F478708
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 314 | 735 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300049580|Ga0501046_0397947|Ga0501046_0397947_12_695 |
| Length | 227 |
| Sequence | VVEQMAGEGDVLRASIVGHPRMMARRRHDARVMLKREILDTFLGLLDEATTGGDPEPTAMNLATADAAGRVSSRIVLLKGADERGFRFYTNYESDKGVQLDAHPQVALNFHWKQLRQGVQVRVEGVARKLLAEESDAYFATRARGSQIGAWASLQSQTLPDRHSFDERVARYEREFEGHEVPRPPHWGGYLVEPDMVEFWYGAEFRLHERMRWSRHGQTWTRRLLYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 4 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 5 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 6 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 7 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 8 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 122 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 123 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 312 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 0 |
| Isolates | 1.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.04 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 82.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10017015 | 3300001990 | Bacteria | 2344 |
| 2 | JGI24735J21928_10008326 | 3300002067 | Bacteria | 3358 |
| 3 | JGI25156J39149_1005881 | 3300002705 | Bacteria | 3452 |
| 4 | JGI25156J39149_1012856 | 3300002705 | Bacteria | 1814 |
| 5 | JGI25162J39368_1000235 | 3300002737 | Bacteria | 55413 |
| 6 | JGI25162J39368_1001269 | 3300002737 | Bacteria | 14390 |
| 7 | JGI25162J39368_1002195 | 3300002737 | Bacteria | 8055 |
| 8 | JGI25162J39368_1008750 | 3300002737 | Bacteria | 1420 |
| 9 | JGI25157J39369_1000415 | 3300002741 | Bacteria | 28682 |
| 10 | JGI25157J39369_1001439 | 3300002741 | Bacteria | 8958 |
| 11 | JGI25157J39369_1001600 | 3300002741 | Bacteria | 7927 |
| 12 | JGI25163J39215_1000768 | 3300002771 | Bacteria | 7895 |
| 13 | JGI25164J39214_1000139 | 3300002772 | Bacteria | 70270 |
| 14 | JGI25164J39214_1001075 | 3300002772 | Bacteria | 8060 |
| 15 | JGI25164J39214_1001475 | 3300002772 | Bacteria | 5372 |
| 16 | JGI25164J39214_1001631 | 3300002772 | Bacteria | 4690 |
| 17 | JGI25165J46597_1000316 | 3300003214 | Bacteria | 58235 |
| 18 | JGI25165J46597_1001043 | 3300003214 | Bacteria | 18071 |
| 19 | JGI25165J46597_1001299 | 3300003214 | Bacteria | 14390 |
| 20 | JGI25165J46597_1002371 | 3300003214 | Bacteria | 6284 |
| 21 | rootH1_10041414 | 3300003316 | Bacteria | 1708 |
| 22 | rootH1_10068308 | 3300003316 | Bacteria | 1068 |
| 23 | Ga0055538_1002162 | 3300003751 | Bacteria | 3066 |
| 24 | Ga0055539_1001607 | 3300003752 | Bacteria | 4070 |
| 25 | Ga0055533_1003938 | 3300003756 | Bacteria | 2814 |
| 26 | Ga0055525_1000178 | 3300003759 | Bacteria | 79260 |
| 27 | Ga0055527_1000090 | 3300003760 | Bacteria | 71093 |
| 28 | Ga0055527_1000100 | 3300003760 | Bacteria | 63720 |
| 29 | Ga0055535_1000201 | 3300003761 | Bacteria | 63716 |
| 30 | Ga0055535_1000456 | 3300003761 | Bacteria | 37749 |
| 31 | Ga0055535_1000742 | 3300003761 | Bacteria | 24432 |
| 32 | Ga0055535_1001175 | 3300003761 | Bacteria | 15158 |
| 33 | Ga0055535_1001446 | 3300003761 | Bacteria | 12051 |
| 34 | Ga0055535_1022041 | 3300003761 | Bacteria | 765 |
| 35 | Ga0055542_1000187 | 3300003762 | Bacteria | 76099 |
| 36 | Ga0055542_1000191 | 3300003762 | Bacteria | 74866 |
| 37 | Ga0055542_1000212 | 3300003762 | Bacteria | 71081 |
| 38 | Ga0055542_1000236 | 3300003762 | Bacteria | 63720 |
| 39 | Ga0055542_1000287 | 3300003762 | Bacteria | 56451 |
| 40 | Ga0055542_1001002 | 3300003762 | Bacteria | 18071 |
| 41 | Ga0055529_1000256 | 3300003763 | Bacteria | 63720 |
| 42 | Ga0055529_1000259 | 3300003763 | Bacteria | 63245 |
| 43 | Ga0055529_1000386 | 3300003763 | Bacteria | 47713 |
| 44 | Ga0055529_1001324 | 3300003763 | Bacteria | 8330 |
| 45 | Ga0065712_10160772 | 3300005290 | Bacteria | 1304 |
| 46 | Ga0070658_10001497 | 3300005327 | Bacteria | 19822 |
| 47 | Ga0070676_10046880 | 3300005328 | Bacteria | 2522 |
| 48 | Ga0070683_100033550 | 3300005329 | Bacteria | 4682 |
| 49 | Ga0070683_100171784 | 3300005329 | Bacteria | 2057 |
| 50 | Ga0070683_100987400 | 3300005329 | Bacteria | 808 |
| 51 | Ga0070690_100043209 | 3300005330 | Bacteria | 2857 |
| 52 | Ga0070670_100035414 | 3300005331 | Bacteria | 4298 |
| 53 | Ga0068869_100009671 | 3300005334 | Bacteria | 6261 |
| 54 | Ga0068869_100035408 | 3300005334 | Bacteria | 3537 |
| 55 | Ga0068869_100168927 | 3300005334 | Bacteria | 1707 |
| 56 | Ga0068869_100266181 | 3300005334 | Bacteria | 1374 |
| 57 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 58 | Ga0070666_10002943 | 3300005335 | Bacteria | 10306 |
| 59 | Ga0070666_10339682 | 3300005335 | Bacteria | 1073 |
| 60 | Ga0070680_100008193 | 3300005336 | Bacteria | 7987 |
| 61 | Ga0070680_100776488 | 3300005336 | Bacteria | 825 |
| 62 | Ga0070682_100003692 | 3300005337 | Bacteria | 8503 |
| 63 | Ga0070682_100021180 | 3300005337 | Bacteria | 3832 |
| 64 | Ga0070682_100063155 | 3300005337 | Bacteria | 2347 |
| 65 | Ga0070682_100260995 | 3300005337 | Bacteria | 1254 |
| 66 | Ga0070682_100326442 | 3300005337 | Bacteria | 1135 |
| 67 | Ga0070682_100792045 | 3300005337 | Unclassified | 769 |
| 68 | Ga0068868_100057784 | 3300005338 | Bacteria | 3065 |
| 69 | Ga0068868_100603892 | 3300005338 | Bacteria | 972 |
| 70 | Ga0070660_100112135 | 3300005339 | Bacteria | 2171 |
| 71 | Ga0070660_100112186 | 3300005339 | Bacteria | 2170 |
| 72 | Ga0070660_100492422 | 3300005339 | Bacteria | 1019 |
| 73 | Ga0070689_100002814 | 3300005340 | Bacteria | 11436 |
| 74 | Ga0070689_100080965 | 3300005340 | Bacteria | 2549 |
| 75 | Ga0070689_100462536 | 3300005340 | Bacteria | 1081 |
| 76 | Ga0070661_100020646 | 3300005344 | Bacteria | 4698 |
| 77 | Ga0070661_100040860 | 3300005344 | Bacteria | 3384 |
| 78 | Ga0070661_100087838 | 3300005344 | Bacteria | 2300 |
| 79 | Ga0070661_100177642 | 3300005344 | Bacteria | 1619 |
| 80 | Ga0070692_10006299 | 3300005345 | Bacteria | 5145 |
| 81 | Ga0070692_10113658 | 3300005345 | Bacteria | 1501 |
| 82 | Ga0070668_100007465 | 3300005347 | Bacteria | 8113 |
| 83 | Ga0070668_100058262 | 3300005347 | Bacteria | 2988 |
| 84 | Ga0070668_100121140 | 3300005347 | Bacteria | 2091 |
| 85 | Ga0070669_100037305 | 3300005353 | Bacteria | 3526 |
| 86 | Ga0070669_100082972 | 3300005353 | Bacteria | 2390 |
| 87 | Ga0070669_100290315 | 3300005353 | Bacteria | 1313 |
| 88 | Ga0070675_100025653 | 3300005354 | Bacteria | 4725 |
| 89 | Ga0070675_100075845 | 3300005354 | Bacteria | 2795 |
| 90 | Ga0070675_100272724 | 3300005354 | Bacteria | 1485 |
| 91 | Ga0070675_100761488 | 3300005354 | Bacteria | 884 |
| 92 | Ga0070674_100357015 | 3300005356 | Bacteria | 1182 |
| 93 | Ga0070673_100030499 | 3300005364 | Bacteria | 4036 |
| 94 | Ga0070673_100350608 | 3300005364 | Bacteria | 1310 |
| 95 | Ga0070659_100003021 | 3300005366 | Bacteria | 11974 |
| 96 | Ga0070659_100020532 | 3300005366 | Bacteria | 5020 |
| 97 | Ga0070659_100047533 | 3300005366 | Bacteria | 3366 |
| 98 | Ga0070659_100082497 | 3300005366 | Bacteria | 2568 |
| 99 | Ga0070659_100904469 | 3300005366 | Bacteria | 771 |
| 100 | Ga0070667_100014067 | 3300005367 | Bacteria | 6612 |
| 101 | Ga0070667_100088087 | 3300005367 | Bacteria | 2665 |
| 102 | Ga0070667_100166732 | 3300005367 | Bacteria | 1943 |
| 103 | Ga0070709_10302788 | 3300005434 | Bacteria | 1168 |
| 104 | Ga0070714_100000020 | 3300005435 | Bacteria | 169262 |
| 105 | Ga0070714_100003774 | 3300005435 | Bacteria | 11366 |
| 106 | Ga0070714_100062369 | 3300005435 | Bacteria | 3204 |
| 107 | Ga0070710_10045776 | 3300005437 | Bacteria | 2434 |
| 108 | Ga0070711_100135662 | 3300005439 | Bacteria | 1839 |
| 109 | Ga0070694_100095027 | 3300005444 | Bacteria | 2098 |
| 110 | Ga0070694_100099595 | 3300005444 | Bacteria | 2054 |
| 111 | Ga0070694_100193912 | 3300005444 | Bacteria | 1510 |
| 112 | Ga0070708_100000007 | 3300005445 | Bacteria | 146443 |
| 113 | Ga0070663_100006682 | 3300005455 | Bacteria | 6955 |
| 114 | Ga0070663_100241911 | 3300005455 | Bacteria | 1425 |
| 115 | Ga0070663_100267237 | 3300005455 | Bacteria | 1359 |
| 116 | Ga0070678_100013499 | 3300005456 | Bacteria | 5125 |
| 117 | Ga0070678_100103379 | 3300005456 | Bacteria | 2213 |
| 118 | Ga0070662_100002975 | 3300005457 | Bacteria | 10530 |
| 119 | Ga0070662_100030126 | 3300005457 | Bacteria | 3793 |
| 120 | Ga0070662_100051910 | 3300005457 | Bacteria | 2962 |
| 121 | Ga0070681_10010860 | 3300005458 | Bacteria | 9001 |
| 122 | Ga0070681_10026364 | 3300005458 | Bacteria | 5843 |
| 123 | Ga0070681_10027397 | 3300005458 | Bacteria | 5730 |
| 124 | Ga0070681_10037699 | 3300005458 | Bacteria | 4849 |
| 125 | Ga0070681_10130039 | 3300005458 | Bacteria | 2450 |
| 126 | Ga0070685_10000607 | 3300005466 | Bacteria | 19772 |
| 127 | Ga0070707_100039332 | 3300005468 | Bacteria | 4519 |
| 128 | Ga0070707_100096329 | 3300005468 | Bacteria | 2866 |
| 129 | Ga0070698_100120714 | 3300005471 | Bacteria | 2582 |
| 130 | Ga0070698_100262638 | 3300005471 | Bacteria | 1659 |
| 131 | Ga0070679_100033490 | 3300005530 | Bacteria | 5088 |
| 132 | Ga0070679_100153576 | 3300005530 | Bacteria | 2278 |
| 133 | Ga0070679_100259181 | 3300005530 | Bacteria | 1694 |
| 134 | Ga0070679_100777117 | 3300005530 | Unclassified | 901 |
| 135 | Ga0070684_100532919 | 3300005535 | Bacteria | 1089 |
| 136 | Ga0070697_100051466 | 3300005536 | Bacteria | 3346 |
| 137 | Ga0068853_100006495 | 3300005539 | Bacteria | 9302 |
| 138 | Ga0068853_100176295 | 3300005539 | Bacteria | 1936 |
| 139 | Ga0068853_100225597 | 3300005539 | Bacteria | 1712 |
| 140 | Ga0068853_100281949 | 3300005539 | Bacteria | 1532 |
| 141 | Ga0068853_100752294 | 3300005539 | Bacteria | 931 |
| 142 | Ga0070672_100011137 | 3300005543 | Bacteria | 6263 |
| 143 | Ga0070672_100027164 | 3300005543 | Bacteria | 4267 |
| 144 | Ga0070695_100020249 | 3300005545 | Bacteria | 4060 |
| 145 | Ga0070696_100001686 | 3300005546 | Bacteria | 14471 |
| 146 | Ga0070696_100004173 | 3300005546 | Bacteria | 9627 |
| 147 | Ga0070693_100004068 | 3300005547 | Bacteria | 6885 |
| 148 | Ga0070693_100009737 | 3300005547 | Bacteria | 4788 |
| 149 | Ga0070693_100030353 | 3300005547 | Bacteria | 2955 |
| 150 | Ga0070693_100189000 | 3300005547 | Bacteria | 1331 |
| 151 | Ga0070693_100211150 | 3300005547 | Bacteria | 1266 |
| 152 | Ga0070693_100410837 | 3300005547 | Bacteria | 941 |
| 153 | Ga0070665_100000333 | 3300005548 | Bacteria | 72698 |
| 154 | Ga0070665_100000618 | 3300005548 | Bacteria | 48757 |
| 155 | Ga0070665_100032263 | 3300005548 | Bacteria | 5273 |
| 156 | Ga0070665_100136571 | 3300005548 | Bacteria | 2455 |
| 157 | Ga0068855_100054444 | 3300005563 | Bacteria | 4702 |
| 158 | Ga0068855_100073447 | 3300005563 | Bacteria | 3974 |
| 159 | Ga0068855_100080267 | 3300005563 | Bacteria | 3783 |
| 160 | Ga0068855_100399273 | 3300005563 | Bacteria | 1507 |
| 161 | Ga0070664_100108449 | 3300005564 | Bacteria | 2421 |
| 162 | Ga0068857_100030513 | 3300005577 | Bacteria | 4760 |
| 163 | Ga0068857_100147750 | 3300005577 | Bacteria | 2127 |
| 164 | Ga0068857_100251681 | 3300005577 | Bacteria | 1620 |
| 165 | Ga0068857_100656346 | 3300005577 | Bacteria | 994 |
| 166 | Ga0068854_100054124 | 3300005578 | Bacteria | 2885 |
| 167 | Ga0068856_100042321 | 3300005614 | Bacteria | 4480 |
| 168 | Ga0068856_100046743 | 3300005614 | Bacteria | 4263 |
| 169 | Ga0068856_100118837 | 3300005614 | Bacteria | 2644 |
| 170 | Ga0068856_100420258 | 3300005614 | Bacteria | 1357 |
| 171 | Ga0070702_100016179 | 3300005615 | Bacteria | 3823 |
| 172 | Ga0068852_100554688 | 3300005616 | Bacteria | 1150 |
| 173 | Ga0068859_100037834 | 3300005617 | Bacteria | 4842 |
| 174 | Ga0068859_100058706 | 3300005617 | Bacteria | 3875 |
| 175 | Ga0068859_100233305 | 3300005617 | Bacteria | 1929 |
| 176 | Ga0068864_100066775 | 3300005618 | Bacteria | 3122 |
| 177 | Ga0068864_101325375 | 3300005618 | Bacteria | 720 |
| 178 | Ga0068851_10000591 | 3300005834 | Bacteria | 15744 |
| 179 | Ga0068870_10029604 | 3300005840 | Bacteria | 2760 |
| 180 | Ga0068870_10247110 | 3300005840 | Bacteria | 1104 |
| 181 | Ga0068863_100015928 | 3300005841 | Bacteria | 7211 |
| 182 | Ga0068863_100061756 | 3300005841 | Bacteria | 3543 |
| 183 | Ga0068863_100475107 | 3300005841 | Bacteria | 1229 |
| 184 | Ga0068858_100002640 | 3300005842 | Bacteria | 18054 |
| 185 | Ga0068860_100048917 | 3300005843 | Bacteria | 4029 |
| 186 | Ga0068860_100105639 | 3300005843 | Bacteria | 2689 |
| 187 | Ga0068860_100219453 | 3300005843 | Bacteria | 1846 |
| 188 | Ga0068862_100023433 | 3300005844 | Bacteria | 5173 |
| 189 | Ga0068862_100086124 | 3300005844 | Bacteria | 2731 |
| 190 | Ga0081540_1001157 | 3300005983 | Bacteria | 23238 |
| 191 | Ga0070712_100226029 | 3300006175 | Bacteria | 1484 |
| 192 | Ga0070712_100669544 | 3300006175 | Bacteria | 883 |
| 193 | Ga0097621_100021820 | 3300006237 | Bacteria | 4962 |
| 194 | Ga0097621_100046457 | 3300006237 | Bacteria | 3513 |
| 195 | Ga0097621_100064745 | 3300006237 | Bacteria | 3007 |
| 196 | Ga0097621_100553744 | 3300006237 | Bacteria | 1047 |
| 197 | Ga0068871_100025613 | 3300006358 | Bacteria | 4592 |
| 198 | Ga0068871_100810254 | 3300006358 | Bacteria | 864 |
| 199 | Ga0075434_100628080 | 3300006871 | Bacteria | 1093 |
| 200 | Ga0068865_100158311 | 3300006881 | Bacteria | 1725 |
| 201 | Ga0068865_100184551 | 3300006881 | Bacteria | 1609 |
| 202 | Ga0068865_100220363 | 3300006881 | Bacteria | 1483 |
| 203 | Ga0097620_100037832 | 3300006931 | Bacteria | 4842 |
| 204 | Ga0097620_100058701 | 3300006931 | Bacteria | 3875 |
| 205 | Ga0097620_100233306 | 3300006931 | Bacteria | 1929 |
| 206 | Ga0099794_10000575 | 3300007265 | Bacteria | 12305 |
| 207 | Ga0105240_10013854 | 3300009093 | Bacteria | 11041 |
| 208 | Ga0105240_10103634 | 3300009093 | Bacteria | 3456 |
| 209 | Ga0105240_10173549 | 3300009093 | Bacteria | 2551 |
| 210 | Ga0105240_10388762 | 3300009093 | Bacteria | 1574 |
| 211 | Ga0105245_10355162 | 3300009098 | Bacteria | 1453 |
| 212 | Ga0105245_11081389 | 3300009098 | Bacteria | 848 |
| 213 | Ga0105243_10369795 | 3300009148 | Bacteria | 1322 |
| 214 | Ga0105241_10045483 | 3300009174 | Bacteria | 3331 |
| 215 | Ga0105241_10098624 | 3300009174 | Bacteria | 2318 |
| 216 | Ga0105241_10463809 | 3300009174 | Bacteria | 1123 |
| 217 | Ga0105242_10128828 | 3300009176 | Bacteria | 2181 |
| 218 | Ga0105242_10196201 | 3300009176 | Bacteria | 1790 |
| 219 | Ga0105248_10085167 | 3300009177 | Bacteria | 3557 |
| 220 | Ga0105248_10148079 | 3300009177 | Bacteria | 2649 |
| 221 | Ga0105248_10506360 | 3300009177 | Bacteria | 1361 |
| 222 | Ga0105248_10965684 | 3300009177 | Unclassified | 962 |
| 223 | Ga0105248_11199044 | 3300009177 | Bacteria | 858 |
| 224 | Ga0105237_10025886 | 3300009545 | Bacteria | 5997 |
| 225 | Ga0105237_10035711 | 3300009545 | Bacteria | 5029 |
| 226 | Ga0105237_10074364 | 3300009545 | Bacteria | 3390 |
| 227 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 228 | Ga0105238_10005675 | 3300009551 | Bacteria | 12338 |
| 229 | Ga0105238_10011550 | 3300009551 | Bacteria | 8898 |
| 230 | Ga0105238_10019359 | 3300009551 | Bacteria | 6932 |
| 231 | Ga0105238_10031956 | 3300009551 | Bacteria | 5356 |
| 232 | Ga0105238_10068568 | 3300009551 | Bacteria | 3548 |
| 233 | Ga0105238_10612615 | 3300009551 | Bacteria | 1097 |
| 234 | Ga0105238_10626982 | 3300009551 | Bacteria | 1084 |
| 235 | Ga0105249_10069077 | 3300009553 | Bacteria | 3260 |
| 236 | Ga0105239_10012447 | 3300010375 | Bacteria | 9476 |
| 237 | Ga0105239_10061214 | 3300010375 | Bacteria | 4131 |
| 238 | Ga0105239_10134230 | 3300010375 | Bacteria | 2755 |
| 239 | Ga0105239_10259430 | 3300010375 | Bacteria | 1953 |
| 240 | Ga0105239_10851499 | 3300010375 | Bacteria | 1046 |
| 241 | Ga0105246_10021173 | 3300011119 | Bacteria | 4180 |
| 242 | Ga0105246_10296663 | 3300011119 | Bacteria | 1303 |
| 243 | Ga0157347_1004129 | 3300012502 | Bacteria | 1335 |
| 244 | Ga0157373_10010449 | 3300013100 | Bacteria | 6829 |
| 245 | Ga0157373_10167985 | 3300013100 | Bacteria | 1544 |
| 246 | Ga0157371_10009406 | 3300013102 | Bacteria | 7694 |
| 247 | Ga0157370_10004556 | 3300013104 | Bacteria | 15864 |
| 248 | Ga0157370_10005515 | 3300013104 | Bacteria | 14180 |
| 249 | Ga0157370_10011083 | 3300013104 | Bacteria | 9450 |
| 250 | Ga0157370_10036580 | 3300013104 | Bacteria | 4763 |
| 251 | Ga0157370_10534889 | 3300013104 | Bacteria | 1075 |
| 252 | Ga0157369_10000114 | 3300013105 | Bacteria | 113453 |
| 253 | Ga0157369_10150651 | 3300013105 | Bacteria | 2458 |
| 254 | Ga0157369_10357155 | 3300013105 | Bacteria | 1517 |
| 255 | Ga0157369_10761042 | 3300013105 | Bacteria | 996 |
| 256 | Ga0157374_10014004 | 3300013296 | Bacteria | 7010 |
| 257 | Ga0157374_10207695 | 3300013296 | Bacteria | 1919 |
| 258 | Ga0157374_10211096 | 3300013296 | Bacteria | 1903 |
| 259 | Ga0157378_10000322 | 3300013297 | Bacteria | 47146 |
| 260 | Ga0157378_10026771 | 3300013297 | Bacteria | 5085 |
| 261 | Ga0157378_10217786 | 3300013297 | Bacteria | 1814 |
| 262 | Ga0163162_10043365 | 3300013306 | Bacteria | 4504 |
| 263 | Ga0163162_10080175 | 3300013306 | Bacteria | 3332 |
| 264 | Ga0163162_10098108 | 3300013306 | Bacteria | 3019 |
| 265 | Ga0163162_10420958 | 3300013306 | Bacteria | 1468 |
| 266 | Ga0157372_10025975 | 3300013307 | Bacteria | 6370 |
| 267 | Ga0157372_10032948 | 3300013307 | Bacteria | 5687 |
| 268 | Ga0157372_10069158 | 3300013307 | Bacteria | 3971 |
| 269 | Ga0157372_10103762 | 3300013307 | Bacteria | 3249 |
| 270 | Ga0157372_10249727 | 3300013307 | Bacteria | 2059 |
| 271 | Ga0157372_10414469 | 3300013307 | Bacteria | 1570 |
| 272 | Ga0157372_11054734 | 3300013307 | Bacteria | 941 |
| 273 | Ga0157375_10000459 | 3300013308 | Bacteria | 37058 |
| 274 | Ga0157375_10035389 | 3300013308 | Bacteria | 4766 |
| 275 | Ga0157375_10164466 | 3300013308 | Bacteria | 2363 |
| 276 | Ga0157375_10212061 | 3300013308 | Bacteria | 2094 |
| 277 | Ga0157375_10519589 | 3300013308 | Bacteria | 1354 |
| 278 | Ga0157375_11235122 | 3300013308 | Bacteria | 877 |
| 279 | Ga0163163_10018334 | 3300014325 | Bacteria | 6550 |
| 280 | Ga0163163_10257451 | 3300014325 | Bacteria | 1796 |
| 281 | Ga0157377_10007481 | 3300014745 | Bacteria | 5278 |
| 282 | Ga0157377_10331037 | 3300014745 | Bacteria | 1015 |
| 283 | Ga0157379_10300818 | 3300014968 | Bacteria | 1462 |
| 284 | Ga0157379_10369859 | 3300014968 | Bacteria | 1314 |
| 285 | Ga0157376_10001958 | 3300014969 | Bacteria | 13773 |
| 286 | Ga0157376_10006141 | 3300014969 | Bacteria | 8458 |
| 287 | Ga0157376_10045401 | 3300014969 | Bacteria | 3617 |
| 288 | Ga0157376_10050961 | 3300014969 | Bacteria | 3436 |
| 289 | Ga0182006_1003066 | 3300015261 | Bacteria | 8763 |
| 290 | Ga0182006_1143667 | 3300015261 | Bacteria | 813 |
| 291 | Ga0182007_10019186 | 3300015262 | Bacteria | 2463 |
| 292 | Ga0182005_1035578 | 3300015265 | Bacteria | 1354 |
| 293 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 294 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 295 | Ga0209435_104489 | 3300025206 | Bacteria | 1578 |
| 296 | Ga0209760_100541 | 3300025207 | Bacteria | 7120 |
| 297 | Ga0209784_100422 | 3300025224 | Bacteria | 18592 |
| 298 | Ga0209566_101312 | 3300025225 | Bacteria | 8033 |
| 299 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 300 | Ga0209674_100140 | 3300025226 | Bacteria | 109152 |
| 301 | Ga0209674_100373 | 3300025226 | Bacteria | 24523 |
| 302 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 303 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 304 | Ga0209672_100141 | 3300025228 | Bacteria | 67332 |
| 305 | Ga0209672_101550 | 3300025228 | Bacteria | 7904 |
| 306 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 307 | Ga0207427_100057 | 3300025231 | Bacteria | 198202 |
| 308 | Ga0207427_100111 | 3300025231 | Bacteria | 112775 |
| 309 | Ga0207427_100179 | 3300025231 | Bacteria | 67665 |
| 310 | Ga0207427_100443 | 3300025231 | Bacteria | 23103 |
| 311 | Ga0207427_101239 | 3300025231 | Bacteria | 9790 |
| 312 | Ga0209437_100099 | 3300025233 | Bacteria | 229500 |
| 313 | Ga0209437_100184 | 3300025233 | Bacteria | 128650 |
| 314 | Ga0209437_100270 | 3300025233 | Bacteria | 78319 |
| 315 | Ga0209437_100878 | 3300025233 | Bacteria | 12233 |
| 316 | Ga0209437_102084 | 3300025233 | Bacteria | 4059 |
| 317 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 318 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 319 | Ga0209258_100119 | 3300025242 | Bacteria | 183554 |
| 320 | Ga0209258_100316 | 3300025242 | Bacteria | 74911 |
| 321 | Ga0209258_100509 | 3300025242 | Bacteria | 37607 |
| 322 | Ga0209258_101510 | 3300025242 | Bacteria | 7889 |
| 323 | Ga0209646_1000487 | 3300025246 | Bacteria | 19378 |
| 324 | Ga0209646_1001182 | 3300025246 | Bacteria | 7580 |
| 325 | Ga0209646_1021838 | 3300025246 | Bacteria | 917 |
| 326 | Ga0209026_1000117 | 3300025250 | Bacteria | 131918 |
| 327 | Ga0209026_1000276 | 3300025250 | Bacteria | 60964 |
| 328 | Ga0209026_1000414 | 3300025250 | Bacteria | 36965 |
| 329 | Ga0209026_1003387 | 3300025250 | Bacteria | 5260 |
| 330 | Ga0209677_105076 | 3300025253 | Bacteria | 3558 |
| 331 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 332 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 333 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 334 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 335 | Ga0209148_1000201 | 3300025254 | Bacteria | 107073 |
| 336 | Ga0209148_1000244 | 3300025254 | Bacteria | 86833 |
| 337 | Ga0209759_1000134 | 3300025256 | Bacteria | 126221 |
| 338 | Ga0209759_1002336 | 3300025256 | Bacteria | 8501 |
| 339 | Ga0209759_1002497 | 3300025256 | Bacteria | 8025 |
| 340 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 341 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 342 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 343 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 344 | Ga0209233_1001156 | 3300025261 | Bacteria | 10712 |
| 345 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 346 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 347 | Ga0209455_1000018 | 3300025272 | Bacteria | 718034 |
| 348 | Ga0209455_1000164 | 3300025272 | Bacteria | 114011 |
| 349 | Ga0209256_1002977 | 3300025299 | Bacteria | 12652 |
| 350 | Ga0207656_10000662 | 3300025321 | Bacteria | 11286 |
| 351 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 352 | Ga0207680_10000218 | 3300025903 | Bacteria | 27690 |
| 353 | Ga0207680_10004422 | 3300025903 | Bacteria | 6666 |
| 354 | Ga0207680_10278788 | 3300025903 | Unclassified | 1161 |
| 355 | Ga0207680_10432295 | 3300025903 | Bacteria | 933 |
| 356 | Ga0207647_10000286 | 3300025904 | Bacteria | 41390 |
| 357 | Ga0207647_10022283 | 3300025904 | Bacteria | 4210 |
| 358 | Ga0207647_10052007 | 3300025904 | Bacteria | 2529 |
| 359 | Ga0207699_10076986 | 3300025906 | Bacteria | 2057 |
| 360 | Ga0207645_10120717 | 3300025907 | Bacteria | 1701 |
| 361 | Ga0207643_10020147 | 3300025908 | Bacteria | 3659 |
| 362 | Ga0207643_10042633 | 3300025908 | Bacteria | 2559 |
| 363 | Ga0207705_10052373 | 3300025909 | Bacteria | 2938 |
| 364 | Ga0207684_10000121 | 3300025910 | Bacteria | 143066 |
| 365 | Ga0207654_10083376 | 3300025911 | Bacteria | 1930 |
| 366 | Ga0207707_10013069 | 3300025912 | Bacteria | 7232 |
| 367 | Ga0207707_10044862 | 3300025912 | Bacteria | 3853 |
| 368 | Ga0207707_10072979 | 3300025912 | Bacteria | 2992 |
| 369 | Ga0207707_10158750 | 3300025912 | Bacteria | 1977 |
| 370 | Ga0207707_10226382 | 3300025912 | Bacteria | 1627 |
| 371 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 372 | Ga0207695_10007050 | 3300025913 | Bacteria | 14415 |
| 373 | Ga0207695_10024339 | 3300025913 | Bacteria | 6816 |
| 374 | Ga0207695_10065042 | 3300025913 | Bacteria | 3751 |
| 375 | Ga0207671_10003776 | 3300025914 | Bacteria | 14885 |
| 376 | Ga0207671_10016470 | 3300025914 | Bacteria | 5743 |
| 377 | Ga0207671_10099109 | 3300025914 | Bacteria | 2205 |
| 378 | Ga0207671_10342910 | 3300025914 | Bacteria | 1184 |
| 379 | Ga0207671_10597923 | 3300025914 | Bacteria | 879 |
| 380 | Ga0207693_10133123 | 3300025915 | Bacteria | 1954 |
| 381 | Ga0207663_10086979 | 3300025916 | Bacteria | 2063 |
| 382 | Ga0207660_10020818 | 3300025917 | Bacteria | 4408 |
| 383 | Ga0207660_10049914 | 3300025917 | Bacteria | 2969 |
| 384 | Ga0207657_10058102 | 3300025919 | Bacteria | 3330 |
| 385 | Ga0207657_10078070 | 3300025919 | Bacteria | 2789 |
| 386 | Ga0207657_10092282 | 3300025919 | Bacteria | 2524 |
| 387 | Ga0207657_10320578 | 3300025919 | Bacteria | 1225 |
| 388 | Ga0207657_10698704 | 3300025919 | Bacteria | 788 |
| 389 | Ga0207649_10269666 | 3300025920 | Bacteria | 1233 |
| 390 | Ga0207652_10012631 | 3300025921 | Bacteria | 6828 |
| 391 | Ga0207652_10041141 | 3300025921 | Bacteria | 3927 |
| 392 | Ga0207646_10038988 | 3300025922 | Bacteria | 4276 |
| 393 | Ga0207681_10155946 | 3300025923 | Bacteria | 1716 |
| 394 | Ga0207681_10196440 | 3300025923 | Bacteria | 1547 |
| 395 | Ga0207694_10000168 | 3300025924 | Bacteria | 67647 |
| 396 | Ga0207694_10001142 | 3300025924 | Bacteria | 23029 |
| 397 | Ga0207694_10001700 | 3300025924 | Bacteria | 18417 |
| 398 | Ga0207694_10003489 | 3300025924 | Bacteria | 12503 |
| 399 | Ga0207694_10007373 | 3300025924 | Bacteria | 8343 |
| 400 | Ga0207694_10040507 | 3300025924 | Bacteria | 3587 |
| 401 | Ga0207694_10132569 | 3300025924 | Bacteria | 1998 |
| 402 | Ga0207694_10579962 | 3300025924 | Unclassified | 942 |
| 403 | Ga0207650_10015995 | 3300025925 | Bacteria | 5235 |
| 404 | Ga0207650_10169000 | 3300025925 | Bacteria | 1737 |
| 405 | Ga0207650_10369008 | 3300025925 | Bacteria | 1184 |
| 406 | Ga0207659_10005820 | 3300025926 | Bacteria | 7512 |
| 407 | Ga0207659_10082244 | 3300025926 | Bacteria | 2383 |
| 408 | Ga0207687_10102250 | 3300025927 | Bacteria | 2111 |
| 409 | Ga0207687_10561367 | 3300025927 | Bacteria | 959 |
| 410 | Ga0207700_10096576 | 3300025928 | Bacteria | 2346 |
| 411 | Ga0207664_10000023 | 3300025929 | Bacteria | 204730 |
| 412 | Ga0207664_10000200 | 3300025929 | Bacteria | 44986 |
| 413 | Ga0207644_10592280 | 3300025931 | Bacteria | 920 |
| 414 | Ga0207690_10000138 | 3300025932 | Bacteria | 59404 |
| 415 | Ga0207690_10003322 | 3300025932 | Bacteria | 9623 |
| 416 | Ga0207690_10005588 | 3300025932 | Bacteria | 7429 |
| 417 | Ga0207690_10009214 | 3300025932 | Bacteria | 5861 |
| 418 | Ga0207690_10034933 | 3300025932 | Bacteria | 3242 |
| 419 | Ga0207690_10108188 | 3300025932 | Bacteria | 1997 |
| 420 | Ga0207706_10002151 | 3300025933 | Bacteria | 19257 |
| 421 | Ga0207706_10047647 | 3300025933 | Bacteria | 3792 |
| 422 | Ga0207706_10200878 | 3300025933 | Bacteria | 1748 |
| 423 | Ga0207706_10412971 | 3300025933 | Bacteria | 1170 |
| 424 | Ga0207686_10140942 | 3300025934 | Bacteria | 1666 |
| 425 | Ga0207686_10187852 | 3300025934 | Unclassified | 1470 |
| 426 | Ga0207686_10266529 | 3300025934 | Bacteria | 1258 |
| 427 | Ga0207670_10000951 | 3300025936 | Bacteria | 15281 |
| 428 | Ga0207670_10164471 | 3300025936 | Bacteria | 1659 |
| 429 | Ga0207669_10035252 | 3300025937 | Bacteria | 2845 |
| 430 | Ga0207669_10486030 | 3300025937 | Bacteria | 985 |
| 431 | Ga0207704_10006533 | 3300025938 | Bacteria | 5446 |
| 432 | Ga0207704_10086008 | 3300025938 | Bacteria | 2049 |
| 433 | Ga0207704_10204616 | 3300025938 | Bacteria | 1448 |
| 434 | Ga0207704_10238285 | 3300025938 | Bacteria | 1357 |
| 435 | Ga0207665_10116644 | 3300025939 | Bacteria | 1882 |
| 436 | Ga0207665_10655675 | 3300025939 | Bacteria | 823 |
| 437 | Ga0207691_10033892 | 3300025940 | Bacteria | 4753 |
| 438 | Ga0207691_10057932 | 3300025940 | Bacteria | 3525 |
| 439 | Ga0207711_10029973 | 3300025941 | Bacteria | 4590 |
| 440 | Ga0207689_10002445 | 3300025942 | Bacteria | 17309 |
| 441 | Ga0207689_10021229 | 3300025942 | Bacteria | 5459 |
| 442 | Ga0207689_10117797 | 3300025942 | Bacteria | 2184 |
| 443 | Ga0207689_10169566 | 3300025942 | Bacteria | 1799 |
| 444 | Ga0207661_10168474 | 3300025944 | Bacteria | 1905 |
| 445 | Ga0207661_10419015 | 3300025944 | Unclassified | 1216 |
| 446 | Ga0207679_10012035 | 3300025945 | Bacteria | 5625 |
| 447 | Ga0207667_10008241 | 3300025949 | Bacteria | 12404 |
| 448 | Ga0207667_10028030 | 3300025949 | Bacteria | 6120 |
| 449 | Ga0207651_10055094 | 3300025960 | Bacteria | 2729 |
| 450 | Ga0207651_10102122 | 3300025960 | Bacteria | 2131 |
| 451 | Ga0207712_10000745 | 3300025961 | Bacteria | 24662 |
| 452 | Ga0207712_10128984 | 3300025961 | Bacteria | 1924 |
| 453 | Ga0207668_10037848 | 3300025972 | Bacteria | 3233 |
| 454 | Ga0207668_10057888 | 3300025972 | Bacteria | 2706 |
| 455 | Ga0207668_10266936 | 3300025972 | Bacteria | 1397 |
| 456 | Ga0207668_10336924 | 3300025972 | Bacteria | 1257 |
| 457 | Ga0207640_10004096 | 3300025981 | Bacteria | 7875 |
| 458 | Ga0207658_10005424 | 3300025986 | Bacteria | 8744 |
| 459 | Ga0207658_10119922 | 3300025986 | Bacteria | 2095 |
| 460 | Ga0207658_10186657 | 3300025986 | Bacteria | 1720 |
| 461 | Ga0207658_10464365 | 3300025986 | Bacteria | 1122 |
| 462 | Ga0207677_10197701 | 3300026023 | Bacteria | 1595 |
| 463 | Ga0207703_10002027 | 3300026035 | Bacteria | 17888 |
| 464 | Ga0207703_10597880 | 3300026035 | Bacteria | 1043 |
| 465 | Ga0207703_10742087 | 3300026035 | Bacteria | 935 |
| 466 | Ga0207639_10004144 | 3300026041 | Bacteria | 9759 |
| 467 | Ga0207639_10015812 | 3300026041 | Bacteria | 5328 |
| 468 | Ga0207639_10148530 | 3300026041 | Bacteria | 1961 |
| 469 | Ga0207639_10190980 | 3300026041 | Bacteria | 1749 |
| 470 | Ga0207639_10408317 | 3300026041 | Bacteria | 1225 |
| 471 | Ga0207639_10448272 | 3300026041 | Bacteria | 1171 |
| 472 | Ga0207678_10005813 | 3300026067 | Bacteria | 10994 |
| 473 | Ga0207678_10070555 | 3300026067 | Bacteria | 2996 |
| 474 | Ga0207678_10195785 | 3300026067 | Bacteria | 1727 |
| 475 | Ga0207678_10285600 | 3300026067 | Bacteria | 1417 |
| 476 | Ga0207678_10800903 | 3300026067 | Bacteria | 832 |
| 477 | Ga0207702_10001815 | 3300026078 | Bacteria | 21008 |
| 478 | Ga0207641_10235681 | 3300026088 | Bacteria | 1703 |
| 479 | Ga0207641_10596934 | 3300026088 | Bacteria | 1081 |
| 480 | Ga0207641_10733722 | 3300026088 | Bacteria | 974 |
| 481 | Ga0207648_10009668 | 3300026089 | Bacteria | 9222 |
| 482 | Ga0207648_10605728 | 3300026089 | Bacteria | 1010 |
| 483 | Ga0207676_10037898 | 3300026095 | Bacteria | 3677 |
| 484 | Ga0207676_11244773 | 3300026095 | Bacteria | 738 |
| 485 | Ga0207674_10003313 | 3300026116 | Bacteria | 19805 |
| 486 | Ga0207674_10030465 | 3300026116 | Bacteria | 5671 |
| 487 | Ga0207674_10231844 | 3300026116 | Bacteria | 1794 |
| 488 | Ga0207674_10285092 | 3300026116 | Bacteria | 1600 |
| 489 | Ga0207674_10678227 | 3300026116 | Bacteria | 995 |
| 490 | Ga0207675_100514386 | 3300026118 | Bacteria | 1193 |
| 491 | Ga0207683_10004646 | 3300026121 | Bacteria | 11836 |
| 492 | Ga0207683_10008124 | 3300026121 | Bacteria | 8975 |
| 493 | Ga0207683_10010121 | 3300026121 | Bacteria | 8046 |
| 494 | Ga0207683_10188535 | 3300026121 | Bacteria | 1872 |
| 495 | Ga0207683_10680241 | 3300026121 | Bacteria | 954 |
| 496 | Ga0207698_10041829 | 3300026142 | Bacteria | 3419 |
| 497 | Ga0209588_1000001 | 3300027671 | Bacteria | 705877 |
| 498 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 499 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 500 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 501 | Ga0268265_10297999 | 3300028380 | Bacteria | 1450 |
| 502 | Ga0268265_10441971 | 3300028380 | Bacteria | 1212 |
| 503 | Ga0268264_10079476 | 3300028381 | Bacteria | 2798 |
| 504 | Ga0268264_10194410 | 3300028381 | Bacteria | 1851 |
| 505 | Ga0307517_10154980 | 3300028786 | Bacteria | 1558 |
| 506 | Ga0307408_100513816 | 3300031548 | Bacteria | 1051 |
| 507 | Ga0307406_10099256 | 3300031901 | Bacteria | 1979 |
| 508 | Ga0307416_100198820 | 3300032002 | Bacteria | 1899 |
| 509 | Ga0307416_100825753 | 3300032002 | Bacteria | 1024 |
| 510 | Ga0307510_10002367 | 3300033180 | Bacteria | 21348 |
| 511 | Ga0307510_10043003 | 3300033180 | Bacteria | 4915 |
| 512 | Ga0373934_0015089 | 3300035086 | Bacteria | 2929 |
| 513 | Ga0373923_0001685 | 3300035111 | Bacteria | 6465 |
| 514 | Ga0373953_0021480 | 3300035117 | Bacteria | 2423 |
| 515 | Ga0373954_0106440 | 3300035118 | Bacteria | 1355 |
| 516 | Ga0373956_0000342 | 3300035119 | Bacteria | 18800 |
| 517 | Ga0373957_0004152 | 3300035120 | Bacteria | 4376 |
| 518 | Ga0373943_0021560 | 3300035170 | Bacteria | 2976 |
| 519 | Ga0373955_0028960 | 3300035172 | Bacteria | 2876 |
| 520 | Ga0373935_0443109 | 3300035692 | Bacteria | 937 |
| 521 | Ga0373927_0014915 | 3300035695 | Bacteria | 5140 |
| 522 | Ga0373927_0191488 | 3300035695 | Bacteria | 1342 |
| 523 | Ga0373933_0000836 | 3300035724 | Bacteria | 18821 |
| 524 | Ga0373937_0002242 | 3300036401 | Bacteria | 16140 |
| 525 | Ga0395899_0000089 | 3300037312 | Bacteria | 156851 |
| 526 | Ga0395899_0012531 | 3300037312 | Bacteria | 6498 |
| 527 | Ga0395899_0147439 | 3300037312 | Bacteria | 1670 |
| 528 | Ga0395899_0177970 | 3300037312 | Bacteria | 1494 |
| 529 | Ga0395899_0236952 | 3300037312 | Bacteria | 1257 |
| 530 | Ga0395899_0274215 | 3300037312 | Bacteria | 1149 |
| 531 | Ga0395900_0000029 | 3300037418 | Bacteria | 281061 |
| 532 | Ga0395900_0000651 | 3300037418 | Bacteria | 46429 |
| 533 | Ga0395900_0007702 | 3300037418 | Bacteria | 11106 |
| 534 | Ga0395900_0076239 | 3300037418 | Bacteria | 3446 |
| 535 | Ga0395900_0092578 | 3300037418 | Bacteria | 3106 |
| 536 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 537 | Ga0395898_0000241 | 3300037466 | Bacteria | 138133 |
| 538 | Ga0395898_0004579 | 3300037466 | Bacteria | 15091 |
| 539 | Ga0395898_0029429 | 3300037466 | Bacteria | 5502 |
| 540 | Ga0395898_0042982 | 3300037466 | Bacteria | 4454 |
| 541 | Ga0395898_0111996 | 3300037466 | Bacteria | 2615 |
| 542 | Ga0395901_0000873 | 3300038443 | Bacteria | 33251 |
| 543 | Ga0395901_0003835 | 3300038443 | Bacteria | 15156 |
| 544 | Ga0395901_0021565 | 3300038443 | Bacteria | 6600 |
| 545 | Ga0395901_0062534 | 3300038443 | Bacteria | 3873 |
| 546 | Ga0395901_0273491 | 3300038443 | Bacteria | 1756 |
| 547 | Ga0395901_0470476 | 3300038443 | Bacteria | 1283 |
| 548 | Ga0451795_0663999 | 3300041456 | Bacteria | 958 |
| 549 | Ga0451807_2321265 | 3300041486 | Bacteria | 1700 |
| 550 | Ga0439459_0007326 | 3300042438 | Bacteria | 1861 |
| 551 | Ga0466969_0006829 | 3300044656 | Bacteria | 6071 |
| 552 | Ga0466972_0001275 | 3300044658 | Bacteria | 12158 |
| 553 | Ga0466965_0044614 | 3300044683 | Bacteria | 2191 |
| 554 | Ga0466966_0021050 | 3300044684 | Bacteria | 4283 |
| 555 | Ga0466966_0045989 | 3300044684 | Bacteria | 2788 |
| 556 | Ga0466961_0000345 | 3300044693 | Bacteria | 30306 |
| 557 | Ga0466961_0004106 | 3300044693 | Bacteria | 9090 |
| 558 | Ga0466961_0005564 | 3300044693 | Bacteria | 7952 |
| 559 | Ga0466961_0012072 | 3300044693 | Bacteria | 5520 |
| 560 | Ga0466961_0320382 | 3300044693 | Bacteria | 945 |
| 561 | Ga0466961_0413741 | 3300044693 | Bacteria | 817 |
| 562 | Ga0466963_0202335 | 3300044694 | Bacteria | 1389 |
| 563 | Ga0466971_0012327 | 3300044719 | Bacteria | 3744 |
| 564 | Ga0466971_0060637 | 3300044719 | Bacteria | 1710 |
| 565 | Ga0466970_0008454 | 3300044765 | Bacteria | 5181 |
| 566 | Ga0466970_0014316 | 3300044765 | Bacteria | 4070 |
| 567 | Ga0466970_0099205 | 3300044765 | Bacteria | 1586 |
| 568 | Ga0466957_0017384 | 3300044842 | Bacteria | 4210 |
| 569 | Ga0466957_0090235 | 3300044842 | Bacteria | 1919 |
| 570 | Ga0466957_0271070 | 3300044842 | Bacteria | 1133 |
| 571 | Ga0466959_0000148 | 3300045049 | Bacteria | 45981 |
| 572 | Ga0466959_0002116 | 3300045049 | Bacteria | 12562 |
| 573 | Ga0466959_0028465 | 3300045049 | Bacteria | 4143 |
| 574 | Ga0466959_0109786 | 3300045049 | Bacteria | 1969 |
| 575 | Ga0466959_0128582 | 3300045049 | Bacteria | 1796 |
| 576 | Ga0466959_0130936 | 3300045049 | Bacteria | 1778 |
| 577 | Ga0451576_1347146 | 3300045051 | Bacteria | 743 |
| 578 | Ga0466958_0006082 | 3300045836 | Bacteria | 6543 |
| 579 | Ga0466958_0008710 | 3300045836 | Bacteria | 5632 |
| 580 | Ga0466958_0079594 | 3300045836 | Bacteria | 2015 |
| 581 | Ga0466958_0215517 | 3300045836 | Bacteria | 1224 |
| 582 | Ga0466958_0409055 | 3300045836 | Bacteria | 876 |
| 583 | Ga0466967_0104957 | 3300045976 | Bacteria | 2588 |
| 584 | Ga0495592_0000556 | 3300046454 | Bacteria | 26585 |
| 585 | Ga0495629_0070660 | 3300046459 | Bacteria | 2436 |
| 586 | Ga0495638_0001233 | 3300046460 | Bacteria | 24188 |
| 587 | Ga0495651_0008843 | 3300046462 | Bacteria | 7728 |
| 588 | Ga0495653_0001754 | 3300046463 | Bacteria | 17102 |
| 589 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 590 | Ga0495582_0107775 | 3300046473 | Bacteria | 1564 |
| 591 | Ga0495639_0042443 | 3300046475 | Bacteria | 2051 |
| 592 | Ga0495639_0505217 | 3300046475 | Bacteria | 617 |
| 593 | Ga0495664_0195749 | 3300046477 | Bacteria | 1225 |
| 594 | Ga0495594_0054989 | 3300046499 | Bacteria | 2194 |
| 595 | Ga0495594_0072357 | 3300046499 | Bacteria | 1918 |
| 596 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 597 | Ga0495608_0078561 | 3300046511 | Bacteria | 2146 |
| 598 | Ga0495628_0001995 | 3300046516 | Bacteria | 18493 |
| 599 | Ga0495630_0002377 | 3300046517 | Bacteria | 13064 |
| 600 | Ga0495630_0297828 | 3300046517 | Bacteria | 1232 |
| 601 | Ga0495652_0296850 | 3300046529 | Bacteria | 1176 |
| 602 | Ga0495665_0056746 | 3300046531 | Bacteria | 2067 |
| 603 | Ga0495586_0005012 | 3300046535 | Bacteria | 7088 |
| 604 | Ga0495587_0023366 | 3300046536 | Bacteria | 3798 |
| 605 | Ga0495645_0000351 | 3300046543 | Bacteria | 32660 |
| 606 | Ga0495635_0020957 | 3300046663 | Bacteria | 4555 |
| 607 | Ga0495635_0350485 | 3300046663 | Bacteria | 985 |
| 608 | Ga0495657_0000570 | 3300046675 | Bacteria | 33908 |
| 609 | Ga0495599_0001218 | 3300046678 | Bacteria | 14597 |
| 610 | Ga0495623_0002945 | 3300046679 | Bacteria | 11200 |
| 611 | Ga0495646_0001207 | 3300046680 | Bacteria | 15118 |
| 612 | Ga0495658_0373345 | 3300046683 | Bacteria | 908 |
| 613 | Ga0495613_0061021 | 3300046689 | Bacteria | 2762 |
| 614 | Ga0495649_0000228 | 3300046694 | Bacteria | 49043 |
| 615 | Ga0495600_0000232 | 3300046809 | Bacteria | 30893 |
| 616 | Ga0495581_0102134 | 3300047315 | Bacteria | 1666 |
| 617 | Ga0495581_0105760 | 3300047315 | Bacteria | 1635 |
| 618 | Ga0495604_0000429 | 3300047317 | Bacteria | 37816 |
| 619 | Ga0495674_0002730 | 3300047319 | Bacteria | 17149 |
| 620 | Ga0495674_0019274 | 3300047319 | Bacteria | 6335 |
| 621 | Ga0495672_0009110 | 3300047320 | Bacteria | 7237 |
| 622 | Ga0495684_0000115 | 3300047471 | Bacteria | 58017 |
| 623 | Ga0495684_0065400 | 3300047471 | Bacteria | 2764 |
| 624 | Ga0495602_0100458 | 3300048088 | Unclassified | 2375 |
| 625 | Ga0496101_0973981 | 3300048904 | Bacteria | 667 |
| 626 | Ga0496104_0000041 | 3300048907 | Bacteria | 161394 |
| 627 | Ga0496105_0000022 | 3300048908 | Bacteria | 161208 |
| 628 | Ga0496105_0177054 | 3300048908 | Bacteria | 1747 |
| 629 | Ga0496112_0652152 | 3300048915 | Bacteria | 982 |
| 630 | Ga0496113_0022532 | 3300048916 | Bacteria | 4457 |
| 631 | Ga0496114_0084714 | 3300048917 | Bacteria | 2684 |
| 632 | Ga0496115_0000114 | 3300048918 | Bacteria | 73307 |
| 633 | Ga0496115_0002199 | 3300048918 | Bacteria | 13961 |
| 634 | Ga0496115_0015302 | 3300048918 | Bacteria | 5817 |
| 635 | Ga0496117_0191280 | 3300048920 | Bacteria | 1165 |
| 636 | Ga0496118_0000264 | 3300048921 | Bacteria | 91882 |
| 637 | Ga0496121_0039863 | 3300048924 | Bacteria | 4131 |
| 638 | Ga0496121_0122684 | 3300048924 | Bacteria | 1959 |
| 639 | Ga0496121_0196226 | 3300048924 | Bacteria | 1443 |
| 640 | Ga0496125_0000604 | 3300048928 | Bacteria | 61025 |
| 641 | Ga0496125_0083196 | 3300048928 | Bacteria | 2436 |
| 642 | Ga0496126_0005938 | 3300048929 | Bacteria | 13757 |
| 643 | Ga0496126_0015681 | 3300048929 | Bacteria | 7613 |
| 644 | Ga0496126_0024412 | 3300048929 | Bacteria | 5838 |
| 645 | Ga0496126_0177501 | 3300048929 | Bacteria | 1811 |
| 646 | Ga0495678_038190 | 3300049459 | Bacteria | 1945 |
| 647 | Ga0495678_165713 | 3300049459 | Bacteria | 703 |
| 648 | Ga0501031_0125479 | 3300049568 | Bacteria | 1677 |
| 649 | Ga0501032_0044875 | 3300049569 | Bacteria | 2991 |
| 650 | Ga0501032_0051863 | 3300049569 | Bacteria | 2765 |
| 651 | Ga0501032_0077225 | 3300049569 | Bacteria | 2217 |
| 652 | Ga0501033_0011789 | 3300049570 | Bacteria | 6681 |
| 653 | Ga0501033_0075059 | 3300049570 | Bacteria | 2482 |
| 654 | Ga0501033_0264150 | 3300049570 | Bacteria | 1218 |
| 655 | Ga0501034_0007995 | 3300049571 | Bacteria | 11227 |
| 656 | Ga0501034_0010146 | 3300049571 | Bacteria | 9828 |
| 657 | Ga0501034_0034354 | 3300049571 | Bacteria | 5140 |
| 658 | Ga0501034_0255425 | 3300049571 | Bacteria | 1696 |
| 659 | Ga0501036_0019161 | 3300049572 | Bacteria | 5741 |
| 660 | Ga0501036_0079512 | 3300049572 | Bacteria | 2773 |
| 661 | Ga0501036_0093793 | 3300049572 | Bacteria | 2536 |
| 662 | Ga0501036_0528735 | 3300049572 | Bacteria | 980 |
| 663 | Ga0501037_0008152 | 3300049573 | Bacteria | 7678 |
| 664 | Ga0501037_0009429 | 3300049573 | Bacteria | 7164 |
| 665 | Ga0501037_0132063 | 3300049573 | Bacteria | 1790 |
| 666 | Ga0501037_0401833 | 3300049573 | Bacteria | 940 |
| 667 | Ga0501037_0448278 | 3300049573 | Bacteria | 880 |
| 668 | Ga0501037_0538030 | 3300049573 | Bacteria | 789 |
| 669 | Ga0501038_0000645 | 3300049574 | Bacteria | 30998 |
| 670 | Ga0501038_0140085 | 3300049574 | Bacteria | 1979 |
| 671 | Ga0501038_0342571 | 3300049574 | Bacteria | 1165 |
| 672 | Ga0501038_0401927 | 3300049574 | Bacteria | 1060 |
| 673 | Ga0501039_0077980 | 3300049575 | Bacteria | 2577 |
| 674 | Ga0501039_0156809 | 3300049575 | Bacteria | 1788 |
| 675 | Ga0501039_0175257 | 3300049575 | Bacteria | 1686 |
| 676 | Ga0501042_0127555 | 3300049578 | Bacteria | 1832 |
| 677 | Ga0501043_0016067 | 3300049579 | Bacteria | 5870 |
| 678 | Ga0501043_0045728 | 3300049579 | Bacteria | 3442 |
| 679 | Ga0501043_0091025 | 3300049579 | Bacteria | 2398 |
| 680 | Ga0501043_0158767 | 3300049579 | Bacteria | 1767 |
| 681 | Ga0501043_0176790 | 3300049579 | Bacteria | 1664 |
| 682 | Ga0501046_0011217 | 3300049580 | Bacteria | 7674 |
| 683 | Ga0501046_0046919 | 3300049580 | Bacteria | 3427 |
| 684 | Ga0501046_0143055 | 3300049580 | Bacteria | 1808 |
| 685 | Ga0501046_0397947 | 3300049580 | Bacteria | 995 |
| 686 | Ga0501047_0041830 | 3300049581 | Bacteria | 4427 |
| 687 | Ga0501047_0074836 | 3300049581 | Bacteria | 3260 |
| 688 | Ga0501047_0163581 | 3300049581 | Bacteria | 2096 |
| 689 | Ga0501047_0195408 | 3300049581 | Bacteria | 1885 |
| 690 | Ga0501047_0227329 | 3300049581 | Bacteria | 1720 |
| 691 | Ga0501047_0541774 | 3300049581 | Bacteria | 988 |
| 692 | Ga0501048_0045725 | 3300049582 | Bacteria | 3126 |
| 693 | Ga0501048_0070554 | 3300049582 | Bacteria | 2467 |
| 694 | Ga0501048_0710439 | 3300049582 | Bacteria | 722 |
| 695 | Ga0501068_0044775 | 3300049584 | Bacteria | 2665 |
| 696 | Ga0501070_0052824 | 3300049586 | Bacteria | 3372 |
| 697 | Ga0501070_0122601 | 3300049586 | Bacteria | 2148 |
| 698 | Ga0501070_0319709 | 3300049586 | Bacteria | 1262 |
| 699 | Ga0501071_0304687 | 3300049587 | Bacteria | 1208 |
| 700 | Ga0501073_0041674 | 3300049589 | Bacteria | 3244 |
| 701 | Ga0501073_0083883 | 3300049589 | Bacteria | 2217 |
| 702 | Ga0501073_0084864 | 3300049589 | Bacteria | 2203 |
| 703 | Ga0501074_0313423 | 3300049590 | Bacteria | 1114 |
| 704 | Ga0501079_0415993 | 3300049741 | Bacteria | 1055 |
| 705 | Ga0501080_0026675 | 3300049742 | Bacteria | 5368 |
| 706 | Ga0501080_0060795 | 3300049742 | Bacteria | 3517 |
| 707 | Ga0501080_0233258 | 3300049742 | Bacteria | 1682 |
| 708 | Ga0501035_0035859 | 3300049822 | Bacteria | 4499 |
| 709 | Ga0501035_0047260 | 3300049822 | Bacteria | 3864 |
| 710 | Ga0501035_0048891 | 3300049822 | Bacteria | 3791 |
| 711 | Ga0501035_0052939 | 3300049822 | Bacteria | 3631 |
| 712 | Ga0501035_0111969 | 3300049822 | Bacteria | 2391 |
| 713 | Ga0501035_0167333 | 3300049822 | Bacteria | 1900 |
| 714 | Ga0501035_0191640 | 3300049822 | Bacteria | 1757 |
| 715 | Ga0501035_0226084 | 3300049822 | Bacteria | 1596 |
| 716 | Ga0501035_0439685 | 3300049822 | Bacteria | 1080 |
| 717 | Ga0501035_0652078 | 3300049822 | Bacteria | 853 |
| 718 | Ga0501044_0022729 | 3300049823 | Bacteria | 6677 |
| 719 | Ga0501044_0030494 | 3300049823 | Bacteria | 5683 |
| 720 | Ga0501044_0058268 | 3300049823 | Bacteria | 3961 |
| 721 | Ga0501044_0093702 | 3300049823 | Bacteria | 3028 |
| 722 | Ga0501044_0221312 | 3300049823 | Bacteria | 1843 |
| 723 | Ga0501044_0284672 | 3300049823 | Bacteria | 1585 |
| 724 | Ga0501044_0342416 | 3300049823 | Bacteria | 1416 |
| 725 | Ga0501044_0367726 | 3300049823 | Bacteria | 1355 |
| 726 | Ga0501044_0474372 | 3300049823 | Unclassified | 1155 |
| 727 | Ga0501044_0637572 | 3300049823 | Bacteria | 955 |
| 728 | nmdc:mga06r32_219190_c1 | 3300050510 | Bacteria | 1891 |
| 729 | Ga0495612_0000706 | 3300053078 | Bacteria | 13533 |
| 730 | Ga0495619_0004129 | 3300053085 | Bacteria | 9280 |
| 731 | Ga0500646_0007243 | 3300053090 | Bacteria | 2832 |
| 732 | Ga0500597_000037 | 3300053120 | Bacteria | 26711 |
| 733 | Ga0500597_161391 | 3300053120 | Bacteria | 959 |
| 734 | Ga0501082_0110921 | 3300060353 | Bacteria | 2374 |
| 735 | Ga0466962_0030288 | 3300061719 | Bacteria | 2591 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_100193912 | Ga0070694_1001939122 | 166 |
| 2 | 3300005545 | Ga0070695_100020249 | Ga0070695_1000202492 | 166 |
| 3 | 3300005547 | Ga0070693_100211150 | Ga0070693_1002111501 | 166 |
| 4 | 3300005437 | Ga0070710_10045776 | Ga0070710_100457762 | 171 |
| 5 | 3300049569 | Ga0501032_0044875 | Ga0501032_0044875_1859_2500 | 173 |
| 6 | 3300049586 | Ga0501070_0319709 | Ga0501070_0319709_200_841 | 173 |
| 7 | 3300049823 | Ga0501044_0058268 | Ga0501044_0058268_3163_3804 | 173 |
| 8 | 3300046475 | Ga0495639_0505217 | Ga0495639_0505217_52_606 | 181 |
| 9 | 3300048920 | Ga0496117_0191280 | Ga0496117_0191280_606_1154 | 182 |
| 10 | 3300044684 | Ga0466966_0021050 | Ga0466966_0021050_3706_4257 | 183 |
| 11 | 3300044693 | Ga0466961_0413741 | Ga0466961_0413741_240_791 | 183 |
| 12 | 3300007265 | Ga0099794_10000575 | Ga0099794_100005757 | 185 |
| 13 | 3300027671 | Ga0209588_1000001 | Ga0209588_1000001145 | 185 |
| 14 | 3300005468 | Ga0070707_100039332 | Ga0070707_1000393322 | 186 |
| 15 | 3300005471 | Ga0070698_100120714 | Ga0070698_1001207142 | 186 |
| 16 | 3300005536 | Ga0070697_100051466 | Ga0070697_1000514662 | 186 |
| 17 | 3300025910 | Ga0207684_10000121 | Ga0207684_1000012150 | 186 |
| 18 | 3300025922 | Ga0207646_10038988 | Ga0207646_100389882 | 186 |
| 19 | 3300032002 | Ga0307416_100825753 | Ga0307416_1008257531 | 187 |
| 20 | 3300005329 | Ga0070683_100171784 | Ga0070683_1001717842 | 189 |
| 21 | 3300005337 | Ga0070682_100792045 | Ga0070682_1007920451 | 189 |
| 22 | 3300005353 | Ga0070669_100037305 | Ga0070669_1000373053 | 189 |
| 23 | 3300005354 | Ga0070675_100272724 | Ga0070675_1002727242 | 189 |
| 24 | 3300005530 | Ga0070679_100777117 | Ga0070679_1007771172 | 189 |
| 25 | 3300014325 | Ga0163163_10257451 | Ga0163163_102574512 | 189 |
| 26 | 3300025923 | Ga0207681_10196440 | Ga0207681_101964402 | 189 |
| 27 | 3300025944 | Ga0207661_10168474 | Ga0207661_101684742 | 189 |
| 28 | 3300047320 | Ga0495672_0009110 | Ga0495672_0009110_4823_5410 | 189 |
| 29 | 3300035086 | Ga0373934_0015089 | Ga0373934_0015089_1546_2127 | 190 |
| 30 | 3300035111 | Ga0373923_0001685 | Ga0373923_0001685_4426_5007 | 190 |
| 31 | 3300035117 | Ga0373953_0021480 | Ga0373953_0021480_111_692 | 190 |
| 32 | 3300035118 | Ga0373954_0106440 | Ga0373954_0106440_112_693 | 190 |
| 33 | 3300035119 | Ga0373956_0000342 | Ga0373956_0000342_425_1006 | 190 |
| 34 | 3300035120 | Ga0373957_0004152 | Ga0373957_0004152_1025_1606 | 190 |
| 35 | 3300035172 | Ga0373955_0028960 | Ga0373955_0028960_626_1207 | 190 |
| 36 | 3300035692 | Ga0373935_0443109 | Ga0373935_0443109_90_671 | 190 |
| 37 | 3300035724 | Ga0373933_0000836 | Ga0373933_0000836_16570_17151 | 190 |
| 38 | 3300036401 | Ga0373937_0002242 | Ga0373937_0002242_13867_14448 | 190 |
| 39 | 3300046454 | Ga0495592_0000556 | Ga0495592_0000556_2610_3191 | 190 |
| 40 | 3300046459 | Ga0495629_0070660 | Ga0495629_0070660_1063_1644 | 190 |
| 41 | 3300046462 | Ga0495651_0008843 | Ga0495651_0008843_978_1559 | 190 |
| 42 | 3300046463 | Ga0495653_0001754 | Ga0495653_0001754_6565_7146 | 190 |
| 43 | 3300046477 | Ga0495664_0195749 | Ga0495664_0195749_430_1011 | 190 |
| 44 | 3300046511 | Ga0495608_0078561 | Ga0495608_0078561_1117_1698 | 190 |
| 45 | 3300046516 | Ga0495628_0001995 | Ga0495628_0001995_2976_3557 | 190 |
| 46 | 3300046517 | Ga0495630_0002377 | Ga0495630_0002377_9455_10036 | 190 |
| 47 | 3300046529 | Ga0495652_0296850 | Ga0495652_0296850_64_645 | 190 |
| 48 | 3300046531 | Ga0495665_0056746 | Ga0495665_0056746_1364_1945 | 190 |
| 49 | 3300046536 | Ga0495587_0023366 | Ga0495587_0023366_1641_2222 | 190 |
| 50 | 3300046543 | Ga0495645_0000351 | Ga0495645_0000351_17167_17748 | 190 |
| 51 | 3300046663 | Ga0495635_0020957 | Ga0495635_0020957_1098_1679 | 190 |
| 52 | 3300046675 | Ga0495657_0000570 | Ga0495657_0000570_16920_17501 | 190 |
| 53 | 3300046678 | Ga0495599_0001218 | Ga0495599_0001218_1458_2039 | 190 |
| 54 | 3300046679 | Ga0495623_0002945 | Ga0495623_0002945_9975_10556 | 190 |
| 55 | 3300046680 | Ga0495646_0001207 | Ga0495646_0001207_1674_2255 | 190 |
| 56 | 3300046689 | Ga0495613_0061021 | Ga0495613_0061021_86_667 | 190 |
| 57 | 3300046809 | Ga0495600_0000232 | Ga0495600_0000232_27497_28078 | 190 |
| 58 | 3300047315 | Ga0495581_0102134 | Ga0495581_0102134_288_869 | 190 |
| 59 | 3300047317 | Ga0495604_0000429 | Ga0495604_0000429_34522_35103 | 190 |
| 60 | 3300047319 | Ga0495674_0002730 | Ga0495674_0002730_3704_4285 | 190 |
| 61 | 3300047471 | Ga0495684_0000115 | Ga0495684_0000115_13314_13895 | 190 |
| 62 | 3300048088 | Ga0495602_0100458 | Ga0495602_0100458_1550_2131 | 190 |
| 63 | 3300050510 | nmdc:mga06r32_219190_c1 | nmdc:mga06r32_219190_c1_781_1362 | 190 |
| 64 | 3300053078 | Ga0495612_0000706 | Ga0495612_0000706_8289_8870 | 190 |
| 65 | 3300053085 | Ga0495619_0004129 | Ga0495619_0004129_5785_6366 | 190 |
| 66 | 3300005328 | Ga0070676_10046880 | Ga0070676_100468802 | 191 |
| 67 | 3300005334 | Ga0068869_100266181 | Ga0068869_1002661812 | 191 |
| 68 | 3300005354 | Ga0070675_100075845 | Ga0070675_1000758452 | 191 |
| 69 | 3300005445 | Ga0070708_100000007 | Ga0070708_100000007114 | 191 |
| 70 | 3300005468 | Ga0070707_100096329 | Ga0070707_1000963293 | 191 |
| 71 | 3300005471 | Ga0070698_100262638 | Ga0070698_1002626381 | 191 |
| 72 | 3300005614 | Ga0068856_100420258 | Ga0068856_1004202582 | 191 |
| 73 | 3300005844 | Ga0068862_100023433 | Ga0068862_1000234332 | 191 |
| 74 | 3300006175 | Ga0070712_100669544 | Ga0070712_1006695442 | 191 |
| 75 | 3300006881 | Ga0068865_100158311 | Ga0068865_1001583112 | 191 |
| 76 | 3300009098 | Ga0105245_10355162 | Ga0105245_103551622 | 191 |
| 77 | 3300009148 | Ga0105243_10369795 | Ga0105243_103697952 | 191 |
| 78 | 3300009177 | Ga0105248_10506360 | Ga0105248_105063602 | 191 |
| 79 | 3300009177 | Ga0105248_10965684 | Ga0105248_109656841 | 191 |
| 80 | 3300009551 | Ga0105238_10612615 | Ga0105238_106126152 | 191 |
| 81 | 3300009553 | Ga0105249_10069077 | Ga0105249_100690772 | 191 |
| 82 | 3300011119 | Ga0105246_10296663 | Ga0105246_102966632 | 191 |
| 83 | 3300013104 | Ga0157370_10004556 | Ga0157370_100045566 | 191 |
| 84 | 3300013296 | Ga0157374_10207695 | Ga0157374_102076952 | 191 |
| 85 | 3300013297 | Ga0157378_10217786 | Ga0157378_102177862 | 191 |
| 86 | 3300013307 | Ga0157372_10069158 | Ga0157372_100691582 | 191 |
| 87 | 3300013308 | Ga0157375_10164466 | Ga0157375_101644662 | 191 |
| 88 | 3300014745 | Ga0157377_10331037 | Ga0157377_103310372 | 191 |
| 89 | 3300025903 | Ga0207680_10278788 | Ga0207680_102787882 | 191 |
| 90 | 3300025906 | Ga0207699_10076986 | Ga0207699_100769861 | 191 |
| 91 | 3300025907 | Ga0207645_10120717 | Ga0207645_101207173 | 191 |
| 92 | 3300025924 | Ga0207694_10579962 | Ga0207694_105799622 | 191 |
| 93 | 3300025925 | Ga0207650_10369008 | Ga0207650_103690082 | 191 |
| 94 | 3300025928 | Ga0207700_10096576 | Ga0207700_100965763 | 191 |
| 95 | 3300025934 | Ga0207686_10140942 | Ga0207686_101409421 | 191 |
| 96 | 3300025939 | Ga0207665_10116644 | Ga0207665_101166442 | 191 |
| 97 | 3300025942 | Ga0207689_10117797 | Ga0207689_101177972 | 191 |
| 98 | 3300025960 | Ga0207651_10102122 | Ga0207651_101021223 | 191 |
| 99 | 3300026023 | Ga0207677_10197701 | Ga0207677_101977012 | 191 |
| 100 | 3300026116 | Ga0207674_10678227 | Ga0207674_106782272 | 191 |
| 101 | 3300028380 | Ga0268265_10441971 | Ga0268265_104419712 | 191 |
| 102 | 3300035170 | Ga0373943_0021560 | Ga0373943_0021560_1709_2308 | 191 |
| 103 | 3300035695 | Ga0373927_0014915 | Ga0373927_0014915_3474_4121 | 191 |
| 104 | 3300035695 | Ga0373927_0191488 | Ga0373927_0191488_285_884 | 191 |
| 105 | 3300046473 | Ga0495582_0107775 | Ga0495582_0107775_97_744 | 191 |
| 106 | 3300046475 | Ga0495639_0042443 | Ga0495639_0042443_1398_1997 | 191 |
| 107 | 3300046499 | Ga0495594_0054989 | Ga0495594_0054989_923_1522 | 191 |
| 108 | 3300046499 | Ga0495594_0072357 | Ga0495594_0072357_1125_1724 | 191 |
| 109 | 3300046517 | Ga0495630_0297828 | Ga0495630_0297828_470_1069 | 191 |
| 110 | 3300046535 | Ga0495586_0005012 | Ga0495586_0005012_1182_1781 | 191 |
| 111 | 3300046663 | Ga0495635_0350485 | Ga0495635_0350485_334_933 | 191 |
| 112 | 3300046683 | Ga0495658_0373345 | Ga0495658_0373345_19_618 | 191 |
| 113 | 3300047315 | Ga0495581_0105760 | Ga0495581_0105760_291_890 | 191 |
| 114 | 3300047319 | Ga0495674_0019274 | Ga0495674_0019274_211_858 | 191 |
| 115 | 3300047471 | Ga0495684_0065400 | Ga0495684_0065400_1015_1614 | 191 |
| 116 | 3300048915 | Ga0496112_0652152 | Ga0496112_0652152_244_843 | 191 |
| 117 | 3300049570 | Ga0501033_0075059 | Ga0501033_0075059_630_1235 | 191 |
| 118 | 3300049571 | Ga0501034_0034354 | Ga0501034_0034354_1987_2592 | 191 |
| 119 | 3300049823 | Ga0501044_0474372 | Ga0501044_0474372_219_824 | 191 |
| 120 | iso_pu_bacteria | 2593339239 | 2595451482 | 191 |
| 121 | iso_pu_bacteria | 2687453130 | 2687581995 | 191 |
| 122 | iso_pu_bacteria | 2739367700 | 2739729972 | 191 |
| 123 | iso_pu_bacteria | 2884411467 | 2884412984 | 191 |
| 124 | iso_pu_bacteria | 2895395659 | 2895397246 | 191 |
| 125 | iso_pu_bacteria | 2919404418 | 2919404563 | 191 |
| 126 | iso_pu_bacteria | 2939611941 | 2939612879 | 191 |
| 127 | 3300005329 | Ga0070683_100033550 | Ga0070683_1000335503 | 192 |
| 128 | 3300005329 | Ga0070683_100987400 | Ga0070683_1009874001 | 192 |
| 129 | 3300005330 | Ga0070690_100043209 | Ga0070690_1000432092 | 192 |
| 130 | 3300005331 | Ga0070670_100035414 | Ga0070670_1000354142 | 192 |
| 131 | 3300005334 | Ga0068869_100009671 | Ga0068869_1000096713 | 192 |
| 132 | 3300005335 | Ga0070666_10339682 | Ga0070666_103396822 | 192 |
| 133 | 3300005336 | Ga0070680_100008193 | Ga0070680_1000081933 | 192 |
| 134 | 3300005337 | Ga0070682_100021180 | Ga0070682_1000211802 | 192 |
| 135 | 3300005338 | Ga0068868_100057784 | Ga0068868_1000577842 | 192 |
| 136 | 3300005339 | Ga0070660_100112135 | Ga0070660_1001121352 | 192 |
| 137 | 3300005340 | Ga0070689_100080965 | Ga0070689_1000809653 | 192 |
| 138 | 3300005344 | Ga0070661_100020646 | Ga0070661_1000206463 | 192 |
| 139 | 3300005345 | Ga0070692_10006299 | Ga0070692_100062995 | 192 |
| 140 | 3300005353 | Ga0070669_100082972 | Ga0070669_1000829722 | 192 |
| 141 | 3300005354 | Ga0070675_100025653 | Ga0070675_1000256533 | 192 |
| 142 | 3300005366 | Ga0070659_100047533 | Ga0070659_1000475332 | 192 |
| 143 | 3300005434 | Ga0070709_10302788 | Ga0070709_103027882 | 192 |
| 144 | 3300005444 | Ga0070694_100095027 | Ga0070694_1000950272 | 192 |
| 145 | 3300005457 | Ga0070662_100030126 | Ga0070662_1000301262 | 192 |
| 146 | 3300005458 | Ga0070681_10026364 | Ga0070681_100263643 | 192 |
| 147 | 3300005530 | Ga0070679_100033490 | Ga0070679_1000334903 | 192 |
| 148 | 3300005539 | Ga0068853_100281949 | Ga0068853_1002819492 | 192 |
| 149 | 3300005547 | Ga0070693_100009737 | Ga0070693_1000097373 | 192 |
| 150 | 3300005563 | Ga0068855_100080267 | Ga0068855_1000802673 | 192 |
| 151 | 3300005564 | Ga0070664_100108449 | Ga0070664_1001084492 | 192 |
| 152 | 3300005577 | Ga0068857_100656346 | Ga0068857_1006563461 | 192 |
| 153 | 3300005615 | Ga0070702_100016179 | Ga0070702_1000161792 | 192 |
| 154 | 3300005617 | Ga0068859_100058706 | Ga0068859_1000587063 | 192 |
| 155 | 3300005618 | Ga0068864_100066775 | Ga0068864_1000667752 | 192 |
| 156 | 3300005840 | Ga0068870_10029604 | Ga0068870_100296043 | 192 |
| 157 | 3300005841 | Ga0068863_100015928 | Ga0068863_1000159282 | 192 |
| 158 | 3300005843 | Ga0068860_100048917 | Ga0068860_1000489175 | 192 |
| 159 | 3300006237 | Ga0097621_100021820 | Ga0097621_1000218202 | 192 |
| 160 | 3300006358 | Ga0068871_100025613 | Ga0068871_1000256133 | 192 |
| 161 | 3300006931 | Ga0097620_100058701 | Ga0097620_1000587013 | 192 |
| 162 | 3300009174 | Ga0105241_10045483 | Ga0105241_100454831 | 192 |
| 163 | 3300009177 | Ga0105248_10085167 | Ga0105248_100851672 | 192 |
| 164 | 3300010375 | Ga0105239_10851499 | Ga0105239_108514991 | 192 |
| 165 | 3300011119 | Ga0105246_10021173 | Ga0105246_100211732 | 192 |
| 166 | 3300013105 | Ga0157369_10150651 | Ga0157369_101506512 | 192 |
| 167 | 3300013296 | Ga0157374_10014004 | Ga0157374_100140045 | 192 |
| 168 | 3300013307 | Ga0157372_10025975 | Ga0157372_100259755 | 192 |
| 169 | 3300013307 | Ga0157372_10103762 | Ga0157372_101037622 | 192 |
| 170 | 3300013308 | Ga0157375_10519589 | Ga0157375_105195892 | 192 |
| 171 | 3300014325 | Ga0163163_10018334 | Ga0163163_100183345 | 192 |
| 172 | 3300014745 | Ga0157377_10007481 | Ga0157377_100074814 | 192 |
| 173 | 3300014968 | Ga0157379_10300818 | Ga0157379_103008181 | 192 |
| 174 | 3300014969 | Ga0157376_10006141 | Ga0157376_100061415 | 192 |
| 175 | 3300025903 | Ga0207680_10432295 | Ga0207680_104322952 | 192 |
| 176 | 3300025908 | Ga0207643_10042633 | Ga0207643_100426332 | 192 |
| 177 | 3300025911 | Ga0207654_10083376 | Ga0207654_100833761 | 192 |
| 178 | 3300025914 | Ga0207671_10597923 | Ga0207671_105979231 | 192 |
| 179 | 3300025919 | Ga0207657_10092282 | Ga0207657_100922822 | 192 |
| 180 | 3300025921 | Ga0207652_10012631 | Ga0207652_100126315 | 192 |
| 181 | 3300025923 | Ga0207681_10155946 | Ga0207681_101559461 | 192 |
| 182 | 3300025925 | Ga0207650_10015995 | Ga0207650_100159953 | 192 |
| 183 | 3300025926 | Ga0207659_10005820 | Ga0207659_100058205 | 192 |
| 184 | 3300025927 | Ga0207687_10102250 | Ga0207687_101022501 | 192 |
| 185 | 3300025931 | Ga0207644_10592280 | Ga0207644_105922801 | 192 |
| 186 | 3300025932 | Ga0207690_10034933 | Ga0207690_100349333 | 192 |
| 187 | 3300025933 | Ga0207706_10412971 | Ga0207706_104129712 | 192 |
| 188 | 3300025941 | Ga0207711_10029973 | Ga0207711_100299732 | 192 |
| 189 | 3300025942 | Ga0207689_10002445 | Ga0207689_100024454 | 192 |
| 190 | 3300025944 | Ga0207661_10419015 | Ga0207661_104190152 | 192 |
| 191 | 3300025945 | Ga0207679_10012035 | Ga0207679_100120354 | 192 |
| 192 | 3300026041 | Ga0207639_10408317 | Ga0207639_104083172 | 192 |
| 193 | 3300026095 | Ga0207676_10037898 | Ga0207676_100378981 | 192 |
| 194 | 3300026116 | Ga0207674_10003313 | Ga0207674_100033136 | 192 |
| 195 | 3300026121 | Ga0207683_10188535 | Ga0207683_101885352 | 192 |
| 196 | 3300026142 | Ga0207698_10041829 | Ga0207698_100418294 | 192 |
| 197 | 3300028381 | Ga0268264_10194410 | Ga0268264_101944102 | 192 |
| 198 | 3300045051 | Ga0451576_1347146 | Ga0451576_1347146_53_655 | 192 |
| 199 | 3300049823 | Ga0501044_0342416 | Ga0501044_0342416_511_1095 | 192 |
| 200 | 3300005290 | Ga0065712_10160772 | Ga0065712_101607722 | 193 |
| 201 | 3300005336 | Ga0070680_100776488 | Ga0070680_1007764881 | 193 |
| 202 | 3300005364 | Ga0070673_100350608 | Ga0070673_1003506082 | 193 |
| 203 | 3300005435 | Ga0070714_100062369 | Ga0070714_1000623692 | 193 |
| 204 | 3300005530 | Ga0070679_100259181 | Ga0070679_1002591812 | 193 |
| 205 | 3300014968 | Ga0157379_10369859 | Ga0157379_103698592 | 193 |
| 206 | 3300025912 | Ga0207707_10226382 | Ga0207707_102263822 | 193 |
| 207 | 3300031548 | Ga0307408_100513816 | Ga0307408_1005138162 | 193 |
| 208 | 3300031901 | Ga0307406_10099256 | Ga0307406_100992562 | 193 |
| 209 | 3300032002 | Ga0307416_100198820 | Ga0307416_1001988202 | 193 |
| 210 | 3300005367 | Ga0070667_100014067 | Ga0070667_1000140674 | 194 |
| 211 | 3300005548 | Ga0070665_100000333 | Ga0070665_10000033344 | 194 |
| 212 | 3300010375 | Ga0105239_10134230 | Ga0105239_101342304 | 194 |
| 213 | 3300025986 | Ga0207658_10005424 | Ga0207658_100054249 | 194 |
| 214 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001931 | 194 |
| 215 | 3300041456 | Ga0451795_0663999 | Ga0451795_0663999_126_743 | 194 |
| 216 | 3300048924 | Ga0496121_0196226 | Ga0496121_0196226_444_1061 | 194 |
| 217 | 3300048929 | Ga0496126_0177501 | Ga0496126_0177501_778_1395 | 194 |
| 218 | 3300053120 | Ga0500597_000037 | Ga0500597_000037_11282_11899 | 194 |
| 219 | 3300001990 | JGI24737J22298_10017015 | JGI24737J22298_100170152 | 195 |
| 220 | 3300002067 | JGI24735J21928_10008326 | JGI24735J21928_100083263 | 195 |
| 221 | 3300002705 | JGI25156J39149_1005881 | JGI25156J39149_10058813 | 195 |
| 222 | 3300002705 | JGI25156J39149_1012856 | JGI25156J39149_10128563 | 195 |
| 223 | 3300002737 | JGI25162J39368_1000235 | JGI25162J39368_100023517 | 195 |
| 224 | 3300002737 | JGI25162J39368_1001269 | JGI25162J39368_100126917 | 195 |
| 225 | 3300002737 | JGI25162J39368_1002195 | JGI25162J39368_10021959 | 195 |
| 226 | 3300002737 | JGI25162J39368_1008750 | JGI25162J39368_10087503 | 195 |
| 227 | 3300002741 | JGI25157J39369_1000415 | JGI25157J39369_100041511 | 195 |
| 228 | 3300002741 | JGI25157J39369_1001439 | JGI25157J39369_10014397 | 195 |
| 229 | 3300002741 | JGI25157J39369_1001600 | JGI25157J39369_10016009 | 195 |
| 230 | 3300002771 | JGI25163J39215_1000768 | JGI25163J39215_10007689 | 195 |
| 231 | 3300002772 | JGI25164J39214_1000139 | JGI25164J39214_100013920 | 195 |
| 232 | 3300002772 | JGI25164J39214_1001075 | JGI25164J39214_10010759 | 195 |
| 233 | 3300002772 | JGI25164J39214_1001475 | JGI25164J39214_10014751 | 195 |
| 234 | 3300002772 | JGI25164J39214_1001631 | JGI25164J39214_10016316 | 195 |
| 235 | 3300003214 | JGI25165J46597_1000316 | JGI25165J46597_100031620 | 195 |
| 236 | 3300003214 | JGI25165J46597_1001043 | JGI25165J46597_100104317 | 195 |
| 237 | 3300003214 | JGI25165J46597_1001299 | JGI25165J46597_100129917 | 195 |
| 238 | 3300003214 | JGI25165J46597_1002371 | JGI25165J46597_10023711 | 195 |
| 239 | 3300003316 | rootH1_10041414 | rootH1_100414143 | 195 |
| 240 | 3300003316 | rootH1_10068308 | rootH1_100683082 | 195 |
| 241 | 3300003751 | Ga0055538_1002162 | Ga0055538_10021623 | 195 |
| 242 | 3300003752 | Ga0055539_1001607 | Ga0055539_10016073 | 195 |
| 243 | 3300003756 | Ga0055533_1003938 | Ga0055533_10039383 | 195 |
| 244 | 3300003759 | Ga0055525_1000178 | Ga0055525_100017871 | 195 |
| 245 | 3300003760 | Ga0055527_1000090 | Ga0055527_100009020 | 195 |
| 246 | 3300003760 | Ga0055527_1000100 | Ga0055527_100010017 | 195 |
| 247 | 3300003761 | Ga0055535_1000201 | Ga0055535_100020131 | 195 |
| 248 | 3300003761 | Ga0055535_1000456 | Ga0055535_100045613 | 195 |
| 249 | 3300003761 | Ga0055535_1000742 | Ga0055535_10007423 | 195 |
| 250 | 3300003761 | Ga0055535_1001175 | Ga0055535_10011756 | 195 |
| 251 | 3300003761 | Ga0055535_1001446 | Ga0055535_10014463 | 195 |
| 252 | 3300003761 | Ga0055535_1022041 | Ga0055535_10220411 | 195 |
| 253 | 3300003762 | Ga0055542_1000187 | Ga0055542_100018746 | 195 |
| 254 | 3300003762 | Ga0055542_1000191 | Ga0055542_100019111 | 195 |
| 255 | 3300003762 | Ga0055542_1000212 | Ga0055542_100021230 | 195 |
| 256 | 3300003762 | Ga0055542_1000236 | Ga0055542_100023631 | 195 |
| 257 | 3300003762 | Ga0055542_1000287 | Ga0055542_100028713 | 195 |
| 258 | 3300003762 | Ga0055542_1001002 | Ga0055542_100100217 | 195 |
| 259 | 3300003763 | Ga0055529_1000256 | Ga0055529_100025631 | 195 |
| 260 | 3300003763 | Ga0055529_1000259 | Ga0055529_100025926 | 195 |
| 261 | 3300003763 | Ga0055529_1000386 | Ga0055529_100038625 | 195 |
| 262 | 3300003763 | Ga0055529_1001324 | Ga0055529_100132410 | 195 |
| 263 | 3300005327 | Ga0070658_10001497 | Ga0070658_1000149716 | 195 |
| 264 | 3300005334 | Ga0068869_100035408 | Ga0068869_1000354085 | 195 |
| 265 | 3300005334 | Ga0068869_100168927 | Ga0068869_1001689273 | 195 |
| 266 | 3300005335 | Ga0070666_10000013 | Ga0070666_10000013182 | 195 |
| 267 | 3300005335 | Ga0070666_10002943 | Ga0070666_100029437 | 195 |
| 268 | 3300005337 | Ga0070682_100003692 | Ga0070682_1000036927 | 195 |
| 269 | 3300005337 | Ga0070682_100063155 | Ga0070682_1000631552 | 195 |
| 270 | 3300005337 | Ga0070682_100260995 | Ga0070682_1002609952 | 195 |
| 271 | 3300005337 | Ga0070682_100326442 | Ga0070682_1003264422 | 195 |
| 272 | 3300005338 | Ga0068868_100603892 | Ga0068868_1006038922 | 195 |
| 273 | 3300005339 | Ga0070660_100112186 | Ga0070660_1001121861 | 195 |
| 274 | 3300005339 | Ga0070660_100492422 | Ga0070660_1004924221 | 195 |
| 275 | 3300005340 | Ga0070689_100002814 | Ga0070689_1000028148 | 195 |
| 276 | 3300005340 | Ga0070689_100462536 | Ga0070689_1004625361 | 195 |
| 277 | 3300005344 | Ga0070661_100040860 | Ga0070661_1000408603 | 195 |
| 278 | 3300005344 | Ga0070661_100087838 | Ga0070661_1000878383 | 195 |
| 279 | 3300005344 | Ga0070661_100177642 | Ga0070661_1001776423 | 195 |
| 280 | 3300005345 | Ga0070692_10113658 | Ga0070692_101136583 | 195 |
| 281 | 3300005347 | Ga0070668_100007465 | Ga0070668_1000074652 | 195 |
| 282 | 3300005347 | Ga0070668_100058262 | Ga0070668_1000582625 | 195 |
| 283 | 3300005347 | Ga0070668_100121140 | Ga0070668_1001211402 | 195 |
| 284 | 3300005353 | Ga0070669_100290315 | Ga0070669_1002903152 | 195 |
| 285 | 3300005354 | Ga0070675_100761488 | Ga0070675_1007614882 | 195 |
| 286 | 3300005356 | Ga0070674_100357015 | Ga0070674_1003570152 | 195 |
| 287 | 3300005364 | Ga0070673_100030499 | Ga0070673_1000304997 | 195 |
| 288 | 3300005366 | Ga0070659_100003021 | Ga0070659_1000030213 | 195 |
| 289 | 3300005366 | Ga0070659_100020532 | Ga0070659_1000205323 | 195 |
| 290 | 3300005366 | Ga0070659_100082497 | Ga0070659_1000824971 | 195 |
| 291 | 3300005366 | Ga0070659_100904469 | Ga0070659_1009044691 | 195 |
| 292 | 3300005367 | Ga0070667_100088087 | Ga0070667_1000880873 | 195 |
| 293 | 3300005367 | Ga0070667_100166732 | Ga0070667_1001667322 | 195 |
| 294 | 3300005435 | Ga0070714_100000020 | Ga0070714_10000002035 | 195 |
| 295 | 3300005435 | Ga0070714_100003774 | Ga0070714_1000037748 | 195 |
| 296 | 3300005439 | Ga0070711_100135662 | Ga0070711_1001356622 | 195 |
| 297 | 3300005444 | Ga0070694_100099595 | Ga0070694_1000995953 | 195 |
| 298 | 3300005455 | Ga0070663_100006682 | Ga0070663_1000066825 | 195 |
| 299 | 3300005455 | Ga0070663_100241911 | Ga0070663_1002419113 | 195 |
| 300 | 3300005455 | Ga0070663_100267237 | Ga0070663_1002672372 | 195 |
| 301 | 3300005456 | Ga0070678_100013499 | Ga0070678_1000134994 | 195 |
| 302 | 3300005456 | Ga0070678_100103379 | Ga0070678_1001033794 | 195 |
| 303 | 3300005457 | Ga0070662_100002975 | Ga0070662_10000297512 | 195 |
| 304 | 3300005457 | Ga0070662_100051910 | Ga0070662_1000519105 | 195 |
| 305 | 3300005458 | Ga0070681_10010860 | Ga0070681_100108602 | 195 |
| 306 | 3300005458 | Ga0070681_10027397 | Ga0070681_100273975 | 195 |
| 307 | 3300005458 | Ga0070681_10037699 | Ga0070681_100376993 | 195 |
| 308 | 3300005458 | Ga0070681_10130039 | Ga0070681_101300393 | 195 |
| 309 | 3300005466 | Ga0070685_10000607 | Ga0070685_1000060720 | 195 |
| 310 | 3300005530 | Ga0070679_100153576 | Ga0070679_1001535763 | 195 |
| 311 | 3300005535 | Ga0070684_100532919 | Ga0070684_1005329192 | 195 |
| 312 | 3300005539 | Ga0068853_100006495 | Ga0068853_1000064957 | 195 |
| 313 | 3300005539 | Ga0068853_100176295 | Ga0068853_1001762953 | 195 |
| 314 | 3300005539 | Ga0068853_100225597 | Ga0068853_1002255973 | 195 |
| 315 | 3300005539 | Ga0068853_100752294 | Ga0068853_1007522941 | 195 |
| 316 | 3300005543 | Ga0070672_100011137 | Ga0070672_1000111377 | 195 |
| 317 | 3300005543 | Ga0070672_100027164 | Ga0070672_1000271648 | 195 |
| 318 | 3300005546 | Ga0070696_100001686 | Ga0070696_1000016865 | 195 |
| 319 | 3300005546 | Ga0070696_100004173 | Ga0070696_10000417310 | 195 |
| 320 | 3300005547 | Ga0070693_100004068 | Ga0070693_1000040684 | 195 |
| 321 | 3300005547 | Ga0070693_100030353 | Ga0070693_1000303532 | 195 |
| 322 | 3300005547 | Ga0070693_100189000 | Ga0070693_1001890001 | 195 |
| 323 | 3300005547 | Ga0070693_100410837 | Ga0070693_1004108372 | 195 |
| 324 | 3300005548 | Ga0070665_100000618 | Ga0070665_10000061838 | 195 |
| 325 | 3300005548 | Ga0070665_100032263 | Ga0070665_1000322632 | 195 |
| 326 | 3300005548 | Ga0070665_100136571 | Ga0070665_1001365713 | 195 |
| 327 | 3300005563 | Ga0068855_100054444 | Ga0068855_1000544445 | 195 |
| 328 | 3300005563 | Ga0068855_100073447 | Ga0068855_1000734472 | 195 |
| 329 | 3300005563 | Ga0068855_100399273 | Ga0068855_1003992733 | 195 |
| 330 | 3300005577 | Ga0068857_100030513 | Ga0068857_1000305137 | 195 |
| 331 | 3300005577 | Ga0068857_100147750 | Ga0068857_1001477503 | 195 |
| 332 | 3300005577 | Ga0068857_100251681 | Ga0068857_1002516812 | 195 |
| 333 | 3300005578 | Ga0068854_100054124 | Ga0068854_1000541242 | 195 |
| 334 | 3300005614 | Ga0068856_100042321 | Ga0068856_1000423214 | 195 |
| 335 | 3300005614 | Ga0068856_100046743 | Ga0068856_1000467435 | 195 |
| 336 | 3300005614 | Ga0068856_100118837 | Ga0068856_1001188372 | 195 |
| 337 | 3300005616 | Ga0068852_100554688 | Ga0068852_1005546882 | 195 |
| 338 | 3300005617 | Ga0068859_100037834 | Ga0068859_1000378345 | 195 |
| 339 | 3300005617 | Ga0068859_100233305 | Ga0068859_1002333052 | 195 |
| 340 | 3300005618 | Ga0068864_101325375 | Ga0068864_1013253751 | 195 |
| 341 | 3300005834 | Ga0068851_10000591 | Ga0068851_100005915 | 195 |
| 342 | 3300005840 | Ga0068870_10247110 | Ga0068870_102471101 | 195 |
| 343 | 3300005841 | Ga0068863_100061756 | Ga0068863_1000617562 | 195 |
| 344 | 3300005841 | Ga0068863_100475107 | Ga0068863_1004751072 | 195 |
| 345 | 3300005842 | Ga0068858_100002640 | Ga0068858_10000264015 | 195 |
| 346 | 3300005843 | Ga0068860_100105639 | Ga0068860_1001056395 | 195 |
| 347 | 3300005843 | Ga0068860_100219453 | Ga0068860_1002194532 | 195 |
| 348 | 3300005844 | Ga0068862_100086124 | Ga0068862_1000861243 | 195 |
| 349 | 3300005983 | Ga0081540_1001157 | Ga0081540_10011574 | 195 |
| 350 | 3300006175 | Ga0070712_100226029 | Ga0070712_1002260291 | 195 |
| 351 | 3300006237 | Ga0097621_100046457 | Ga0097621_1000464575 | 195 |
| 352 | 3300006237 | Ga0097621_100064745 | Ga0097621_1000647455 | 195 |
| 353 | 3300006237 | Ga0097621_100553744 | Ga0097621_1005537442 | 195 |
| 354 | 3300006358 | Ga0068871_100810254 | Ga0068871_1008102541 | 195 |
| 355 | 3300006871 | Ga0075434_100628080 | Ga0075434_1006280802 | 195 |
| 356 | 3300006881 | Ga0068865_100184551 | Ga0068865_1001845512 | 195 |
| 357 | 3300006881 | Ga0068865_100220363 | Ga0068865_1002203632 | 195 |
| 358 | 3300006931 | Ga0097620_100037832 | Ga0097620_1000378323 | 195 |
| 359 | 3300006931 | Ga0097620_100233306 | Ga0097620_1002333062 | 195 |
| 360 | 3300009093 | Ga0105240_10013854 | Ga0105240_1001385413 | 195 |
| 361 | 3300009093 | Ga0105240_10103634 | Ga0105240_101036343 | 195 |
| 362 | 3300009093 | Ga0105240_10173549 | Ga0105240_101735493 | 195 |
| 363 | 3300009093 | Ga0105240_10388762 | Ga0105240_103887622 | 195 |
| 364 | 3300009098 | Ga0105245_11081389 | Ga0105245_110813892 | 195 |
| 365 | 3300009174 | Ga0105241_10098624 | Ga0105241_100986243 | 195 |
| 366 | 3300009174 | Ga0105241_10463809 | Ga0105241_104638092 | 195 |
| 367 | 3300009176 | Ga0105242_10128828 | Ga0105242_101288282 | 195 |
| 368 | 3300009176 | Ga0105242_10196201 | Ga0105242_101962013 | 195 |
| 369 | 3300009177 | Ga0105248_10148079 | Ga0105248_101480795 | 195 |
| 370 | 3300009177 | Ga0105248_11199044 | Ga0105248_111990442 | 195 |
| 371 | 3300009545 | Ga0105237_10025886 | Ga0105237_100258862 | 195 |
| 372 | 3300009545 | Ga0105237_10035711 | Ga0105237_100357111 | 195 |
| 373 | 3300009545 | Ga0105237_10074364 | Ga0105237_100743643 | 195 |
| 374 | 3300009551 | Ga0105238_10000131 | Ga0105238_1000013123 | 195 |
| 375 | 3300009551 | Ga0105238_10005675 | Ga0105238_100056755 | 195 |
| 376 | 3300009551 | Ga0105238_10011550 | Ga0105238_100115503 | 195 |
| 377 | 3300009551 | Ga0105238_10019359 | Ga0105238_100193595 | 195 |
| 378 | 3300009551 | Ga0105238_10031956 | Ga0105238_100319564 | 195 |
| 379 | 3300009551 | Ga0105238_10068568 | Ga0105238_100685682 | 195 |
| 380 | 3300009551 | Ga0105238_10626982 | Ga0105238_106269821 | 195 |
| 381 | 3300010375 | Ga0105239_10012447 | Ga0105239_100124476 | 195 |
| 382 | 3300010375 | Ga0105239_10061214 | Ga0105239_100612145 | 195 |
| 383 | 3300010375 | Ga0105239_10259430 | Ga0105239_102594302 | 195 |
| 384 | 3300012502 | Ga0157347_1004129 | Ga0157347_10041292 | 195 |
| 385 | 3300013100 | Ga0157373_10010449 | Ga0157373_100104497 | 195 |
| 386 | 3300013100 | Ga0157373_10167985 | Ga0157373_101679851 | 195 |
| 387 | 3300013102 | Ga0157371_10009406 | Ga0157371_100094063 | 195 |
| 388 | 3300013104 | Ga0157370_10005515 | Ga0157370_100055154 | 195 |
| 389 | 3300013104 | Ga0157370_10011083 | Ga0157370_1001108310 | 195 |
| 390 | 3300013104 | Ga0157370_10036580 | Ga0157370_100365805 | 195 |
| 391 | 3300013104 | Ga0157370_10534889 | Ga0157370_105348891 | 195 |
| 392 | 3300013105 | Ga0157369_10000114 | Ga0157369_1000011440 | 195 |
| 393 | 3300013105 | Ga0157369_10357155 | Ga0157369_103571552 | 195 |
| 394 | 3300013105 | Ga0157369_10761042 | Ga0157369_107610422 | 195 |
| 395 | 3300013296 | Ga0157374_10211096 | Ga0157374_102110962 | 195 |
| 396 | 3300013297 | Ga0157378_10000322 | Ga0157378_1000032221 | 195 |
| 397 | 3300013297 | Ga0157378_10026771 | Ga0157378_100267714 | 195 |
| 398 | 3300013306 | Ga0163162_10043365 | Ga0163162_100433655 | 195 |
| 399 | 3300013306 | Ga0163162_10080175 | Ga0163162_100801753 | 195 |
| 400 | 3300013306 | Ga0163162_10098108 | Ga0163162_100981084 | 195 |
| 401 | 3300013306 | Ga0163162_10420958 | Ga0163162_104209582 | 195 |
| 402 | 3300013307 | Ga0157372_10032948 | Ga0157372_100329482 | 195 |
| 403 | 3300013307 | Ga0157372_10249727 | Ga0157372_102497273 | 195 |
| 404 | 3300013307 | Ga0157372_10414469 | Ga0157372_104144692 | 195 |
| 405 | 3300013307 | Ga0157372_11054734 | Ga0157372_110547342 | 195 |
| 406 | 3300013308 | Ga0157375_10000459 | Ga0157375_100004599 | 195 |
| 407 | 3300013308 | Ga0157375_10035389 | Ga0157375_100353896 | 195 |
| 408 | 3300013308 | Ga0157375_10212061 | Ga0157375_102120612 | 195 |
| 409 | 3300013308 | Ga0157375_11235122 | Ga0157375_112351222 | 195 |
| 410 | 3300014969 | Ga0157376_10001958 | Ga0157376_1000195811 | 195 |
| 411 | 3300014969 | Ga0157376_10045401 | Ga0157376_100454015 | 195 |
| 412 | 3300014969 | Ga0157376_10050961 | Ga0157376_100509615 | 195 |
| 413 | 3300015261 | Ga0182006_1003066 | Ga0182006_10030669 | 195 |
| 414 | 3300015261 | Ga0182006_1143667 | Ga0182006_11436671 | 195 |
| 415 | 3300015262 | Ga0182007_10019186 | Ga0182007_100191862 | 195 |
| 416 | 3300015265 | Ga0182005_1035578 | Ga0182005_10355782 | 195 |
| 417 | 3300015685 | Ga0183369_1003 | Ga0183369_1003284 | 195 |
| 418 | 3300015687 | Ga0183368_1003 | Ga0183368_1003448 | 195 |
| 419 | 3300025206 | Ga0209435_104489 | Ga0209435_1044892 | 195 |
| 420 | 3300025207 | Ga0209760_100541 | Ga0209760_1005419 | 195 |
| 421 | 3300025224 | Ga0209784_100422 | Ga0209784_10042217 | 195 |
| 422 | 3300025225 | Ga0209566_101312 | Ga0209566_1013127 | 195 |
| 423 | 3300025226 | Ga0209674_100012 | Ga0209674_100012191 | 195 |
| 424 | 3300025226 | Ga0209674_100140 | Ga0209674_10014076 | 195 |
| 425 | 3300025226 | Ga0209674_100373 | Ga0209674_10037318 | 195 |
| 426 | 3300025228 | Ga0209672_100005 | Ga0209672_100005442 | 195 |
| 427 | 3300025228 | Ga0209672_100016 | Ga0209672_100016108 | 195 |
| 428 | 3300025228 | Ga0209672_100141 | Ga0209672_10014115 | 195 |
| 429 | 3300025228 | Ga0209672_101550 | Ga0209672_1015505 | 195 |
| 430 | 3300025230 | Ga0209563_100023 | Ga0209563_10002398 | 195 |
| 431 | 3300025231 | Ga0207427_100057 | Ga0207427_10005792 | 195 |
| 432 | 3300025231 | Ga0207427_100111 | Ga0207427_10011153 | 195 |
| 433 | 3300025231 | Ga0207427_100179 | Ga0207427_10017958 | 195 |
| 434 | 3300025231 | Ga0207427_100443 | Ga0207427_10044311 | 195 |
| 435 | 3300025231 | Ga0207427_101239 | Ga0207427_10123910 | 195 |
| 436 | 3300025233 | Ga0209437_100099 | Ga0209437_10009989 | 195 |
| 437 | 3300025233 | Ga0209437_100184 | Ga0209437_10018492 | 195 |
| 438 | 3300025233 | Ga0209437_100270 | Ga0209437_10027048 | 195 |
| 439 | 3300025233 | Ga0209437_100878 | Ga0209437_1008786 | 195 |
| 440 | 3300025233 | Ga0209437_102084 | Ga0209437_1020842 | 195 |
| 441 | 3300025242 | Ga0209258_100006 | Ga0209258_100006442 | 195 |
| 442 | 3300025242 | Ga0209258_100012 | Ga0209258_100012249 | 195 |
| 443 | 3300025242 | Ga0209258_100119 | Ga0209258_10011959 | 195 |
| 444 | 3300025242 | Ga0209258_100316 | Ga0209258_10031611 | 195 |
| 445 | 3300025242 | Ga0209258_100509 | Ga0209258_10050920 | 195 |
| 446 | 3300025242 | Ga0209258_101510 | Ga0209258_1015108 | 195 |
| 447 | 3300025246 | Ga0209646_1000487 | Ga0209646_100048717 | 195 |
| 448 | 3300025246 | Ga0209646_1001182 | Ga0209646_10011829 | 195 |
| 449 | 3300025246 | Ga0209646_1021838 | Ga0209646_10218381 | 195 |
| 450 | 3300025250 | Ga0209026_1000117 | Ga0209026_100011732 | 195 |
| 451 | 3300025250 | Ga0209026_1000276 | Ga0209026_10002763 | 195 |
| 452 | 3300025250 | Ga0209026_1000414 | Ga0209026_100041412 | 195 |
| 453 | 3300025250 | Ga0209026_1003387 | Ga0209026_10033873 | 195 |
| 454 | 3300025253 | Ga0209677_105076 | Ga0209677_1050762 | 195 |
| 455 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051273 | 195 |
| 456 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012442 | 195 |
| 457 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014406 | 195 |
| 458 | 3300025254 | Ga0209148_1000036 | Ga0209148_1000036358 | 195 |
| 459 | 3300025254 | Ga0209148_1000201 | Ga0209148_100020166 | 195 |
| 460 | 3300025254 | Ga0209148_1000244 | Ga0209148_100024411 | 195 |
| 461 | 3300025256 | Ga0209759_1000134 | Ga0209759_100013491 | 195 |
| 462 | 3300025256 | Ga0209759_1002336 | Ga0209759_100233610 | 195 |
| 463 | 3300025256 | Ga0209759_1002497 | Ga0209759_10024979 | 195 |
| 464 | 3300025261 | Ga0209233_1000040 | Ga0209233_1000040356 | 195 |
| 465 | 3300025261 | Ga0209233_1000063 | Ga0209233_100006358 | 195 |
| 466 | 3300025261 | Ga0209233_1000075 | Ga0209233_100007531 | 195 |
| 467 | 3300025261 | Ga0209233_1000077 | Ga0209233_100007718 | 195 |
| 468 | 3300025261 | Ga0209233_1001156 | Ga0209233_10011568 | 195 |
| 469 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008442 | 195 |
| 470 | 3300025272 | Ga0209455_1000014 | Ga0209455_1000014294 | 195 |
| 471 | 3300025272 | Ga0209455_1000018 | Ga0209455_1000018411 | 195 |
| 472 | 3300025272 | Ga0209455_1000164 | Ga0209455_100016489 | 195 |
| 473 | 3300025299 | Ga0209256_1002977 | Ga0209256_10029772 | 195 |
| 474 | 3300025321 | Ga0207656_10000662 | Ga0207656_100006624 | 195 |
| 475 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001265 | 195 |
| 476 | 3300025903 | Ga0207680_10000218 | Ga0207680_1000021813 | 195 |
| 477 | 3300025903 | Ga0207680_10004422 | Ga0207680_100044222 | 195 |
| 478 | 3300025904 | Ga0207647_10000286 | Ga0207647_100002865 | 195 |
| 479 | 3300025904 | Ga0207647_10022283 | Ga0207647_100222836 | 195 |
| 480 | 3300025904 | Ga0207647_10052007 | Ga0207647_100520074 | 195 |
| 481 | 3300025908 | Ga0207643_10020147 | Ga0207643_100201474 | 195 |
| 482 | 3300025909 | Ga0207705_10052373 | Ga0207705_100523732 | 195 |
| 483 | 3300025912 | Ga0207707_10013069 | Ga0207707_100130694 | 195 |
| 484 | 3300025912 | Ga0207707_10044862 | Ga0207707_100448624 | 195 |
| 485 | 3300025912 | Ga0207707_10072979 | Ga0207707_100729792 | 195 |
| 486 | 3300025912 | Ga0207707_10158750 | Ga0207707_101587502 | 195 |
| 487 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014297 | 195 |
| 488 | 3300025913 | Ga0207695_10007050 | Ga0207695_100070504 | 195 |
| 489 | 3300025913 | Ga0207695_10024339 | Ga0207695_100243392 | 195 |
| 490 | 3300025913 | Ga0207695_10065042 | Ga0207695_100650424 | 195 |
| 491 | 3300025914 | Ga0207671_10003776 | Ga0207671_100037764 | 195 |
| 492 | 3300025914 | Ga0207671_10016470 | Ga0207671_100164705 | 195 |
| 493 | 3300025914 | Ga0207671_10099109 | Ga0207671_100991094 | 195 |
| 494 | 3300025914 | Ga0207671_10342910 | Ga0207671_103429101 | 195 |
| 495 | 3300025915 | Ga0207693_10133123 | Ga0207693_101331232 | 195 |
| 496 | 3300025916 | Ga0207663_10086979 | Ga0207663_100869793 | 195 |
| 497 | 3300025917 | Ga0207660_10020818 | Ga0207660_100208184 | 195 |
| 498 | 3300025917 | Ga0207660_10049914 | Ga0207660_100499144 | 195 |
| 499 | 3300025919 | Ga0207657_10058102 | Ga0207657_100581022 | 195 |
| 500 | 3300025919 | Ga0207657_10078070 | Ga0207657_100780703 | 195 |
| 501 | 3300025919 | Ga0207657_10320578 | Ga0207657_103205783 | 195 |
| 502 | 3300025919 | Ga0207657_10698704 | Ga0207657_106987041 | 195 |
| 503 | 3300025920 | Ga0207649_10269666 | Ga0207649_102696662 | 195 |
| 504 | 3300025921 | Ga0207652_10041141 | Ga0207652_100411412 | 195 |
| 505 | 3300025924 | Ga0207694_10000168 | Ga0207694_1000016818 | 195 |
| 506 | 3300025924 | Ga0207694_10001142 | Ga0207694_1000114210 | 195 |
| 507 | 3300025924 | Ga0207694_10001700 | Ga0207694_100017009 | 195 |
| 508 | 3300025924 | Ga0207694_10003489 | Ga0207694_100034898 | 195 |
| 509 | 3300025924 | Ga0207694_10007373 | Ga0207694_100073737 | 195 |
| 510 | 3300025924 | Ga0207694_10040507 | Ga0207694_100405072 | 195 |
| 511 | 3300025924 | Ga0207694_10132569 | Ga0207694_101325692 | 195 |
| 512 | 3300025925 | Ga0207650_10169000 | Ga0207650_101690002 | 195 |
| 513 | 3300025926 | Ga0207659_10082244 | Ga0207659_100822443 | 195 |
| 514 | 3300025927 | Ga0207687_10561367 | Ga0207687_105613672 | 195 |
| 515 | 3300025929 | Ga0207664_10000023 | Ga0207664_1000002369 | 195 |
| 516 | 3300025929 | Ga0207664_10000200 | Ga0207664_1000020021 | 195 |
| 517 | 3300025932 | Ga0207690_10000138 | Ga0207690_100001388 | 195 |
| 518 | 3300025932 | Ga0207690_10003322 | Ga0207690_100033223 | 195 |
| 519 | 3300025932 | Ga0207690_10005588 | Ga0207690_100055889 | 195 |
| 520 | 3300025932 | Ga0207690_10009214 | Ga0207690_100092149 | 195 |
| 521 | 3300025932 | Ga0207690_10108188 | Ga0207690_101081882 | 195 |
| 522 | 3300025933 | Ga0207706_10002151 | Ga0207706_1000215115 | 195 |
| 523 | 3300025933 | Ga0207706_10047647 | Ga0207706_100476474 | 195 |
| 524 | 3300025933 | Ga0207706_10200878 | Ga0207706_102008782 | 195 |
| 525 | 3300025934 | Ga0207686_10187852 | Ga0207686_101878522 | 195 |
| 526 | 3300025934 | Ga0207686_10266529 | Ga0207686_102665291 | 195 |
| 527 | 3300025936 | Ga0207670_10000951 | Ga0207670_1000095110 | 195 |
| 528 | 3300025936 | Ga0207670_10164471 | Ga0207670_101644712 | 195 |
| 529 | 3300025937 | Ga0207669_10035252 | Ga0207669_100352522 | 195 |
| 530 | 3300025937 | Ga0207669_10486030 | Ga0207669_104860302 | 195 |
| 531 | 3300025938 | Ga0207704_10006533 | Ga0207704_100065335 | 195 |
| 532 | 3300025938 | Ga0207704_10086008 | Ga0207704_100860083 | 195 |
| 533 | 3300025938 | Ga0207704_10204616 | Ga0207704_102046164 | 195 |
| 534 | 3300025938 | Ga0207704_10238285 | Ga0207704_102382852 | 195 |
| 535 | 3300025939 | Ga0207665_10655675 | Ga0207665_106556752 | 195 |
| 536 | 3300025940 | Ga0207691_10033892 | Ga0207691_100338924 | 195 |
| 537 | 3300025940 | Ga0207691_10057932 | Ga0207691_100579322 | 195 |
| 538 | 3300025942 | Ga0207689_10021229 | Ga0207689_1002122910 | 195 |
| 539 | 3300025942 | Ga0207689_10169566 | Ga0207689_101695662 | 195 |
| 540 | 3300025949 | Ga0207667_10008241 | Ga0207667_1000824112 | 195 |
| 541 | 3300025949 | Ga0207667_10028030 | Ga0207667_100280309 | 195 |
| 542 | 3300025960 | Ga0207651_10055094 | Ga0207651_100550943 | 195 |
| 543 | 3300025961 | Ga0207712_10000745 | Ga0207712_1000074519 | 195 |
| 544 | 3300025961 | Ga0207712_10128984 | Ga0207712_101289843 | 195 |
| 545 | 3300025972 | Ga0207668_10037848 | Ga0207668_100378483 | 195 |
| 546 | 3300025972 | Ga0207668_10057888 | Ga0207668_100578884 | 195 |
| 547 | 3300025972 | Ga0207668_10266936 | Ga0207668_102669362 | 195 |
| 548 | 3300025972 | Ga0207668_10336924 | Ga0207668_103369242 | 195 |
| 549 | 3300025981 | Ga0207640_10004096 | Ga0207640_100040966 | 195 |
| 550 | 3300025986 | Ga0207658_10119922 | Ga0207658_101199222 | 195 |
| 551 | 3300025986 | Ga0207658_10186657 | Ga0207658_101866572 | 195 |
| 552 | 3300025986 | Ga0207658_10464365 | Ga0207658_104643652 | 195 |
| 553 | 3300026035 | Ga0207703_10002027 | Ga0207703_1000202715 | 195 |
| 554 | 3300026035 | Ga0207703_10597880 | Ga0207703_105978802 | 195 |
| 555 | 3300026035 | Ga0207703_10742087 | Ga0207703_107420871 | 195 |
| 556 | 3300026041 | Ga0207639_10004144 | Ga0207639_100041445 | 195 |
| 557 | 3300026041 | Ga0207639_10015812 | Ga0207639_100158127 | 195 |
| 558 | 3300026041 | Ga0207639_10148530 | Ga0207639_101485303 | 195 |
| 559 | 3300026041 | Ga0207639_10190980 | Ga0207639_101909802 | 195 |
| 560 | 3300026041 | Ga0207639_10448272 | Ga0207639_104482722 | 195 |
| 561 | 3300026067 | Ga0207678_10005813 | Ga0207678_1000581310 | 195 |
| 562 | 3300026067 | Ga0207678_10070555 | Ga0207678_100705553 | 195 |
| 563 | 3300026067 | Ga0207678_10195785 | Ga0207678_101957852 | 195 |
| 564 | 3300026067 | Ga0207678_10285600 | Ga0207678_102856002 | 195 |
| 565 | 3300026067 | Ga0207678_10800903 | Ga0207678_108009031 | 195 |
| 566 | 3300026078 | Ga0207702_10001815 | Ga0207702_100018155 | 195 |
| 567 | 3300026088 | Ga0207641_10235681 | Ga0207641_102356812 | 195 |
| 568 | 3300026088 | Ga0207641_10596934 | Ga0207641_105969341 | 195 |
| 569 | 3300026088 | Ga0207641_10733722 | Ga0207641_107337222 | 195 |
| 570 | 3300026089 | Ga0207648_10009668 | Ga0207648_100096681 | 195 |
| 571 | 3300026089 | Ga0207648_10605728 | Ga0207648_106057282 | 195 |
| 572 | 3300026095 | Ga0207676_11244773 | Ga0207676_112447732 | 195 |
| 573 | 3300026116 | Ga0207674_10030465 | Ga0207674_100304657 | 195 |
| 574 | 3300026116 | Ga0207674_10231844 | Ga0207674_102318443 | 195 |
| 575 | 3300026116 | Ga0207674_10285092 | Ga0207674_102850923 | 195 |
| 576 | 3300026118 | Ga0207675_100514386 | Ga0207675_1005143861 | 195 |
| 577 | 3300026121 | Ga0207683_10004646 | Ga0207683_100046469 | 195 |
| 578 | 3300026121 | Ga0207683_10008124 | Ga0207683_100081248 | 195 |
| 579 | 3300026121 | Ga0207683_10010121 | Ga0207683_100101213 | 195 |
| 580 | 3300026121 | Ga0207683_10680241 | Ga0207683_106802412 | 195 |
| 581 | 3300028379 | Ga0268266_10000013 | Ga0268266_1000001391 | 195 |
| 582 | 3300028379 | Ga0268266_10000075 | Ga0268266_100000758 | 195 |
| 583 | 3300028380 | Ga0268265_10297999 | Ga0268265_102979992 | 195 |
| 584 | 3300028381 | Ga0268264_10079476 | Ga0268264_100794765 | 195 |
| 585 | 3300028786 | Ga0307517_10154980 | Ga0307517_101549802 | 195 |
| 586 | 3300033180 | Ga0307510_10002367 | Ga0307510_1000236714 | 195 |
| 587 | 3300033180 | Ga0307510_10043003 | Ga0307510_100430035 | 195 |
| 588 | 3300037312 | Ga0395899_0000089 | Ga0395899_0000089_122099_122686 | 195 |
| 589 | 3300037312 | Ga0395899_0012531 | Ga0395899_0012531_2344_2931 | 195 |
| 590 | 3300037312 | Ga0395899_0147439 | Ga0395899_0147439_979_1566 | 195 |
| 591 | 3300037312 | Ga0395899_0177970 | Ga0395899_0177970_753_1373 | 195 |
| 592 | 3300037312 | Ga0395899_0236952 | Ga0395899_0236952_19_606 | 195 |
| 593 | 3300037312 | Ga0395899_0274215 | Ga0395899_0274215_178_798 | 195 |
| 594 | 3300037418 | Ga0395900_0000029 | Ga0395900_0000029_205196_205783 | 195 |
| 595 | 3300037418 | Ga0395900_0000651 | Ga0395900_0000651_19965_20552 | 195 |
| 596 | 3300037418 | Ga0395900_0007702 | Ga0395900_0007702_3398_4018 | 195 |
| 597 | 3300037418 | Ga0395900_0076239 | Ga0395900_0076239_2017_2604 | 195 |
| 598 | 3300037418 | Ga0395900_0092578 | Ga0395900_0092578_1758_2345 | 195 |
| 599 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_88691_89278 | 195 |
| 600 | 3300037466 | Ga0395898_0000241 | Ga0395898_0000241_110592_111179 | 195 |
| 601 | 3300037466 | Ga0395898_0004579 | Ga0395898_0004579_13898_14485 | 195 |
| 602 | 3300037466 | Ga0395898_0029429 | Ga0395898_0029429_4143_4763 | 195 |
| 603 | 3300037466 | Ga0395898_0042982 | Ga0395898_0042982_3610_4197 | 195 |
| 604 | 3300037466 | Ga0395898_0111996 | Ga0395898_0111996_778_1398 | 195 |
| 605 | 3300038443 | Ga0395901_0000873 | Ga0395901_0000873_14243_14830 | 195 |
| 606 | 3300038443 | Ga0395901_0003835 | Ga0395901_0003835_9250_9837 | 195 |
| 607 | 3300038443 | Ga0395901_0021565 | Ga0395901_0021565_4384_5004 | 195 |
| 608 | 3300038443 | Ga0395901_0062534 | Ga0395901_0062534_2017_2604 | 195 |
| 609 | 3300038443 | Ga0395901_0273491 | Ga0395901_0273491_189_809 | 195 |
| 610 | 3300038443 | Ga0395901_0470476 | Ga0395901_0470476_526_1113 | 195 |
| 611 | 3300041486 | Ga0451807_2321265 | Ga0451807_2321265_578_1168 | 195 |
| 612 | 3300042438 | Ga0439459_0007326 | Ga0439459_0007326_248_835 | 195 |
| 613 | 3300044656 | Ga0466969_0006829 | Ga0466969_0006829_3172_3759 | 195 |
| 614 | 3300044658 | Ga0466972_0001275 | Ga0466972_0001275_10925_11548 | 195 |
| 615 | 3300044683 | Ga0466965_0044614 | Ga0466965_0044614_943_1530 | 195 |
| 616 | 3300044684 | Ga0466966_0045989 | Ga0466966_0045989_1179_1766 | 195 |
| 617 | 3300044693 | Ga0466961_0000345 | Ga0466961_0000345_4786_5373 | 195 |
| 618 | 3300044693 | Ga0466961_0004106 | Ga0466961_0004106_4681_5268 | 195 |
| 619 | 3300044693 | Ga0466961_0005564 | Ga0466961_0005564_4738_5325 | 195 |
| 620 | 3300044693 | Ga0466961_0012072 | Ga0466961_0012072_140_727 | 195 |
| 621 | 3300044693 | Ga0466961_0320382 | Ga0466961_0320382_79_666 | 195 |
| 622 | 3300044694 | Ga0466963_0202335 | Ga0466963_0202335_530_1117 | 195 |
| 623 | 3300044719 | Ga0466971_0012327 | Ga0466971_0012327_2899_3486 | 195 |
| 624 | 3300044719 | Ga0466971_0060637 | Ga0466971_0060637_22_609 | 195 |
| 625 | 3300044765 | Ga0466970_0008454 | Ga0466970_0008454_504_1127 | 195 |
| 626 | 3300044765 | Ga0466970_0014316 | Ga0466970_0014316_3343_3930 | 195 |
| 627 | 3300044765 | Ga0466970_0099205 | Ga0466970_0099205_860_1447 | 195 |
| 628 | 3300044842 | Ga0466957_0017384 | Ga0466957_0017384_276_863 | 195 |
| 629 | 3300044842 | Ga0466957_0090235 | Ga0466957_0090235_865_1452 | 195 |
| 630 | 3300044842 | Ga0466957_0271070 | Ga0466957_0271070_274_894 | 195 |
| 631 | 3300045049 | Ga0466959_0000148 | Ga0466959_0000148_38923_39510 | 195 |
| 632 | 3300045049 | Ga0466959_0002116 | Ga0466959_0002116_10204_10791 | 195 |
| 633 | 3300045049 | Ga0466959_0028465 | Ga0466959_0028465_2509_3096 | 195 |
| 634 | 3300045049 | Ga0466959_0109786 | Ga0466959_0109786_527_1114 | 195 |
| 635 | 3300045049 | Ga0466959_0128582 | Ga0466959_0128582_365_985 | 195 |
| 636 | 3300045049 | Ga0466959_0130936 | Ga0466959_0130936_183_770 | 195 |
| 637 | 3300045836 | Ga0466958_0006082 | Ga0466958_0006082_3720_4307 | 195 |
| 638 | 3300045836 | Ga0466958_0008710 | Ga0466958_0008710_2429_3016 | 195 |
| 639 | 3300045836 | Ga0466958_0079594 | Ga0466958_0079594_80_667 | 195 |
| 640 | 3300045836 | Ga0466958_0215517 | Ga0466958_0215517_297_884 | 195 |
| 641 | 3300045836 | Ga0466958_0409055 | Ga0466958_0409055_59_646 | 195 |
| 642 | 3300045976 | Ga0466967_0104957 | Ga0466967_0104957_1698_2285 | 195 |
| 643 | 3300046460 | Ga0495638_0001233 | Ga0495638_0001233_14974_15561 | 195 |
| 644 | 3300046471 | Ga0495650_0000350 | Ga0495650_0000350_4234_4821 | 195 |
| 645 | 3300046507 | Ga0495606_0000016 | Ga0495606_0000016_169122_169709 | 195 |
| 646 | 3300046694 | Ga0495649_0000228 | Ga0495649_0000228_44591_45178 | 195 |
| 647 | 3300048904 | Ga0496101_0973981 | Ga0496101_0973981_44_631 | 195 |
| 648 | 3300048907 | Ga0496104_0000041 | Ga0496104_0000041_38458_39057 | 195 |
| 649 | 3300048908 | Ga0496105_0000022 | Ga0496105_0000022_38318_38917 | 195 |
| 650 | 3300048908 | Ga0496105_0177054 | Ga0496105_0177054_898_1485 | 195 |
| 651 | 3300048916 | Ga0496113_0022532 | Ga0496113_0022532_3397_3984 | 195 |
| 652 | 3300048917 | Ga0496114_0084714 | Ga0496114_0084714_1315_1902 | 195 |
| 653 | 3300048918 | Ga0496115_0000114 | Ga0496115_0000114_41223_41810 | 195 |
| 654 | 3300048918 | Ga0496115_0002199 | Ga0496115_0002199_5880_6467 | 195 |
| 655 | 3300048918 | Ga0496115_0015302 | Ga0496115_0015302_1608_2195 | 195 |
| 656 | 3300048921 | Ga0496118_0000264 | Ga0496118_0000264_63799_64419 | 195 |
| 657 | 3300048924 | Ga0496121_0039863 | Ga0496121_0039863_2023_2610 | 195 |
| 658 | 3300048924 | Ga0496121_0122684 | Ga0496121_0122684_478_1065 | 195 |
| 659 | 3300048928 | Ga0496125_0000604 | Ga0496125_0000604_49843_50463 | 195 |
| 660 | 3300048928 | Ga0496125_0083196 | Ga0496125_0083196_1035_1622 | 195 |
| 661 | 3300048929 | Ga0496126_0005938 | Ga0496126_0005938_6677_7264 | 195 |
| 662 | 3300048929 | Ga0496126_0015681 | Ga0496126_0015681_1722_2309 | 195 |
| 663 | 3300048929 | Ga0496126_0024412 | Ga0496126_0024412_1369_1956 | 195 |
| 664 | 3300049459 | Ga0495678_038190 | Ga0495678_038190_528_1115 | 195 |
| 665 | 3300049459 | Ga0495678_165713 | Ga0495678_165713_94_681 | 195 |
| 666 | 3300049568 | Ga0501031_0125479 | Ga0501031_0125479_149_736 | 195 |
| 667 | 3300049569 | Ga0501032_0051863 | Ga0501032_0051863_653_1273 | 195 |
| 668 | 3300049569 | Ga0501032_0077225 | Ga0501032_0077225_279_866 | 195 |
| 669 | 3300049570 | Ga0501033_0011789 | Ga0501033_0011789_1993_2580 | 195 |
| 670 | 3300049570 | Ga0501033_0264150 | Ga0501033_0264150_438_1025 | 195 |
| 671 | 3300049571 | Ga0501034_0007995 | Ga0501034_0007995_10537_11154 | 195 |
| 672 | 3300049571 | Ga0501034_0010146 | Ga0501034_0010146_82_669 | 195 |
| 673 | 3300049571 | Ga0501034_0255425 | Ga0501034_0255425_581_1168 | 195 |
| 674 | 3300049572 | Ga0501036_0019161 | Ga0501036_0019161_1815_2402 | 195 |
| 675 | 3300049572 | Ga0501036_0079512 | Ga0501036_0079512_1086_1706 | 195 |
| 676 | 3300049572 | Ga0501036_0093793 | Ga0501036_0093793_1385_1972 | 195 |
| 677 | 3300049572 | Ga0501036_0528735 | Ga0501036_0528735_203_820 | 195 |
| 678 | 3300049573 | Ga0501037_0008152 | Ga0501037_0008152_4124_4741 | 195 |
| 679 | 3300049573 | Ga0501037_0009429 | Ga0501037_0009429_5891_6478 | 195 |
| 680 | 3300049573 | Ga0501037_0132063 | Ga0501037_0132063_455_1042 | 195 |
| 681 | 3300049573 | Ga0501037_0401833 | Ga0501037_0401833_56_643 | 195 |
| 682 | 3300049573 | Ga0501037_0448278 | Ga0501037_0448278_34_621 | 195 |
| 683 | 3300049573 | Ga0501037_0538030 | Ga0501037_0538030_102_689 | 195 |
| 684 | 3300049574 | Ga0501038_0000645 | Ga0501038_0000645_2597_3214 | 195 |
| 685 | 3300049574 | Ga0501038_0140085 | Ga0501038_0140085_714_1301 | 195 |
| 686 | 3300049574 | Ga0501038_0342571 | Ga0501038_0342571_538_1125 | 195 |
| 687 | 3300049574 | Ga0501038_0401927 | Ga0501038_0401927_245_832 | 195 |
| 688 | 3300049575 | Ga0501039_0077980 | Ga0501039_0077980_1041_1628 | 195 |
| 689 | 3300049575 | Ga0501039_0156809 | Ga0501039_0156809_231_818 | 195 |
| 690 | 3300049575 | Ga0501039_0175257 | Ga0501039_0175257_747_1364 | 195 |
| 691 | 3300049578 | Ga0501042_0127555 | Ga0501042_0127555_1032_1619 | 195 |
| 692 | 3300049579 | Ga0501043_0016067 | Ga0501043_0016067_4506_5123 | 195 |
| 693 | 3300049579 | Ga0501043_0045728 | Ga0501043_0045728_204_791 | 195 |
| 694 | 3300049579 | Ga0501043_0091025 | Ga0501043_0091025_1705_2292 | 195 |
| 695 | 3300049579 | Ga0501043_0158767 | Ga0501043_0158767_1012_1599 | 195 |
| 696 | 3300049579 | Ga0501043_0176790 | Ga0501043_0176790_486_1073 | 195 |
| 697 | 3300049580 | Ga0501046_0011217 | Ga0501046_0011217_494_1081 | 195 |
| 698 | 3300049580 | Ga0501046_0046919 | Ga0501046_0046919_2602_3219 | 195 |
| 699 | 3300049580 | Ga0501046_0143055 | Ga0501046_0143055_529_1116 | 195 |
| 700 | 3300049580 | Ga0501046_0397947 | Ga0501046_0397947_12_695 | 195 |
| 701 | 3300049581 | Ga0501047_0041830 | Ga0501047_0041830_3679_4362 | 195 |
| 702 | 3300049581 | Ga0501047_0074836 | Ga0501047_0074836_510_1193 | 195 |
| 703 | 3300049581 | Ga0501047_0163581 | Ga0501047_0163581_39_659 | 195 |
| 704 | 3300049581 | Ga0501047_0195408 | Ga0501047_0195408_231_818 | 195 |
| 705 | 3300049581 | Ga0501047_0227329 | Ga0501047_0227329_686_1303 | 195 |
| 706 | 3300049581 | Ga0501047_0541774 | Ga0501047_0541774_231_818 | 195 |
| 707 | 3300049582 | Ga0501048_0045725 | Ga0501048_0045725_2079_2666 | 195 |
| 708 | 3300049582 | Ga0501048_0070554 | Ga0501048_0070554_907_1494 | 195 |
| 709 | 3300049582 | Ga0501048_0710439 | Ga0501048_0710439_125_712 | 195 |
| 710 | 3300049584 | Ga0501068_0044775 | Ga0501068_0044775_65_682 | 195 |
| 711 | 3300049586 | Ga0501070_0052824 | Ga0501070_0052824_1026_1613 | 195 |
| 712 | 3300049586 | Ga0501070_0122601 | Ga0501070_0122601_158_775 | 195 |
| 713 | 3300049587 | Ga0501071_0304687 | Ga0501071_0304687_372_989 | 195 |
| 714 | 3300049589 | Ga0501073_0041674 | Ga0501073_0041674_1102_1689 | 195 |
| 715 | 3300049589 | Ga0501073_0083883 | Ga0501073_0083883_453_1070 | 195 |
| 716 | 3300049589 | Ga0501073_0084864 | Ga0501073_0084864_211_828 | 195 |
| 717 | 3300049590 | Ga0501074_0313423 | Ga0501074_0313423_405_992 | 195 |
| 718 | 3300049741 | Ga0501079_0415993 | Ga0501079_0415993_91_678 | 195 |
| 719 | 3300049742 | Ga0501080_0026675 | Ga0501080_0026675_2062_2679 | 195 |
| 720 | 3300049742 | Ga0501080_0060795 | Ga0501080_0060795_1497_2117 | 195 |
| 721 | 3300049742 | Ga0501080_0233258 | Ga0501080_0233258_472_1059 | 195 |
| 722 | 3300049822 | Ga0501035_0035859 | Ga0501035_0035859_2057_2644 | 195 |
| 723 | 3300049822 | Ga0501035_0047260 | Ga0501035_0047260_1587_2204 | 195 |
| 724 | 3300049822 | Ga0501035_0048891 | Ga0501035_0048891_3116_3703 | 195 |
| 725 | 3300049822 | Ga0501035_0052939 | Ga0501035_0052939_1956_2543 | 195 |
| 726 | 3300049822 | Ga0501035_0111969 | Ga0501035_0111969_688_1275 | 195 |
| 727 | 3300049822 | Ga0501035_0167333 | Ga0501035_0167333_34_621 | 195 |
| 728 | 3300049822 | Ga0501035_0191640 | Ga0501035_0191640_488_1105 | 195 |
| 729 | 3300049822 | Ga0501035_0226084 | Ga0501035_0226084_324_911 | 195 |
| 730 | 3300049822 | Ga0501035_0439685 | Ga0501035_0439685_413_1000 | 195 |
| 731 | 3300049822 | Ga0501035_0652078 | Ga0501035_0652078_111_698 | 195 |
| 732 | 3300049823 | Ga0501044_0022729 | Ga0501044_0022729_5427_6014 | 195 |
| 733 | 3300049823 | Ga0501044_0030494 | Ga0501044_0030494_4022_4639 | 195 |
| 734 | 3300049823 | Ga0501044_0093702 | Ga0501044_0093702_367_954 | 195 |
| 735 | 3300049823 | Ga0501044_0221312 | Ga0501044_0221312_1047_1634 | 195 |
| 736 | 3300049823 | Ga0501044_0284672 | Ga0501044_0284672_39_626 | 195 |
| 737 | 3300049823 | Ga0501044_0367726 | Ga0501044_0367726_467_1087 | 195 |
| 738 | 3300049823 | Ga0501044_0637572 | Ga0501044_0637572_200_787 | 195 |
| 739 | 3300053090 | Ga0500646_0007243 | Ga0500646_0007243_1032_1619 | 195 |
| 740 | 3300053120 | Ga0500597_161391 | Ga0500597_161391_97_720 | 195 |
| 741 | 3300060353 | Ga0501082_0110921 | Ga0501082_0110921_1494_2111 | 195 |
| 742 | 3300061719 | Ga0466962_0030288 | Ga0466962_0030288_1311_1898 | 195 |
| 743 | iso_pu_bacteria | 2643221562 | 2643829401 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hmx-assembly1.cif.gz_A | crystal structure of phzg from burkholderia lata 383 in complex with tetrahydrophenazine-1-carboxylic acid | 0.9432 | 7 | 195 |
| 1t9m-assembly1.cif.gz_B | x-ray crystal structure of phzg from pseudomonas aeruginosa | 0.9359 | 7 | 195 |
| 4hmt-assembly1.cif.gz_B | crystal structure of phzg from pseudomonas fluorescens 2-79 in complex with hexahydrophenazine-1,6-dicarboxylic acid | 0.9304 | 7 | 195 |
| 1nrg-assembly1.cif.gz_A-2 | structure and properties of recombinant human pyridoxine-5'-phosphate oxidase | 0.9286 | 8 | 195 |
| 1jnw-assembly1.cif.gz_A-2 | active site structure of e. coli pyridoxine 5'-phosphate oxidase | 0.9204 | 2 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hmxA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9432 | 7 | 195 | 2.30.110.10 |
| af_Q9LTX3_323_519_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9394 | 2 | 184 | 2.30.110.10 |
| 1g78A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9392 | 2 | 195 | 2.30.110.10 |
| 4hmtB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9304 | 7 | 195 | 2.30.110.10 |
| af_A0A1R3LXN8_584_738_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9209 | 2 | 145 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H2X535-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9809 | 5 | 116 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A7K2MJX4-F1-model_v4 | Oxidase | 0.9714 | 7 | 102 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A7Z9IK15-F1-model_v4 | Pyridoxal 5'-phosphate synthase (EC 1.4.3.5) | 0.9699 | 8 | 118 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-T0ZGX9-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.967 | 1 | 171 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A0N5A5Q2-F1-model_v4 | pyridoxal 5'-phosphate synthase (EC 1.4.3.5) | 0.9669 | 4 | 98 |
GO:0004733
GO:0008615 GO:0010181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar