3300042006 Ga0439432_032469 Ga0439432_032469_673_1197 174
407 3300042006 Ga0439432_033339 Ga0439432_033339_786_1310 174
408 3300042006 Ga0439432_033854 Ga0439432_033854_1095_1619 174
409 3300042006 Ga0439432_047059 Ga0439432_047059_293_817 174
410 3300042006 Ga0439432_065757 Ga0439432_065757_14_538 174
411 3300042009 Ga0439451_034380 Ga0439451_034380_310_834 174
412 3300042010 Ga0439452_000236 Ga0439452_000236_17046_17570 174
413 3300042010 Ga0439452_000723 Ga0439452_000723_4702_5226 174
414 3300042010 Ga0439452_001102 Ga0439452_001102_2800_3324 174
415 3300042010 Ga0439452_006972 Ga0439452_006972_113_637 174
416 3300042013 Ga0439456_000991 Ga0439456_000991_2594_3118 174
417 3300042013 Ga0439456_003684 Ga0439456_003684_2140_2664 174
418 3300042016 Ga0439463_020989 Ga0439463_020989_301_825 174
419 3300042016 Ga0439463_021396 Ga0439463_021396_1066_1590 174
420 3300042016 Ga0439463_037727 Ga0439463_037727_612_1136 174
421 3300042115 Ga0450911_000219 Ga0450911_000219_12678_13202 174
422 3300042124 Ga0450922_000134 Ga0450922_000134_5767_6318 174
423 3300042137 Ga0450902_003102 Ga0450902_003102_860_1384 174
424 3300042138 Ga0450903_001464 Ga0450903_001464_2771_3295 174
425 3300042138 Ga0450903_005368 Ga0450903_005368_290_814 174
426 3300042139 Ga0450904_001779 Ga0450904_001779_2295_2819 174
427 3300042145 Ga0450906_002134 Ga0450906_002134_2954_3478 174
428 3300042145 Ga0450906_002286 Ga0450906_002286_134_685 174
429 3300042146 Ga0450907_014327 Ga0450907_014327_704_1228 174
430 3300042146 Ga0450907_036031 Ga0450907_036031_231_755 174
431 3300042156 Ga0439446_0007713 Ga0439446_0007713_1225_1749 174
432 3300042531 Ga0450918_011606 Ga0450918_011606_737_1261 174
433 3300042993 Ga0439440_0010264 Ga0439440_0010264_1232_1756 174
434 3300046452 Ga0495617_001725 Ga0495617_001725_1373_1924 174
435 3300046452 Ga0495617_016529 Ga0495617_016529_232_783 174
436 3300046452 Ga0495617_025012 Ga0495617_025012_1286_1810 174
437 3300046452 Ga0495617_027823 Ga0495617_027823_1260_1784 174
438 3300046452 Ga0495617_028165 Ga0495617_028165_518_1069 174
439 3300046452 Ga0495617_031509 Ga0495617_031509_689_1240 174
440 3300046452 Ga0495617_053990 Ga0495617_053990_251_775 174
441 3300046452 Ga0495617_125428 Ga0495617_125428_95_652 174
442 3300046453 Ga0495627_003123 Ga0495627_003123_1383_1934 174
443 3300046453 Ga0495627_003208 Ga0495627_003208_1337_1861 174
444 3300046453 Ga0495627_015090 Ga0495627_015090_592_1125 174
445 3300046453 Ga0495627_094564 Ga0495627_094564_227_784 174
446 3300046453 Ga0495627_107563 Ga0495627_107563_193_744 174
447 3300046454 Ga0495592_0072863 Ga0495592_0072863_1279_1803 174
448 3300046457 Ga0495590_0001440 Ga0495590_0001440_1391_1915 174
449 3300046458 Ga0495591_000217 Ga0495591_000217_48034_48567 174
450 3300046458 Ga0495591_000221 Ga0495591_000221_13982_14506 174
451 3300046458 Ga0495591_003994 Ga0495591_003994_1351_1902 174
452 3300046458 Ga0495591_008777 Ga0495591_008777_2801_3358 174
453 3300046458 Ga0495591_014101 Ga0495591_014101_2010_2534 174
454 3300046458 Ga0495591_014394 Ga0495591_014394_703_1227 174
455 3300046460 Ga0495638_0003901 Ga0495638_0003901_1386_1943 174
456 3300046460 Ga0495638_0007483 Ga0495638_0007483_5780_6304 174
457 3300046460 Ga0495638_0009433 Ga0495638_0009433_2717_3268 174
458 3300046460 Ga0495638_0010691 Ga0495638_0010691_1344_1895 174
459 3300046460 Ga0495638_0041390 Ga0495638_0041390_1973_2497 174
460 3300046460 Ga0495638_0050735 Ga0495638_0050735_346_870 174
461 3300046460 Ga0495638_0072827 Ga0495638_0072827_1126_1650 174
462 3300046460 Ga0495638_0121812 Ga0495638_0121812_769_1293 174
463 3300046463 Ga0495653_0003922 Ga0495653_0003922_10878_11402 174
464 3300046471 Ga0495650_0002813 Ga0495650_0002813_10841_11392 174
465 3300046471 Ga0495650_0004151 Ga0495650_0004151_8237_8761 174
466 3300046471 Ga0495650_0009249 Ga0495650_0009249_3923_4480 174
467 3300046471 Ga0495650_0025602 Ga0495650_0025602_886_1410 174
468 3300046471 Ga0495650_0048266 Ga0495650_0048266_820_1344 174
469 3300046474 Ga0495605_0001217 Ga0495605_0001217_6930_7454 174
470 3300046474 Ga0495605_0002711 Ga0495605_0002711_8947_9471 174
471 3300046474 Ga0495605_0007676 Ga0495605_0007676_427_984 174
472 3300046474 Ga0495605_0017848 Ga0495605_0017848_606_1130 174
473 3300046474 Ga0495605_0024361 Ga0495605_0024361_1293_1817 174
474 3300046474 Ga0495605_0040541 Ga0495605_0040541_1311_1835 174
475 3300046475 Ga0495639_0006247 Ga0495639_0006247_3687_4211 174
476 3300046491 Ga0495584_0011208 Ga0495584_0011208_1211_1735 174
477 3300046491 Ga0495584_0012104 Ga0495584_0012104_3294_3818 174
478 3300046491 Ga0495584_0034524 Ga0495584_0034524_307_864 174
479 3300046492 Ga0495585_0006273 Ga0495585_0006273_2763_3287 174
480 3300046492 Ga0495585_0007031 Ga0495585_0007031_5297_5821 174
481 3300046492 Ga0495585_0018925 Ga0495585_0018925_2843_3394 174
482 3300046492 Ga0495585_0022378 Ga0495585_0022378_1630_2154 174
483 3300046492 Ga0495585_0031157 Ga0495585_0031157_1181_1732 174
484 3300046499 Ga0495594_0001641 Ga0495594_0001641_7339_7863 174
485 3300046500 Ga0495596_0026886 Ga0495596_0026886_444_995 174
486 3300046500 Ga0495596_0034547 Ga0495596_0034547_1380_1904 174
487 3300046501 Ga0495607_0003241 Ga0495607_0003241_961_1518 174
488 3300046501 Ga0495607_0003656 Ga0495607_0003656_8375_8899 174
489 3300046501 Ga0495607_0003814 Ga0495607_0003814_9526_10050 174
490 3300046501 Ga0495607_0059009 Ga0495607_0059009_1225_1749 174
491 3300046501 Ga0495607_0067117 Ga0495607_0067117_1231_1755 174
492 3300046501 Ga0495607_0085517 Ga0495607_0085517_932_1456 174
493 3300046501 Ga0495607_0100685 Ga0495607_0100685_807_1331 174
494 3300046501 Ga0495607_0338640 Ga0495607_0338640_11_538 174
495 3300046507 Ga0495606_0002514 Ga0495606_0002514_9643_10167 174
496 3300046507 Ga0495606_0004699 Ga0495606_0004699_8697_9254 174
497 3300046507 Ga0495606_0007684 Ga0495606_0007684_7057_7581 174
498 3300046507 Ga0495606_0030628 Ga0495606_0030628_2543_3067 174
499 3300046507 Ga0495606_0080236 Ga0495606_0080236_689_1213 174
500 3300046507 Ga0495606_0414133 Ga0495606_0414133_10_534 174
501 3300046512 Ga0495610_0006331 Ga0495610_0006331_1634_2191 174
502 3300046512 Ga0495610_0014407 Ga0495610_0014407_1899_2423 174
503 3300046512 Ga0495610_0032014 Ga0495610_0032014_876_1400 174
504 3300046512 Ga0495610_0032594 Ga0495610_0032594_1589_2113 174
505 3300046512 Ga0495610_0035950 Ga0495610_0035950_1312_1836 174
506 3300046513 Ga0495616_0000893 Ga0495616_0000893_11986_12510 174
507 3300046513 Ga0495616_0003092 Ga0495616_0003092_1325_1849 174
508 3300046513 Ga0495616_0007274 Ga0495616_0007274_5220_5771 174
509 3300046513 Ga0495616_0013673 Ga0495616_0013673_1335_1886 174
510 3300046513 Ga0495616_0022361 Ga0495616_0022361_1643_2167 174
511 3300046513 Ga0495616_0039776 Ga0495616_0039776_1197_1754 174
512 3300046513 Ga0495616_0240828 Ga0495616_0240828_203_727 174
513 3300046515 Ga0495620_0000669 Ga0495620_0000669_12768_13325 174
514 3300046515 Ga0495620_0001608 Ga0495620_0001608_3550_4074 174
515 3300046515 Ga0495620_0009422 Ga0495620_0009422_2694_3218 174
516 3300046515 Ga0495620_0014572 Ga0495620_0014572_941_1492 174
517 3300046515 Ga0495620_0016483 Ga0495620_0016483_765_1316 174
518 3300046515 Ga0495620_0031236 Ga0495620_0031236_1333_1857 174
519 3300046515 Ga0495620_0042008 Ga0495620_0042008_535_1059 174
520 3300046518 Ga0495631_0000565 Ga0495631_0000565_15527_16051 174
521 3300046518 Ga0495631_0001729 Ga0495631_0001729_9696_10220 174
522 3300046518 Ga0495631_0056831 Ga0495631_0056831_826_1350 174
523 3300046518 Ga0495631_0059219 Ga0495631_0059219_945_1469 174
524 3300046518 Ga0495631_0097722 Ga0495631_0097722_535_1059 174
525 3300046518 Ga0495631_0123109 Ga0495631_0123109_443_967 174
526 3300046519 Ga0495632_0003322 Ga0495632_0003322_2681_3238 174
527 3300046519 Ga0495632_0007002 Ga0495632_0007002_4971_5495 174
528 3300046519 Ga0495632_0154823 Ga0495632_0154823_360_884 174
529 3300046519 Ga0495632_0160985 Ga0495632_0160985_462_1013 174
530 3300046519 Ga0495632_0180256 Ga0495632_0180256_306_830 174
531 3300046520 Ga0495637_0001999 Ga0495637_0001999_5667_6191 174
532 3300046520 Ga0495637_0005542 Ga0495637_0005542_4528_5052 174
533 3300046520 Ga0495637_0013340 Ga0495637_0013340_1855_2379 174
534 3300046520 Ga0495637_0016540 Ga0495637_0016540_14_538 174
535 3300046520 Ga0495637_0021429 Ga0495637_0021429_203_754 174
536 3300046520 Ga0495637_0030814 Ga0495637_0030814_1167_1691 174
537 3300046520 Ga0495637_0063662 Ga0495637_0063662_447_1004 174
538 3300046520 Ga0495637_0075912 Ga0495637_0075912_163_687 174
539 3300046520 Ga0495637_0104093 Ga0495637_0104093_13_537 174
540 3300046522 Ga0495643_0030251 Ga0495643_0030251_877_1401 174
541 3300046522 Ga0495643_0095871 Ga0495643_0095871_111_635 174
542 3300046522 Ga0495643_0359994 Ga0495643_0359994_52_603 174
543 3300046524 Ga0495648_0000042 Ga0495648_0000042_169582_170106 174
544 3300046524 Ga0495648_0002710 Ga0495648_0002710_3432_3956 174
545 3300046524 Ga0495648_0002983 Ga0495648_0002983_11955_12479 174
546 3300046524 Ga0495648_0004180 Ga0495648_0004180_2728_3252 174
547 3300046524 Ga0495648_0004206 Ga0495648_0004206_6940_7464 174
548 3300046524 Ga0495648_0011301 Ga0495648_0011301_3584_4135 174
549 3300046524 Ga0495648_0011471 Ga0495648_0011471_2724_3248 174
550 3300046524 Ga0495648_0014407 Ga0495648_0014407_1180_1704 174
551 3300046524 Ga0495648_0030154 Ga0495648_0030154_2465_3016 174
552 3300046524 Ga0495648_0084332 Ga0495648_0084332_995_1519 174
553 3300046528 Ga0495642_0000856 Ga0495642_0000856_7448_7972 174
554 3300046530 Ga0495654_0000846 Ga0495654_0000846_13612_14136 174
555 3300046530 Ga0495654_0005323 Ga0495654_0005323_4203_4727 174
556 3300046530 Ga0495654_0012049 Ga0495654_0012049_1490_2014 174
557 3300046530 Ga0495654_0018566 Ga0495654_0018566_486_1037 174
558 3300046530 Ga0495654_0019863 Ga0495654_0019863_980_1537 174
559 3300046530 Ga0495654_0045913 Ga0495654_0045913_528_1052 174
560 3300046530 Ga0495654_0102047 Ga0495654_0102047_445_969 174
561 3300046530 Ga0495654_0109425 Ga0495654_0109425_328_852 174
562 3300046536 Ga0495587_0356230 Ga0495587_0356230_259_783 174
563 3300046538 Ga0495609_0005803 Ga0495609_0005803_2087_2638 174
564 3300046538 Ga0495609_0010321 Ga0495609_0010321_2629_3180 174
565 3300046538 Ga0495609_0013211 Ga0495609_0013211_947_1498 174
566 3300046538 Ga0495609_0014071 Ga0495609_0014071_2789_3313 174
567 3300046538 Ga0495609_0076156 Ga0495609_0076156_260_784 174
568 3300046538 Ga0495609_0185412 Ga0495609_0185412_242_766 174
569 3300046542 Ga0495597_0003616 Ga0495597_0003616_2678_3229 174
570 3300046542 Ga0495597_0011450 Ga0495597_0011450_1570_2094 174
571 3300046542 Ga0495597_0032745 Ga0495597_0032745_563_1114 174
572 3300046542 Ga0495597_0075202 Ga0495597_0075202_695_1225 174
573 3300046542 Ga0495597_0106236 Ga0495597_0106236_507_1064 174
574 3300046543 Ga0495645_0031027 Ga0495645_0031027_1326_1850 174
575 3300046557 Ga0495622_0001382 Ga0495622_0001382_9174_9698 174
576 3300046557 Ga0495622_0006971 Ga0495622_0006971_1211_1735 174
577 3300046558 Ga0495633_0004263 Ga0495633_0004263_1008_1559 174
578 3300046558 Ga0495633_0004510 Ga0495633_0004510_5671_6195 174
579 3300046616 Ga0495668_0010559 Ga0495668_0010559_4857_5399 174
580 3300046616 Ga0495668_0398466 Ga0495668_0398466_79_603 174
581 3300046642 Ga0495634_0042155 Ga0495634_0042155_1215_1739 174
582 3300046648 Ga0495611_0048479 Ga0495611_0048479_28_579 174
583 3300046648 Ga0495611_0131902 Ga0495611_0131902_10_534 174
584 3300046660 Ga0495625_0003170 Ga0495625_0003170_1574_2098 174
585 3300046660 Ga0495625_0005996 Ga0495625_0005996_9012_9536 174
586 3300046660 Ga0495625_0018142 Ga0495625_0018142_811_1362 174
587 3300046660 Ga0495625_0064317 Ga0495625_0064317_1659_2216 174
588 3300046660 Ga0495625_0098979 Ga0495625_0098979_1322_1846 174
589 3300046660 Ga0495625_0700727 Ga0495625_0700727_17_568 174
590 3300046665 Ga0495661_0001563 Ga0495661_0001563_2102_2659 174
591 3300046665 Ga0495661_0012767 Ga0495661_0012767_981_1505 174
592 3300046665 Ga0495661_0035745 Ga0495661_0035745_1436_1960 174
593 3300046665 Ga0495661_0058942 Ga0495661_0058942_379_903 174
594 3300046665 Ga0495661_0138198 Ga0495661_0138198_366_890 174
595 3300046674 Ga0495588_0236199 Ga0495588_0236199_348_872 174
596 3300046680 Ga0495646_0007762 Ga0495646_0007762_969_1493 174
597 3300046684 Ga0495669_0017549 Ga0495669_0017549_2508_3059 174
598 3300046689 Ga0495613_0029335 Ga0495613_0029335_2215_2739 174
599 3300046689 Ga0495613_0082251 Ga0495613_0082251_373_924 174
600 3300046690 Ga0495624_0001132 Ga0495624_0001132_9680_10204 174
601 3300046690 Ga0495624_0147729 Ga0495624_0147729_508_1059 174
602 3300046691 Ga0495670_0001896 Ga0495670_0001896_5556_6080 174
603 3300046691 Ga0495670_0003131 Ga0495670_0003131_2758_3309 174
604 3300046691 Ga0495670_0004379 Ga0495670_0004379_1613_2137 174
605 3300046691 Ga0495670_0008464 Ga0495670_0008464_806_1363 174
606 3300046692 Ga0495671_0002629 Ga0495671_0002629_6414_6938 174
607 3300046692 Ga0495671_0005124 Ga0495671_0005124_1523_2047 174
608 3300046692 Ga0495671_0006906 Ga0495671_0006906_2424_2948 174
609 3300046692 Ga0495671_0016132 Ga0495671_0016132_1310_1861 174
610 3300046692 Ga0495671_0049387 Ga0495671_0049387_277_801 174
611 3300046694 Ga0495649_0002330 Ga0495649_0002330_687_1211 174
612 3300046694 Ga0495649_0013048 Ga0495649_0013048_3009_3566 174
613 3300046694 Ga0495649_0013057 Ga0495649_0013057_406_930 174
614 3300046694 Ga0495649_0016101 Ga0495649_0016101_2658_3209 174
615 3300046694 Ga0495649_0028694 Ga0495649_0028694_406_930 174
616 3300046694 Ga0495649_0030490 Ga0495649_0030490_432_956 174
617 3300046694 Ga0495649_0039000 Ga0495649_0039000_902_1453 174
618 3300046694 Ga0495649_0086373 Ga0495649_0086373_388_939 174
619 3300046794 Ga0495589_0001102 Ga0495589_0001102_14915_15439 174
620 3300046794 Ga0495589_0018042 Ga0495589_0018042_482_1006 174
621 3300046794 Ga0495589_0020201 Ga0495589_0020201_1533_2057 174
622 3300046809 Ga0495600_0001741 Ga0495600_0001741_2673_3197 174
623 3300046810 Ga0495660_0005776 Ga0495660_0005776_5518_6042 174
624 3300046810 Ga0495660_0014625 Ga0495660_0014625_2023_2547 174
625 3300046810 Ga0495660_0040420 Ga0495660_0040420_888_1412 174
626 3300046810 Ga0495660_0047858 Ga0495660_0047858_432_956 174
627 3300046810 Ga0495660_0080949 Ga0495660_0080949_175_699 174
628 3300046810 Ga0495660_0086674 Ga0495660_0086674_706_1263 174
629 3300046810 Ga0495660_0131634 Ga0495660_0131634_267_791 174
630 3300046810 Ga0495660_0246627 Ga0495660_0246627_23_547 174
631 3300046810 Ga0495660_0320306 Ga0495660_0320306_36_560 174
632 3300047317 Ga0495604_0004784 Ga0495604_0004784_8903_9427 174
633 3300047320 Ga0495672_0001619 Ga0495672_0001619_10935_11459 174
634 3300047320 Ga0495672_0001840 Ga0495672_0001840_12762_13286 174
635 3300047320 Ga0495672_0015027 Ga0495672_0015027_1353_1904 174
636 3300047320 Ga0495672_0020267 Ga0495672_0020267_2775_3326 174
637 3300047320 Ga0495672_0034212 Ga0495672_0034212_1876_2427 174
638 3300047320 Ga0495672_0167509 Ga0495672_0167509_450_974 174
639 3300047321 Ga0495676_0037142 Ga0495676_0037142_2184_2708 174
640 3300047322 Ga0495680_0033821 Ga0495680_0033821_2660_3184 174
641 3300047323 Ga0495683_0000669 Ga0495683_0000669_15474_16025 174
642 3300047323 Ga0495683_0001163 Ga0495683_0001163_14946_15470 174
643 3300047323 Ga0495683_0017795 Ga0495683_0017795_202_726 174
644 3300047323 Ga0495683_0030509 Ga0495683_0030509_1325_1849 174
645 3300047323 Ga0495683_0039116 Ga0495683_0039116_689_1213 174
646 3300047323 Ga0495683_0054458 Ga0495683_0054458_187_711 174
647 3300047443 Ga0495687_003088 Ga0495687_003088_7007_7558 174
648 3300047443 Ga0495687_003921 Ga0495687_003921_3215_3766 174
649 3300047446 Ga0495679_001980 Ga0495679_001980_1338_1889 174
650 3300047446 Ga0495679_007738 Ga0495679_007738_2890_3447 174
651 3300047469 Ga0495673_0001005 Ga0495673_0001005_15634_16185 174
652 3300047469 Ga0495673_0001180 Ga0495673_0001180_12773_13330 174
653 3300047469 Ga0495673_0001453 Ga0495673_0001453_16857_17399 174
654 3300047469 Ga0495673_0001533 Ga0495673_0001533_12342_12866 174
655 3300047469 Ga0495673_0003268 Ga0495673_0003268_8797_9354 174
656 3300047469 Ga0495673_0004435 Ga0495673_0004435_5555_6079 174
657 3300047469 Ga0495673_0007220 Ga0495673_0007220_4660_5211 174
658 3300047469 Ga0495673_0027326 Ga0495673_0027326_102_653 174
659 3300047469 Ga0495673_0032918 Ga0495673_0032918_1326_1877 174
660 3300047469 Ga0495673_0036501 Ga0495673_0036501_1463_1987 174
661 3300047470 Ga0495681_0001420 Ga0495681_0001420_7014_7565 174
662 3300047470 Ga0495681_0003595 Ga0495681_0003595_1325_1849 174
663 3300047470 Ga0495681_0004503 Ga0495681_0004503_1977_2501 174
664 3300047470 Ga0495681_0007700 Ga0495681_0007700_1589_2113 174
665 3300047470 Ga0495681_0014715 Ga0495681_0014715_3780_4310 174
666 3300047470 Ga0495681_0019080 Ga0495681_0019080_1312_1863 174
667 3300047470 Ga0495681_0020298 Ga0495681_0020298_1335_1886 174
668 3300047470 Ga0495681_0086815 Ga0495681_0086815_413_937 174
669 3300047471 Ga0495684_0025102 Ga0495684_0025102_2473_2997 174
670 3300047472 Ga0495686_0007180 Ga0495686_0007180_5824_6348 174
671 3300047472 Ga0495686_0011921 Ga0495686_0011921_2732_3256 174
672 3300047472 Ga0495686_0335063 Ga0495686_0335063_134_658 174
673 3300048088 Ga0495602_0042988 Ga0495602_0042988_2239_2763 174
674 3300048091 Ga0495626_0000878 Ga0495626_0000878_17018_17575 174
675 3300048091 Ga0495626_0001166 Ga0495626_0001166_9035_9559 174
676 3300048091 Ga0495626_0002319 Ga0495626_0002319_7480_8004 174
677 3300048091 Ga0495626_0010298 Ga0495626_0010298_1752_2276 174
678 3300048091 Ga0495626_0013521 Ga0495626_0013521_2355_2879 174
679 3300048091 Ga0495626_0164941 Ga0495626_0164941_186_710 174
680 3300048909 Ga0496106_0036176 Ga0496106_0036176_1518_2069 174
681 3300048915 Ga0496112_0005396 Ga0496112_0005396_3359_3883 174
682 3300048916 Ga0496113_0619894 Ga0496113_0619894_47_580 174
683 3300048919 Ga0496116_0000967 Ga0496116_0000967_26167_26691 174
684 3300048919 Ga0496116_0001797 Ga0496116_0001797_19445_19969 174
685 3300048919 Ga0496116_0004486 Ga0496116_0004486_10094_10618 174
686 3300048920 Ga0496117_0030570 Ga0496117_0030570_3338_3862 174
687 3300048920 Ga0496117_0037277 Ga0496117_0037277_1913_2464 174
688 3300048920 Ga0496117_0267552 Ga0496117_0267552_74_607 174
689 3300048921 Ga0496118_0009636 Ga0496118_0009636_8356_8880 174
690 3300048921 Ga0496118_0034458 Ga0496118_0034458_1956_2507 174
691 3300048921 Ga0496118_0047066 Ga0496118_0047066_1397_1948 174
692 3300048921 Ga0496118_0111787 Ga0496118_0111787_485_1018 174
693 3300048921 Ga0496118_0515279 Ga0496118_0515279_12_536 174
694 3300048923 Ga0496120_0063297 Ga0496120_0063297_222_773 174
695 3300048924 Ga0496121_0000149 Ga0496121_0000149_144313_144837 174
696 3300048924 Ga0496121_0005030 Ga0496121_0005030_5458_5991 174
697 3300048924 Ga0496121_0032806 Ga0496121_0032806_1915_2466 174
698 3300048924 Ga0496121_0132252 Ga0496121_0132252_651_1175 174
699 3300048924 Ga0496121_0212414 Ga0496121_0212414_366_890 174
700 3300048924 Ga0496121_0327435 Ga0496121_0327435_431_982 174
701 3300048925 Ga0496122_0001797 Ga0496122_0001797_13286_13819 174
702 3300048925 Ga0496122_0002387 Ga0496122_0002387_406_930 174
703 3300048926 Ga0496123_0000079 Ga0496123_0000079_166702_167235 174
704 3300048926 Ga0496123_0001620 Ga0496123_0001620_25934_26458 174
705 3300048926 Ga0496123_0029728 Ga0496123_0029728_1931_2482 174
706 3300048927 Ga0496124_0018537 Ga0496124_0018537_2850_3401 174
707 3300048927 Ga0496124_0087937 Ga0496124_0087937_578_1102 174
708 3300048927 Ga0496124_0102952 Ga0496124_0102952_1699_2223 174
709 3300048927 Ga0496124_0555332 Ga0496124_0555332_194_718 174
710 3300048928 Ga0496125_0045891 Ga0496125_0045891_2578_3129 174
711 3300048928 Ga0496125_0087247 Ga0496125_0087247_426_950 174
712 3300048928 Ga0496125_0202413 Ga0496125_0202413_628_1152 174
713 3300049459 Ga0495678_001417 Ga0495678_001417_11828_12352 174
714 3300049459 Ga0495678_005728 Ga0495678_005728_689_1240 174
715 3300049459 Ga0495678_012763 Ga0495678_012763_272_829 174
716 3300049459 Ga0495678_014399 Ga0495678_014399_689_1213 174
717 3300049459 Ga0495678_025856 Ga0495678_025856_460_1011 174
718 3300049459 Ga0495678_026766 Ga0495678_026766_683_1207 174
719 3300049459 Ga0495678_042352 Ga0495678_042352_129_653 174
720 3300049459 Ga0495678_049199 Ga0495678_049199_43_567 174
721 3300049459 Ga0495678_057160 Ga0495678_057160_82_606 174
722 3300049460 Ga0495682_0003039 Ga0495682_0003039_1335_1859 174
723 3300049460 Ga0495682_0003103 Ga0495682_0003103_4172_4696 174
724 3300049460 Ga0495682_0019984 Ga0495682_0019984_1326_1850 174
725 3300049460 Ga0495682_0038422 Ga0495682_0038422_30_581 174
726 3300049758 Ga0501241_001416 Ga0501241_001416_2675_3199 174
727 3300049853 Ga0501226_004230 Ga0501226_004230_73_597 174
728 3300050489 nmdc:mga03683_53911_c1 nmdc:mga03683_53911_c1_496_1020 174
729 3300050491 nmdc:mga00v17_39016_c1 nmdc:mga00v17_39016_c1_2266_2790 174
730 3300050514 nmdc:mga08x19_1032860_c1 nmdc:mga08x19_1032860_c1_11_562 174
731 3300050516 nmdc:mga0sz30_164758_c1 nmdc:mga0sz30_164758_c1_236_760 174
732 3300050516 nmdc:mga0sz30_31302_c1 nmdc:mga0sz30_31302_c1_1585_2109 174
733 3300053111 Ga0500572_001869 Ga0500572_001869_2482_3033 174
734 3300053145 Ga0500586_014768 Ga0500586_014768_740_1264 174
735 3300053145 Ga0500586_149056 Ga0500586_149056_137_664 174
736 iso_pu_bacteria 2643221589 2643954352 174
737 iso_pu_bacteria 2643221602 2644023161 174
738 iso_pu_bacteria 2825651385 2825651461 174
739 iso_pu_bacteria 2880230671 2880233619 174
740 iso_pu_bacteria 2919456309 2919458782 174
741 iso_pu_bacteria 2923586266 2923588818 174
742 iso_pu_bacteria 2988728565 2988729205 174
743 iso_pu_bacteria 3007866637 3007869015 174
744 iso_pu_bacteria 8056143049 8056145830 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13521

AAA_28

AAA domain

3

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gyf-assembly2.cif.gz_B crystal structure of nadr protein in complex with nr 0.8157 2 174
6gyf-assembly2.cif.gz_B crystal structure of nadr protein in complex with nr 0.807 2 174
6gzo-assembly1.cif.gz_A crystal structure of nadr protein in complex with nad and amp-pnp 0.8025 2 174
6gzo-assembly1.cif.gz_A crystal structure of nadr protein in complex with nad and amp-pnp 0.7938 2 174
6gyf-assembly1.cif.gz_A crystal structure of nadr protein in complex with nr 0.7907 2 174
ID Description Score Start End Superfamily
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9265 1 162 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9155 1 162 3.40.50.300
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 1 163 3.40.50.300
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8795 1 163 3.40.50.300
af_Q55C96_20_302_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8399 2 23 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A836ZMV4-F1-model_v4 deleted 0.9988 1 114
AF-A0A2N1WLD2-F1-model_v4 deleted 0.9972 1 96
AF-A0A3M5YYB0-F1-model_v4 deleted 0.9926 1 172
AF-A0A1V9UFH2-F1-model_v4 N-acetylglucosamine-6-sulfatase 0.991 1 174
AF-A0A6I4RLU3-F1-model_v4 AAA family ATPase 0.9906 1 172

Feature Viewer

pLDDT pTM Quality
91.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map