F478708

General Info

Members Datasets Scaffolds Average Seq Length
743 314 735 198

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0397947|Ga0501046_0397947_12_695
Length 227
Sequence VVEQMAGEGDVLRASIVGHPRMMARRRHDARVMLKREILDTFLGLLDEATTGGDPEPTAMNLATADAAGRVSSRIVLLKGADERGFRFYTNYESDKGVQLDAHPQVALNFHWKQLRQGVQVRVEGVARKLLAEESDAYFATRARGSQIGAWASLQSQTLPDRHSFDERVARYEREFEGHEVPRPPHWGGYLVEPDMVEFWYGAEFRLHERMRWSRHGQTWTRRLLYP

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2884411467 Dyella sp. AD56 Isolate Rhizosphere
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2919404418 Luteibacter sp. 3190 Isolate Unclassified
8 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
122 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
123 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
124 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.04
Nodule 0
Rhizoplane 1.62
Rhizosphere 82.1
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10017015 3300001990 Bacteria 2344
2 JGI24735J21928_10008326 3300002067 Bacteria 3358
3 JGI25156J39149_1005881 3300002705 Bacteria 3452
4 JGI25156J39149_1012856 3300002705 Bacteria 1814
5 JGI25162J39368_1000235 3300002737 Bacteria 55413
6 JGI25162J39368_1001269 3300002737 Bacteria 14390
7 JGI25162J39368_1002195 3300002737 Bacteria 8055
8 JGI25162J39368_1008750 3300002737 Bacteria 1420
9 JGI25157J39369_1000415 3300002741 Bacteria 28682
10 JGI25157J39369_1001439 3300002741 Bacteria 8958
11 JGI25157J39369_1001600 3300002741 Bacteria 7927
12 JGI25163J39215_1000768 3300002771 Bacteria 7895
13 JGI25164J39214_1000139 3300002772 Bacteria 70270
14 JGI25164J39214_1001075 3300002772 Bacteria 8060
15 JGI25164J39214_1001475 3300002772 Bacteria 5372
16 JGI25164J39214_1001631 3300002772 Bacteria 4690
17 JGI25165J46597_1000316 3300003214 Bacteria 58235
18 JGI25165J46597_1001043 3300003214 Bacteria 18071
19 JGI25165J46597_1001299 3300003214 Bacteria 14390
20 JGI25165J46597_1002371 3300003214 Bacteria 6284
21 rootH1_10041414 3300003316 Bacteria 1708
22 rootH1_10068308 3300003316 Bacteria 1068
23 Ga0055538_1002162 3300003751 Bacteria 3066
24 Ga0055539_1001607 3300003752 Bacteria 4070
25 Ga0055533_1003938 3300003756 Bacteria 2814
26 Ga0055525_1000178 3300003759 Bacteria 79260
27 Ga0055527_1000090 3300003760 Bacteria 71093
28 Ga0055527_1000100 3300003760 Bacteria 63720
29 Ga0055535_1000201 3300003761 Bacteria 63716
30 Ga0055535_1000456 3300003761 Bacteria 37749
31 Ga0055535_1000742 3300003761 Bacteria 24432
32 Ga0055535_1001175 3300003761 Bacteria 15158
33 Ga0055535_1001446 3300003761 Bacteria 12051
34 Ga0055535_1022041 3300003761 Bacteria 765
35 Ga0055542_1000187 3300003762 Bacteria 76099
36 Ga0055542_1000191 3300003762 Bacteria 74866
37 Ga0055542_1000212 3300003762 Bacteria 71081
38 Ga0055542_1000236 3300003762 Bacteria 63720
39 Ga0055542_1000287 3300003762 Bacteria 56451
40 Ga0055542_1001002 3300003762 Bacteria 18071
41 Ga0055529_1000256 3300003763 Bacteria 63720
42 Ga0055529_1000259 3300003763 Bacteria 63245
43 Ga0055529_1000386 3300003763 Bacteria 47713
44 Ga0055529_1001324 3300003763 Bacteria 8330
45 Ga0065712_10160772 3300005290 Bacteria 1304
46 Ga0070658_10001497 3300005327 Bacteria 19822
47 Ga0070676_10046880 3300005328 Bacteria 2522
48 Ga0070683_100033550 3300005329 Bacteria 4682
49 Ga0070683_100171784 3300005329 Bacteria 2057
50 Ga0070683_100987400 3300005329 Bacteria 808
51 Ga0070690_100043209 3300005330 Bacteria 2857
52 Ga0070670_100035414 3300005331 Bacteria 4298
53 Ga0068869_100009671 3300005334 Bacteria 6261
54 Ga0068869_100035408 3300005334 Bacteria 3537
55 Ga0068869_100168927 3300005334 Bacteria 1707
56 Ga0068869_100266181 3300005334 Bacteria 1374
57 Ga0070666_10000013 3300005335 Bacteria 230442
58 Ga0070666_10002943 3300005335 Bacteria 10306
59 Ga0070666_10339682 3300005335 Bacteria 1073
60 Ga0070680_100008193 3300005336 Bacteria 7987
61 Ga0070680_100776488 3300005336 Bacteria 825
62 Ga0070682_100003692 3300005337 Bacteria 8503
63 Ga0070682_100021180 3300005337 Bacteria 3832
64 Ga0070682_100063155 3300005337 Bacteria 2347
65 Ga0070682_100260995 3300005337 Bacteria 1254
66 Ga0070682_100326442 3300005337 Bacteria 1135
67 Ga0070682_100792045 3300005337 Unclassified 769
68 Ga0068868_100057784 3300005338 Bacteria 3065
69 Ga0068868_100603892 3300005338 Bacteria 972
70 Ga0070660_100112135 3300005339 Bacteria 2171
71 Ga0070660_100112186 3300005339 Bacteria 2170
72 Ga0070660_100492422 3300005339 Bacteria 1019
73 Ga0070689_100002814 3300005340 Bacteria 11436
74 Ga0070689_100080965 3300005340 Bacteria 2549
75 Ga0070689_100462536 3300005340 Bacteria 1081
76 Ga0070661_100020646 3300005344 Bacteria 4698
77 Ga0070661_100040860 3300005344 Bacteria 3384
78 Ga0070661_100087838 3300005344 Bacteria 2300
79 Ga0070661_100177642 3300005344 Bacteria 1619
80 Ga0070692_10006299 3300005345 Bacteria 5145
81 Ga0070692_10113658 3300005345 Bacteria 1501
82 Ga0070668_100007465 3300005347 Bacteria 8113
83 Ga0070668_100058262 3300005347 Bacteria 2988
84 Ga0070668_100121140 3300005347 Bacteria 2091
85 Ga0070669_100037305 3300005353 Bacteria 3526
86 Ga0070669_100082972 3300005353 Bacteria 2390
87 Ga0070669_100290315 3300005353 Bacteria 1313
88 Ga0070675_100025653 3300005354 Bacteria 4725
89 Ga0070675_100075845 3300005354 Bacteria 2795
90 Ga0070675_100272724 3300005354 Bacteria 1485
91 Ga0070675_100761488 3300005354 Bacteria 884
92 Ga0070674_100357015 3300005356 Bacteria 1182
93 Ga0070673_100030499 3300005364 Bacteria 4036
94 Ga0070673_100350608 3300005364 Bacteria 1310
95 Ga0070659_100003021 3300005366 Bacteria 11974
96 Ga0070659_100020532 3300005366 Bacteria 5020
97 Ga0070659_100047533 3300005366 Bacteria 3366
98 Ga0070659_100082497 3300005366 Bacteria 2568
99 Ga0070659_100904469 3300005366 Bacteria 771
100 Ga0070667_100014067 3300005367 Bacteria 6612
101 Ga0070667_100088087 3300005367 Bacteria 2665
102 Ga0070667_100166732 3300005367 Bacteria 1943
103 Ga0070709_10302788 3300005434 Bacteria 1168
104 Ga0070714_100000020 3300005435 Bacteria 169262
105 Ga0070714_100003774 3300005435 Bacteria 11366
106 Ga0070714_100062369 3300005435 Bacteria 3204
107 Ga0070710_10045776 3300005437 Bacteria 2434
108 Ga0070711_100135662 3300005439 Bacteria 1839
109 Ga0070694_100095027 3300005444 Bacteria 2098
110 Ga0070694_100099595 3300005444 Bacteria 2054
111 Ga0070694_100193912 3300005444 Bacteria 1510
112 Ga0070708_100000007 3300005445 Bacteria 146443
113 Ga0070663_100006682 3300005455 Bacteria 6955
114 Ga0070663_100241911 3300005455 Bacteria 1425
115 Ga0070663_100267237 3300005455 Bacteria 1359
116 Ga0070678_100013499 3300005456 Bacteria 5125
117 Ga0070678_100103379 3300005456 Bacteria 2213
118 Ga0070662_100002975 3300005457 Bacteria 10530
119 Ga0070662_100030126 3300005457 Bacteria 3793
120 Ga0070662_100051910 3300005457 Bacteria 2962
121 Ga0070681_10010860 3300005458 Bacteria 9001
122 Ga0070681_10026364 3300005458 Bacteria 5843
123 Ga0070681_10027397 3300005458 Bacteria 5730
124 Ga0070681_10037699 3300005458 Bacteria 4849
125 Ga0070681_10130039 3300005458 Bacteria 2450
126 Ga0070685_10000607 3300005466 Bacteria 19772
127 Ga0070707_100039332 3300005468 Bacteria 4519
128 Ga0070707_100096329 3300005468 Bacteria 2866
129 Ga0070698_100120714 3300005471 Bacteria 2582
130 Ga0070698_100262638 3300005471 Bacteria 1659
131 Ga0070679_100033490 3300005530 Bacteria 5088
132 Ga0070679_100153576 3300005530 Bacteria 2278
133 Ga0070679_100259181 3300005530 Bacteria 1694
134 Ga0070679_100777117 3300005530 Unclassified 901
135 Ga0070684_100532919 3300005535 Bacteria 1089
136 Ga0070697_100051466 3300005536 Bacteria 3346
137 Ga0068853_100006495 3300005539 Bacteria 9302
138 Ga0068853_100176295 3300005539 Bacteria 1936
139 Ga0068853_100225597 3300005539 Bacteria 1712
140 Ga0068853_100281949 3300005539 Bacteria 1532
141 Ga0068853_100752294 3300005539 Bacteria 931
142 Ga0070672_100011137 3300005543 Bacteria 6263
143 Ga0070672_100027164 3300005543 Bacteria 4267
144 Ga0070695_100020249 3300005545 Bacteria 4060
145 Ga0070696_100001686 3300005546 Bacteria 14471
146 Ga0070696_100004173 3300005546 Bacteria 9627
147 Ga0070693_100004068 3300005547 Bacteria 6885
148 Ga0070693_100009737 3300005547 Bacteria 4788
149 Ga0070693_100030353 3300005547 Bacteria 2955
150 Ga0070693_100189000 3300005547 Bacteria 1331
151 Ga0070693_100211150 3300005547 Bacteria 1266
152 Ga0070693_100410837 3300005547 Bacteria 941
153 Ga0070665_100000333 3300005548 Bacteria 72698
154 Ga0070665_100000618 3300005548 Bacteria 48757
155 Ga0070665_100032263 3300005548 Bacteria 5273
156 Ga0070665_100136571 3300005548 Bacteria 2455
157 Ga0068855_100054444 3300005563 Bacteria 4702
158 Ga0068855_100073447 3300005563 Bacteria 3974
159 Ga0068855_100080267 3300005563 Bacteria 3783
160 Ga0068855_100399273 3300005563 Bacteria 1507
161 Ga0070664_100108449 3300005564 Bacteria 2421
162 Ga0068857_100030513 3300005577 Bacteria 4760
163 Ga0068857_100147750 3300005577 Bacteria 2127
164 Ga0068857_100251681 3300005577 Bacteria 1620
165 Ga0068857_100656346 3300005577 Bacteria 994
166 Ga0068854_100054124 3300005578 Bacteria 2885
167 Ga0068856_100042321 3300005614 Bacteria 4480
168 Ga0068856_100046743 3300005614 Bacteria 4263
169 Ga0068856_100118837 3300005614 Bacteria 2644
170 Ga0068856_100420258 3300005614 Bacteria 1357
171 Ga0070702_100016179 3300005615 Bacteria 3823
172 Ga0068852_100554688 3300005616 Bacteria 1150
173 Ga0068859_100037834 3300005617 Bacteria 4842
174 Ga0068859_100058706 3300005617 Bacteria 3875
175 Ga0068859_100233305 3300005617 Bacteria 1929
176 Ga0068864_100066775 3300005618 Bacteria 3122
177 Ga0068864_101325375 3300005618 Bacteria 720
178 Ga0068851_10000591 3300005834 Bacteria 15744
179 Ga0068870_10029604 3300005840 Bacteria 2760
180 Ga0068870_10247110 3300005840 Bacteria 1104
181 Ga0068863_100015928 3300005841 Bacteria 7211
182 Ga0068863_100061756 3300005841 Bacteria 3543
183 Ga0068863_100475107 3300005841 Bacteria 1229
184 Ga0068858_100002640 3300005842 Bacteria 18054
185 Ga0068860_100048917 3300005843 Bacteria 4029
186 Ga0068860_100105639 3300005843 Bacteria 2689
187 Ga0068860_100219453 3300005843 Bacteria 1846
188 Ga0068862_100023433 3300005844 Bacteria 5173
189 Ga0068862_100086124 3300005844 Bacteria 2731
190 Ga0081540_1001157 3300005983 Bacteria 23238
191 Ga0070712_100226029 3300006175 Bacteria 1484
192 Ga0070712_100669544 3300006175 Bacteria 883
193 Ga0097621_100021820 3300006237 Bacteria 4962
194 Ga0097621_100046457 3300006237 Bacteria 3513
195 Ga0097621_100064745 3300006237 Bacteria 3007
196 Ga0097621_100553744 3300006237 Bacteria 1047
197 Ga0068871_100025613 3300006358 Bacteria 4592
198 Ga0068871_100810254 3300006358 Bacteria 864
199 Ga0075434_100628080 3300006871 Bacteria 1093
200 Ga0068865_100158311 3300006881 Bacteria 1725
201 Ga0068865_100184551 3300006881 Bacteria 1609
202 Ga0068865_100220363 3300006881 Bacteria 1483
203 Ga0097620_100037832 3300006931 Bacteria 4842
204 Ga0097620_100058701 3300006931 Bacteria 3875
205 Ga0097620_100233306 3300006931 Bacteria 1929
206 Ga0099794_10000575 3300007265 Bacteria 12305
207 Ga0105240_10013854 3300009093 Bacteria 11041
208 Ga0105240_10103634 3300009093 Bacteria 3456
209 Ga0105240_10173549 3300009093 Bacteria 2551
210 Ga0105240_10388762 3300009093 Bacteria 1574
211 Ga0105245_10355162 3300009098 Bacteria 1453
212 Ga0105245_11081389 3300009098 Bacteria 848
213 Ga0105243_10369795 3300009148 Bacteria 1322
214 Ga0105241_10045483 3300009174 Bacteria 3331
215 Ga0105241_10098624 3300009174 Bacteria 2318
216 Ga0105241_10463809 3300009174 Bacteria 1123
217 Ga0105242_10128828 3300009176 Bacteria 2181
218 Ga0105242_10196201 3300009176 Bacteria 1790
219 Ga0105248_10085167 3300009177 Bacteria 3557
220 Ga0105248_10148079 3300009177 Bacteria 2649
221 Ga0105248_10506360 3300009177 Bacteria 1361
222 Ga0105248_10965684 3300009177 Unclassified 962
223 Ga0105248_11199044 3300009177 Bacteria 858
224 Ga0105237_10025886 3300009545 Bacteria 5997
225 Ga0105237_10035711 3300009545 Bacteria 5029
226 Ga0105237_10074364 3300009545 Bacteria 3390
227 Ga0105238_10000131 3300009551 Bacteria 82050
228 Ga0105238_10005675 3300009551 Bacteria 12338
229 Ga0105238_10011550 3300009551 Bacteria 8898
230 Ga0105238_10019359 3300009551 Bacteria 6932
231 Ga0105238_10031956 3300009551 Bacteria 5356
232 Ga0105238_10068568 3300009551 Bacteria 3548
233 Ga0105238_10612615 3300009551 Bacteria 1097
234 Ga0105238_10626982 3300009551 Bacteria 1084
235 Ga0105249_10069077 3300009553 Bacteria 3260
236 Ga0105239_10012447 3300010375 Bacteria 9476
237 Ga0105239_10061214 3300010375 Bacteria 4131
238 Ga0105239_10134230 3300010375 Bacteria 2755
239 Ga0105239_10259430 3300010375 Bacteria 1953
240 Ga0105239_10851499 3300010375 Bacteria 1046
241 Ga0105246_10021173 3300011119 Bacteria 4180
242 Ga0105246_10296663 3300011119 Bacteria 1303
243 Ga0157347_1004129 3300012502 Bacteria 1335
244 Ga0157373_10010449 3300013100 Bacteria 6829
245 Ga0157373_10167985 3300013100 Bacteria 1544
246 Ga0157371_10009406 3300013102 Bacteria 7694
247 Ga0157370_10004556 3300013104 Bacteria 15864
248 Ga0157370_10005515 3300013104 Bacteria 14180
249 Ga0157370_10011083 3300013104 Bacteria 9450
250 Ga0157370_10036580 3300013104 Bacteria 4763
251 Ga0157370_10534889 3300013104 Bacteria 1075
252 Ga0157369_10000114 3300013105 Bacteria 113453
253 Ga0157369_10150651 3300013105 Bacteria 2458
254 Ga0157369_10357155 3300013105 Bacteria 1517
255 Ga0157369_10761042 3300013105 Bacteria 996
256 Ga0157374_10014004 3300013296 Bacteria 7010
257 Ga0157374_10207695 3300013296 Bacteria 1919
258 Ga0157374_10211096 3300013296 Bacteria 1903
259 Ga0157378_10000322 3300013297 Bacteria 47146
260 Ga0157378_10026771 3300013297 Bacteria 5085
261 Ga0157378_10217786 3300013297 Bacteria 1814
262 Ga0163162_10043365 3300013306 Bacteria 4504
263 Ga0163162_10080175 3300013306 Bacteria 3332
264 Ga0163162_10098108 3300013306 Bacteria 3019
265 Ga0163162_10420958 3300013306 Bacteria 1468
266 Ga0157372_10025975 3300013307 Bacteria 6370
267 Ga0157372_10032948 3300013307 Bacteria 5687
268 Ga0157372_10069158 3300013307 Bacteria 3971
269 Ga0157372_10103762 3300013307 Bacteria 3249
270 Ga0157372_10249727 3300013307 Bacteria 2059
271 Ga0157372_10414469 3300013307 Bacteria 1570
272 Ga0157372_11054734 3300013307 Bacteria 941
273 Ga0157375_10000459 3300013308 Bacteria 37058
274 Ga0157375_10035389 3300013308 Bacteria 4766
275 Ga0157375_10164466 3300013308 Bacteria 2363
276 Ga0157375_10212061 3300013308 Bacteria 2094
277 Ga0157375_10519589 3300013308 Bacteria 1354
278 Ga0157375_11235122 3300013308 Bacteria 877
279 Ga0163163_10018334 3300014325 Bacteria 6550
280 Ga0163163_10257451 3300014325 Bacteria 1796
281 Ga0157377_10007481 3300014745 Bacteria 5278
282 Ga0157377_10331037 3300014745 Bacteria 1015
283 Ga0157379_10300818 3300014968 Bacteria 1462
284 Ga0157379_10369859 3300014968 Bacteria 1314
285 Ga0157376_10001958 3300014969 Bacteria 13773
286 Ga0157376_10006141 3300014969 Bacteria 8458
287 Ga0157376_10045401 3300014969 Bacteria 3617
288 Ga0157376_10050961 3300014969 Bacteria 3436
289 Ga0182006_1003066 3300015261 Bacteria 8763
290 Ga0182006_1143667 3300015261 Bacteria 813
291 Ga0182007_10019186 3300015262 Bacteria 2463
292 Ga0182005_1035578 3300015265 Bacteria 1354
293 Ga0183369_1003 3300015685 Bacteria 726443
294 Ga0183368_1003 3300015687 Bacteria 1276390
295 Ga0209435_104489 3300025206 Bacteria 1578
296 Ga0209760_100541 3300025207 Bacteria 7120
297 Ga0209784_100422 3300025224 Bacteria 18592
298 Ga0209566_101312 3300025225 Bacteria 8033
299 Ga0209674_100012 3300025226 Bacteria 950162
300 Ga0209674_100140 3300025226 Bacteria 109152
301 Ga0209674_100373 3300025226 Bacteria 24523
302 Ga0209672_100005 3300025228 Bacteria 1069303
303 Ga0209672_100016 3300025228 Bacteria 522604
304 Ga0209672_100141 3300025228 Bacteria 67332
305 Ga0209672_101550 3300025228 Bacteria 7904
306 Ga0209563_100023 3300025230 Bacteria 636844
307 Ga0207427_100057 3300025231 Bacteria 198202
308 Ga0207427_100111 3300025231 Bacteria 112775
309 Ga0207427_100179 3300025231 Bacteria 67665
310 Ga0207427_100443 3300025231 Bacteria 23103
311 Ga0207427_101239 3300025231 Bacteria 9790
312 Ga0209437_100099 3300025233 Bacteria 229500
313 Ga0209437_100184 3300025233 Bacteria 128650
314 Ga0209437_100270 3300025233 Bacteria 78319
315 Ga0209437_100878 3300025233 Bacteria 12233
316 Ga0209437_102084 3300025233 Bacteria 4059
317 Ga0209258_100006 3300025242 Bacteria 1069303
318 Ga0209258_100012 3300025242 Bacteria 825544
319 Ga0209258_100119 3300025242 Bacteria 183554
320 Ga0209258_100316 3300025242 Bacteria 74911
321 Ga0209258_100509 3300025242 Bacteria 37607
322 Ga0209258_101510 3300025242 Bacteria 7889
323 Ga0209646_1000487 3300025246 Bacteria 19378
324 Ga0209646_1001182 3300025246 Bacteria 7580
325 Ga0209646_1021838 3300025246 Bacteria 917
326 Ga0209026_1000117 3300025250 Bacteria 131918
327 Ga0209026_1000276 3300025250 Bacteria 60964
328 Ga0209026_1000414 3300025250 Bacteria 36965
329 Ga0209026_1003387 3300025250 Bacteria 5260
330 Ga0209677_105076 3300025253 Bacteria 3558
331 Ga0209148_1000005 3300025254 Bacteria 1806504
332 Ga0209148_1000012 3300025254 Bacteria 1069303
333 Ga0209148_1000014 3300025254 Bacteria 925277
334 Ga0209148_1000036 3300025254 Bacteria 530505
335 Ga0209148_1000201 3300025254 Bacteria 107073
336 Ga0209148_1000244 3300025254 Bacteria 86833
337 Ga0209759_1000134 3300025256 Bacteria 126221
338 Ga0209759_1002336 3300025256 Bacteria 8501
339 Ga0209759_1002497 3300025256 Bacteria 8025
340 Ga0209233_1000040 3300025261 Bacteria 530395
341 Ga0209233_1000063 3300025261 Bacteria 395810
342 Ga0209233_1000075 3300025261 Bacteria 356837
343 Ga0209233_1000077 3300025261 Bacteria 349570
344 Ga0209233_1001156 3300025261 Bacteria 10712
345 Ga0209455_1000008 3300025272 Bacteria 1069303
346 Ga0209455_1000014 3300025272 Bacteria 806601
347 Ga0209455_1000018 3300025272 Bacteria 718034
348 Ga0209455_1000164 3300025272 Bacteria 114011
349 Ga0209256_1002977 3300025299 Bacteria 12652
350 Ga0207656_10000662 3300025321 Bacteria 11286
351 Ga0207680_10000001 3300025903 Bacteria 1091453
352 Ga0207680_10000218 3300025903 Bacteria 27690
353 Ga0207680_10004422 3300025903 Bacteria 6666
354 Ga0207680_10278788 3300025903 Unclassified 1161
355 Ga0207680_10432295 3300025903 Bacteria 933
356 Ga0207647_10000286 3300025904 Bacteria 41390
357 Ga0207647_10022283 3300025904 Bacteria 4210
358 Ga0207647_10052007 3300025904 Bacteria 2529
359 Ga0207699_10076986 3300025906 Bacteria 2057
360 Ga0207645_10120717 3300025907 Bacteria 1701
361 Ga0207643_10020147 3300025908 Bacteria 3659
362 Ga0207643_10042633 3300025908 Bacteria 2559
363 Ga0207705_10052373 3300025909 Bacteria 2938
364 Ga0207684_10000121 3300025910 Bacteria 143066
365 Ga0207654_10083376 3300025911 Bacteria 1930
366 Ga0207707_10013069 3300025912 Bacteria 7232
367 Ga0207707_10044862 3300025912 Bacteria 3853
368 Ga0207707_10072979 3300025912 Bacteria 2992
369 Ga0207707_10158750 3300025912 Bacteria 1977
370 Ga0207707_10226382 3300025912 Bacteria 1627
371 Ga0207695_10000014 3300025913 Bacteria 812599
372 Ga0207695_10007050 3300025913 Bacteria 14415
373 Ga0207695_10024339 3300025913 Bacteria 6816
374 Ga0207695_10065042 3300025913 Bacteria 3751
375 Ga0207671_10003776 3300025914 Bacteria 14885
376 Ga0207671_10016470 3300025914 Bacteria 5743
377 Ga0207671_10099109 3300025914 Bacteria 2205
378 Ga0207671_10342910 3300025914 Bacteria 1184
379 Ga0207671_10597923 3300025914 Bacteria 879
380 Ga0207693_10133123 3300025915 Bacteria 1954
381 Ga0207663_10086979 3300025916 Bacteria 2063
382 Ga0207660_10020818 3300025917 Bacteria 4408
383 Ga0207660_10049914 3300025917 Bacteria 2969
384 Ga0207657_10058102 3300025919 Bacteria 3330
385 Ga0207657_10078070 3300025919 Bacteria 2789
386 Ga0207657_10092282 3300025919 Bacteria 2524
387 Ga0207657_10320578 3300025919 Bacteria 1225
388 Ga0207657_10698704 3300025919 Bacteria 788
389 Ga0207649_10269666 3300025920 Bacteria 1233
390 Ga0207652_10012631 3300025921 Bacteria 6828
391 Ga0207652_10041141 3300025921 Bacteria 3927
392 Ga0207646_10038988 3300025922 Bacteria 4276
393 Ga0207681_10155946 3300025923 Bacteria 1716
394 Ga0207681_10196440 3300025923 Bacteria 1547
395 Ga0207694_10000168 3300025924 Bacteria 67647
396 Ga0207694_10001142 3300025924 Bacteria 23029
397 Ga0207694_10001700 3300025924 Bacteria 18417
398 Ga0207694_10003489 3300025924 Bacteria 12503
399 Ga0207694_10007373 3300025924 Bacteria 8343
400 Ga0207694_10040507 3300025924 Bacteria 3587
401 Ga0207694_10132569 3300025924 Bacteria 1998
402 Ga0207694_10579962 3300025924 Unclassified 942
403 Ga0207650_10015995 3300025925 Bacteria 5235
404 Ga0207650_10169000 3300025925 Bacteria 1737
405 Ga0207650_10369008 3300025925 Bacteria 1184
406 Ga0207659_10005820 3300025926 Bacteria 7512
407 Ga0207659_10082244 3300025926 Bacteria 2383
408 Ga0207687_10102250 3300025927 Bacteria 2111
409 Ga0207687_10561367 3300025927 Bacteria 959
410 Ga0207700_10096576 3300025928 Bacteria 2346
411 Ga0207664_10000023 3300025929 Bacteria 204730
412 Ga0207664_10000200 3300025929 Bacteria 44986
413 Ga0207644_10592280 3300025931 Bacteria 920
414 Ga0207690_10000138 3300025932 Bacteria 59404
415 Ga0207690_10003322 3300025932 Bacteria 9623
416 Ga0207690_10005588 3300025932 Bacteria 7429
417 Ga0207690_10009214 3300025932 Bacteria 5861
418 Ga0207690_10034933 3300025932 Bacteria 3242
419 Ga0207690_10108188 3300025932 Bacteria 1997
420 Ga0207706_10002151 3300025933 Bacteria 19257
421 Ga0207706_10047647 3300025933 Bacteria 3792
422 Ga0207706_10200878 3300025933 Bacteria 1748
423 Ga0207706_10412971 3300025933 Bacteria 1170
424 Ga0207686_10140942 3300025934 Bacteria 1666
425 Ga0207686_10187852 3300025934 Unclassified 1470
426 Ga0207686_10266529 3300025934 Bacteria 1258
427 Ga0207670_10000951 3300025936 Bacteria 15281
428 Ga0207670_10164471 3300025936 Bacteria 1659
429 Ga0207669_10035252 3300025937 Bacteria 2845
430 Ga0207669_10486030 3300025937 Bacteria 985
431 Ga0207704_10006533 3300025938 Bacteria 5446
432 Ga0207704_10086008 3300025938 Bacteria 2049
433 Ga0207704_10204616 3300025938 Bacteria 1448
434 Ga0207704_10238285 3300025938 Bacteria 1357
435 Ga0207665_10116644 3300025939 Bacteria 1882
436 Ga0207665_10655675 3300025939 Bacteria 823
437 Ga0207691_10033892 3300025940 Bacteria 4753
438 Ga0207691_10057932 3300025940 Bacteria 3525
439 Ga0207711_10029973 3300025941 Bacteria 4590
440 Ga0207689_10002445 3300025942 Bacteria 17309
441 Ga0207689_10021229 3300025942 Bacteria 5459
442 Ga0207689_10117797 3300025942 Bacteria 2184
443 Ga0207689_10169566 3300025942 Bacteria 1799
444 Ga0207661_10168474 3300025944 Bacteria 1905
445 Ga0207661_10419015 3300025944 Unclassified 1216
446 Ga0207679_10012035 3300025945 Bacteria 5625
447 Ga0207667_10008241 3300025949 Bacteria 12404
448 Ga0207667_10028030 3300025949 Bacteria 6120
449 Ga0207651_10055094 3300025960 Bacteria 2729
450 Ga0207651_10102122 3300025960 Bacteria 2131
451 Ga0207712_10000745 3300025961 Bacteria 24662
452 Ga0207712_10128984 3300025961 Bacteria 1924
453 Ga0207668_10037848 3300025972 Bacteria 3233
454 Ga0207668_10057888 3300025972 Bacteria 2706
455 Ga0207668_10266936 3300025972 Bacteria 1397
456 Ga0207668_10336924 3300025972 Bacteria 1257
457 Ga0207640_10004096 3300025981 Bacteria 7875
458 Ga0207658_10005424 3300025986 Bacteria 8744
459 Ga0207658_10119922 3300025986 Bacteria 2095
460 Ga0207658_10186657 3300025986 Bacteria 1720
461 Ga0207658_10464365 3300025986 Bacteria 1122
462 Ga0207677_10197701 3300026023 Bacteria 1595
463 Ga0207703_10002027 3300026035 Bacteria 17888
464 Ga0207703_10597880 3300026035 Bacteria 1043
465 Ga0207703_10742087 3300026035 Bacteria 935
466 Ga0207639_10004144 3300026041 Bacteria 9759
467 Ga0207639_10015812 3300026041 Bacteria 5328
468 Ga0207639_10148530 3300026041 Bacteria 1961
469 Ga0207639_10190980 3300026041 Bacteria 1749
470 Ga0207639_10408317 3300026041 Bacteria 1225
471 Ga0207639_10448272 3300026041 Bacteria 1171
472 Ga0207678_10005813 3300026067 Bacteria 10994
473 Ga0207678_10070555 3300026067 Bacteria 2996
474 Ga0207678_10195785 3300026067 Bacteria 1727
475 Ga0207678_10285600 3300026067 Bacteria 1417
476 Ga0207678_10800903 3300026067 Bacteria 832
477 Ga0207702_10001815 3300026078 Bacteria 21008
478 Ga0207641_10235681 3300026088 Bacteria 1703
479 Ga0207641_10596934 3300026088 Bacteria 1081
480 Ga0207641_10733722 3300026088 Bacteria 974
481 Ga0207648_10009668 3300026089 Bacteria 9222
482 Ga0207648_10605728 3300026089 Bacteria 1010
483 Ga0207676_10037898 3300026095 Bacteria 3677
484 Ga0207676_11244773 3300026095 Bacteria 738
485 Ga0207674_10003313 3300026116 Bacteria 19805
486 Ga0207674_10030465 3300026116 Bacteria 5671
487 Ga0207674_10231844 3300026116 Bacteria 1794
488 Ga0207674_10285092 3300026116 Bacteria 1600
489 Ga0207674_10678227 3300026116 Bacteria 995
490 Ga0207675_100514386 3300026118 Bacteria 1193
491 Ga0207683_10004646 3300026121 Bacteria 11836
492 Ga0207683_10008124 3300026121 Bacteria 8975
493 Ga0207683_10010121 3300026121 Bacteria 8046
494 Ga0207683_10188535 3300026121 Bacteria 1872
495 Ga0207683_10680241 3300026121 Bacteria 954
496 Ga0207698_10041829 3300026142 Bacteria 3419
497 Ga0209588_1000001 3300027671 Bacteria 705877
498 Ga0268266_10000001 3300028379 Bacteria 4040580
499 Ga0268266_10000013 3300028379 Bacteria 649715
500 Ga0268266_10000075 3300028379 Bacteria 218045
501 Ga0268265_10297999 3300028380 Bacteria 1450
502 Ga0268265_10441971 3300028380 Bacteria 1212
503 Ga0268264_10079476 3300028381 Bacteria 2798
504 Ga0268264_10194410 3300028381 Bacteria 1851
505 Ga0307517_10154980 3300028786 Bacteria 1558
506 Ga0307408_100513816 3300031548 Bacteria 1051
507 Ga0307406_10099256 3300031901 Bacteria 1979
508 Ga0307416_100198820 3300032002 Bacteria 1899
509 Ga0307416_100825753 3300032002 Bacteria 1024
510 Ga0307510_10002367 3300033180 Bacteria 21348
511 Ga0307510_10043003 3300033180 Bacteria 4915
512 Ga0373934_0015089 3300035086 Bacteria 2929
513 Ga0373923_0001685 3300035111 Bacteria 6465
514 Ga0373953_0021480 3300035117 Bacteria 2423
515 Ga0373954_0106440 3300035118 Bacteria 1355
516 Ga0373956_0000342 3300035119 Bacteria 18800
517 Ga0373957_0004152 3300035120 Bacteria 4376
518 Ga0373943_0021560 3300035170 Bacteria 2976
519 Ga0373955_0028960 3300035172 Bacteria 2876
520 Ga0373935_0443109 3300035692 Bacteria 937
521 Ga0373927_0014915 3300035695 Bacteria 5140
522 Ga0373927_0191488 3300035695 Bacteria 1342
523 Ga0373933_0000836 3300035724 Bacteria 18821
524 Ga0373937_0002242 3300036401 Bacteria 16140
525 Ga0395899_0000089 3300037312 Bacteria 156851
526 Ga0395899_0012531 3300037312 Bacteria 6498
527 Ga0395899_0147439 3300037312 Bacteria 1670
528 Ga0395899_0177970 3300037312 Bacteria 1494
529 Ga0395899_0236952 3300037312 Bacteria 1257
530 Ga0395899_0274215 3300037312 Bacteria 1149
531 Ga0395900_0000029 3300037418 Bacteria 281061
532 Ga0395900_0000651 3300037418 Bacteria 46429
533 Ga0395900_0007702 3300037418 Bacteria 11106
534 Ga0395900_0076239 3300037418 Bacteria 3446
535 Ga0395900_0092578 3300037418 Bacteria 3106
536 Ga0395898_0000018 3300037466 Bacteria 418600
537 Ga0395898_0000241 3300037466 Bacteria 138133
538 Ga0395898_0004579 3300037466 Bacteria 15091
539 Ga0395898_0029429 3300037466 Bacteria 5502
540 Ga0395898_0042982 3300037466 Bacteria 4454
541 Ga0395898_0111996 3300037466 Bacteria 2615
542 Ga0395901_0000873 3300038443 Bacteria 33251
543 Ga0395901_0003835 3300038443 Bacteria 15156
544 Ga0395901_0021565 3300038443 Bacteria 6600
545 Ga0395901_0062534 3300038443 Bacteria 3873
546 Ga0395901_0273491 3300038443 Bacteria 1756
547 Ga0395901_0470476 3300038443 Bacteria 1283
548 Ga0451795_0663999 3300041456 Bacteria 958
549 Ga0451807_2321265 3300041486 Bacteria 1700
550 Ga0439459_0007326 3300042438 Bacteria 1861
551 Ga0466969_0006829 3300044656 Bacteria 6071
552 Ga0466972_0001275 3300044658 Bacteria 12158
553 Ga0466965_0044614 3300044683 Bacteria 2191
554 Ga0466966_0021050 3300044684 Bacteria 4283
555 Ga0466966_0045989 3300044684 Bacteria 2788
556 Ga0466961_0000345 3300044693 Bacteria 30306
557 Ga0466961_0004106 3300044693 Bacteria 9090
558 Ga0466961_0005564 3300044693 Bacteria 7952
559 Ga0466961_0012072 3300044693 Bacteria 5520
560 Ga0466961_0320382 3300044693 Bacteria 945
561 Ga0466961_0413741 3300044693 Bacteria 817
562 Ga0466963_0202335 3300044694 Bacteria 1389
563 Ga0466971_0012327 3300044719 Bacteria 3744
564 Ga0466971_0060637 3300044719 Bacteria 1710
565 Ga0466970_0008454 3300044765 Bacteria 5181
566 Ga0466970_0014316 3300044765 Bacteria 4070
567 Ga0466970_0099205 3300044765 Bacteria 1586
568 Ga0466957_0017384 3300044842 Bacteria 4210
569 Ga0466957_0090235 3300044842 Bacteria 1919
570 Ga0466957_0271070 3300044842 Bacteria 1133
571 Ga0466959_0000148 3300045049 Bacteria 45981
572 Ga0466959_0002116 3300045049 Bacteria 12562
573 Ga0466959_0028465 3300045049 Bacteria 4143
574 Ga0466959_0109786 3300045049 Bacteria 1969
575 Ga0466959_0128582 3300045049 Bacteria 1796
576 Ga0466959_0130936 3300045049 Bacteria 1778
577 Ga0451576_1347146 3300045051 Bacteria 743
578 Ga0466958_0006082 3300045836 Bacteria 6543
579 Ga0466958_0008710 3300045836 Bacteria 5632
580 Ga0466958_0079594 3300045836 Bacteria 2015
581 Ga0466958_0215517 3300045836 Bacteria 1224
582 Ga0466958_0409055 3300045836 Bacteria 876
583 Ga0466967_0104957 3300045976 Bacteria 2588
584 Ga0495592_0000556 3300046454 Bacteria 26585
585 Ga0495629_0070660 3300046459 Bacteria 2436
586 Ga0495638_0001233 3300046460 Bacteria 24188
587 Ga0495651_0008843 3300046462 Bacteria 7728
588 Ga0495653_0001754 3300046463 Bacteria 17102
589 Ga0495650_0000350 3300046471 Bacteria 81541
590 Ga0495582_0107775 3300046473 Bacteria 1564
591 Ga0495639_0042443 3300046475 Bacteria 2051
592 Ga0495639_0505217 3300046475 Bacteria 617
593 Ga0495664_0195749 3300046477 Bacteria 1225
594 Ga0495594_0054989 3300046499 Bacteria 2194
595 Ga0495594_0072357 3300046499 Bacteria 1918
596 Ga0495606_0000016 3300046507 Bacteria 284865
597 Ga0495608_0078561 3300046511 Bacteria 2146
598 Ga0495628_0001995 3300046516 Bacteria 18493
599 Ga0495630_0002377 3300046517 Bacteria 13064
600 Ga0495630_0297828 3300046517 Bacteria 1232
601 Ga0495652_0296850 3300046529 Bacteria 1176
602 Ga0495665_0056746 3300046531 Bacteria 2067
603 Ga0495586_0005012 3300046535 Bacteria 7088
604 Ga0495587_0023366 3300046536 Bacteria 3798
605 Ga0495645_0000351 3300046543 Bacteria 32660
606 Ga0495635_0020957 3300046663 Bacteria 4555
607 Ga0495635_0350485 3300046663 Bacteria 985
608 Ga0495657_0000570 3300046675 Bacteria 33908
609 Ga0495599_0001218 3300046678 Bacteria 14597
610 Ga0495623_0002945 3300046679 Bacteria 11200
611 Ga0495646_0001207 3300046680 Bacteria 15118
612 Ga0495658_0373345 3300046683 Bacteria 908
613 Ga0495613_0061021 3300046689 Bacteria 2762
614 Ga0495649_0000228 3300046694 Bacteria 49043
615 Ga0495600_0000232 3300046809 Bacteria 30893
616 Ga0495581_0102134 3300047315 Bacteria 1666
617 Ga0495581_0105760 3300047315 Bacteria 1635
618 Ga0495604_0000429 3300047317 Bacteria 37816
619 Ga0495674_0002730 3300047319 Bacteria 17149
620 Ga0495674_0019274 3300047319 Bacteria 6335
621 Ga0495672_0009110 3300047320 Bacteria 7237
622 Ga0495684_0000115 3300047471 Bacteria 58017
623 Ga0495684_0065400 3300047471 Bacteria 2764
624 Ga0495602_0100458 3300048088 Unclassified 2375
625 Ga0496101_0973981 3300048904 Bacteria 667
626 Ga0496104_0000041 3300048907 Bacteria 161394
627 Ga0496105_0000022 3300048908 Bacteria 161208
628 Ga0496105_0177054 3300048908 Bacteria 1747
629 Ga0496112_0652152 3300048915 Bacteria 982
630 Ga0496113_0022532 3300048916 Bacteria 4457
631 Ga0496114_0084714 3300048917 Bacteria 2684
632 Ga0496115_0000114 3300048918 Bacteria 73307
633 Ga0496115_0002199 3300048918 Bacteria 13961
634 Ga0496115_0015302 3300048918 Bacteria 5817
635 Ga0496117_0191280 3300048920 Bacteria 1165
636 Ga0496118_0000264 3300048921 Bacteria 91882
637 Ga0496121_0039863 3300048924 Bacteria 4131
638 Ga0496121_0122684 3300048924 Bacteria 1959
639 Ga0496121_0196226 3300048924 Bacteria 1443
640 Ga0496125_0000604 3300048928 Bacteria 61025
641 Ga0496125_0083196 3300048928 Bacteria 2436
642 Ga0496126_0005938 3300048929 Bacteria 13757
643 Ga0496126_0015681 3300048929 Bacteria 7613
644 Ga0496126_0024412 3300048929 Bacteria 5838
645 Ga0496126_0177501 3300048929 Bacteria 1811
646 Ga0495678_038190 3300049459 Bacteria 1945
647 Ga0495678_165713 3300049459 Bacteria 703
648 Ga0501031_0125479 3300049568 Bacteria 1677
649 Ga0501032_0044875 3300049569 Bacteria 2991
650 Ga0501032_0051863 3300049569 Bacteria 2765
651 Ga0501032_0077225 3300049569 Bacteria 2217
652 Ga0501033_0011789 3300049570 Bacteria 6681
653 Ga0501033_0075059 3300049570 Bacteria 2482
654 Ga0501033_0264150 3300049570 Bacteria 1218
655 Ga0501034_0007995 3300049571 Bacteria 11227
656 Ga0501034_0010146 3300049571 Bacteria 9828
657 Ga0501034_0034354 3300049571 Bacteria 5140
658 Ga0501034_0255425 3300049571 Bacteria 1696
659 Ga0501036_0019161 3300049572 Bacteria 5741
660 Ga0501036_0079512 3300049572 Bacteria 2773
661 Ga0501036_0093793 3300049572 Bacteria 2536
662 Ga0501036_0528735 3300049572 Bacteria 980
663 Ga0501037_0008152 3300049573 Bacteria 7678
664 Ga0501037_0009429 3300049573 Bacteria 7164
665 Ga0501037_0132063 3300049573 Bacteria 1790
666 Ga0501037_0401833 3300049573 Bacteria 940
667 Ga0501037_0448278 3300049573 Bacteria 880
668 Ga0501037_0538030 3300049573 Bacteria 789
669 Ga0501038_0000645 3300049574 Bacteria 30998
670 Ga0501038_0140085 3300049574 Bacteria 1979
671 Ga0501038_0342571 3300049574 Bacteria 1165
672 Ga0501038_0401927 3300049574 Bacteria 1060
673 Ga0501039_0077980 3300049575 Bacteria 2577
674 Ga0501039_0156809 3300049575 Bacteria 1788
675 Ga0501039_0175257 3300049575 Bacteria 1686
676 Ga0501042_0127555 3300049578 Bacteria 1832
677 Ga0501043_0016067 3300049579 Bacteria 5870
678 Ga0501043_0045728 3300049579 Bacteria 3442
679 Ga0501043_0091025 3300049579 Bacteria 2398
680 Ga0501043_0158767 3300049579 Bacteria 1767
681 Ga0501043_0176790 3300049579 Bacteria 1664
682 Ga0501046_0011217 3300049580 Bacteria 7674
683 Ga0501046_0046919 3300049580 Bacteria 3427
684 Ga0501046_0143055 3300049580 Bacteria 1808
685 Ga0501046_0397947 3300049580 Bacteria 995
686 Ga0501047_0041830 3300049581 Bacteria 4427
687 Ga0501047_0074836 3300049581 Bacteria 3260
688 Ga0501047_0163581 3300049581 Bacteria 2096
689 Ga0501047_0195408 3300049581 Bacteria 1885
690 Ga0501047_0227329 3300049581 Bacteria 1720
691 Ga0501047_0541774 3300049581 Bacteria 988
692 Ga0501048_0045725 3300049582 Bacteria 3126
693 Ga0501048_0070554 3300049582 Bacteria 2467
694 Ga0501048_0710439 3300049582 Bacteria 722
695 Ga0501068_0044775 3300049584 Bacteria 2665
696 Ga0501070_0052824 3300049586 Bacteria 3372
697 Ga0501070_0122601 3300049586 Bacteria 2148
698 Ga0501070_0319709 3300049586 Bacteria 1262
699 Ga0501071_0304687 3300049587 Bacteria 1208
700 Ga0501073_0041674 3300049589 Bacteria 3244
701 Ga0501073_0083883 3300049589 Bacteria 2217
702 Ga0501073_0084864 3300049589 Bacteria 2203
703 Ga0501074_0313423 3300049590 Bacteria 1114
704 Ga0501079_0415993 3300049741 Bacteria 1055
705 Ga0501080_0026675 3300049742 Bacteria 5368
706 Ga0501080_0060795 3300049742 Bacteria 3517
707 Ga0501080_0233258 3300049742 Bacteria 1682
708 Ga0501035_0035859 3300049822 Bacteria 4499
709 Ga0501035_0047260 3300049822 Bacteria 3864
710 Ga0501035_0048891 3300049822 Bacteria 3791
711 Ga0501035_0052939 3300049822 Bacteria 3631
712 Ga0501035_0111969 3300049822 Bacteria 2391
713 Ga0501035_0167333 3300049822 Bacteria 1900
714 Ga0501035_0191640 3300049822 Bacteria 1757
715 Ga0501035_0226084 3300049822 Bacteria 1596
716 Ga0501035_0439685 3300049822 Bacteria 1080
717 Ga0501035_0652078 3300049822 Bacteria 853
718 Ga0501044_0022729 3300049823 Bacteria 6677
719 Ga0501044_0030494 3300049823 Bacteria 5683
720 Ga0501044_0058268 3300049823 Bacteria 3961
721 Ga0501044_0093702 3300049823 Bacteria 3028
722 Ga0501044_0221312 3300049823 Bacteria 1843
723 Ga0501044_0284672 3300049823 Bacteria 1585
724 Ga0501044_0342416 3300049823 Bacteria 1416
725 Ga0501044_0367726 3300049823 Bacteria 1355
726 Ga0501044_0474372 3300049823 Unclassified 1155
727 Ga0501044_0637572 3300049823 Bacteria 955
728 nmdc:mga06r32_219190_c1 3300050510 Bacteria 1891
729 Ga0495612_0000706 3300053078 Bacteria 13533
730 Ga0495619_0004129 3300053085 Bacteria 9280
731 Ga0500646_0007243 3300053090 Bacteria 2832
732 Ga0500597_000037 3300053120 Bacteria 26711
733 Ga0500597_161391 3300053120 Bacteria 959
734 Ga0501082_0110921 3300060353 Bacteria 2374
735 Ga0466962_0030288 3300061719 Bacteria 2591

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100193912 Ga0070694_1001939122 166
2 3300005545 Ga0070695_100020249 Ga0070695_1000202492 166
3 3300005547 Ga0070693_100211150 Ga0070693_1002111501 166
4 3300005437 Ga0070710_10045776 Ga0070710_100457762 171
5 3300049569 Ga0501032_0044875 Ga0501032_0044875_1859_2500 173
6 3300049586 Ga0501070_0319709 Ga0501070_0319709_200_841 173
7 3300049823 Ga0501044_0058268 Ga0501044_0058268_3163_3804 173
8 3300046475 Ga0495639_0505217 Ga0495639_0505217_52_606 181
9 3300048920 Ga0496117_0191280 Ga0496117_0191280_606_1154 182
10 3300044684 Ga0466966_0021050 Ga0466966_0021050_3706_4257 183
11 3300044693 Ga0466961_0413741 Ga0466961_0413741_240_791 183
12 3300007265 Ga0099794_10000575 Ga0099794_100005757 185
13 3300027671 Ga0209588_1000001 Ga0209588_1000001145 185
14 3300005468 Ga0070707_100039332 Ga0070707_1000393322 186
15 3300005471 Ga0070698_100120714 Ga0070698_1001207142 186
16 3300005536 Ga0070697_100051466 Ga0070697_1000514662 186
17 3300025910 Ga0207684_10000121 Ga0207684_1000012150 186
18 3300025922 Ga0207646_10038988 Ga0207646_100389882 186
19 3300032002 Ga0307416_100825753 Ga0307416_1008257531 187
20 3300005329 Ga0070683_100171784 Ga0070683_1001717842 189
21 3300005337 Ga0070682_100792045 Ga0070682_1007920451 189
22 3300005353 Ga0070669_100037305 Ga0070669_1000373053 189
23 3300005354 Ga0070675_100272724 Ga0070675_1002727242 189
24 3300005530 Ga0070679_100777117 Ga0070679_1007771172 189
25 3300014325 Ga0163163_10257451 Ga0163163_102574512 189
26 3300025923 Ga0207681_10196440 Ga0207681_101964402 189
27 3300025944 Ga0207661_10168474 Ga0207661_101684742 189
28 3300047320 Ga0495672_0009110 Ga0495672_0009110_4823_5410 189
29 3300035086 Ga0373934_0015089 Ga0373934_0015089_1546_2127 190
30 3300035111 Ga0373923_0001685 Ga0373923_0001685_4426_5007 190
31 3300035117 Ga0373953_0021480 Ga0373953_0021480_111_692 190
32 3300035118 Ga0373954_0106440 Ga0373954_0106440_112_693 190
33 3300035119 Ga0373956_0000342 Ga0373956_0000342_425_1006 190
34 3300035120 Ga0373957_0004152 Ga0373957_0004152_1025_1606 190
35 3300035172 Ga0373955_0028960 Ga0373955_0028960_626_1207 190
36 3300035692 Ga0373935_0443109 Ga0373935_0443109_90_671 190
37 3300035724 Ga0373933_0000836 Ga0373933_0000836_16570_17151 190
38 3300036401 Ga0373937_0002242 Ga0373937_0002242_13867_14448 190
39 3300046454 Ga0495592_0000556 Ga0495592_0000556_2610_3191 190
40 3300046459 Ga0495629_0070660 Ga0495629_0070660_1063_1644 190
41 3300046462 Ga0495651_0008843 Ga0495651_0008843_978_1559 190
42 3300046463 Ga0495653_0001754 Ga0495653_0001754_6565_7146 190
43 3300046477 Ga0495664_0195749 Ga0495664_0195749_430_1011 190
44 3300046511 Ga0495608_0078561 Ga0495608_0078561_1117_1698 190
45 3300046516 Ga0495628_0001995 Ga0495628_0001995_2976_3557 190
46 3300046517 Ga0495630_0002377 Ga0495630_0002377_9455_10036 190
47 3300046529 Ga0495652_0296850 Ga0495652_0296850_64_645 190
48 3300046531 Ga0495665_0056746 Ga0495665_0056746_1364_1945 190
49 3300046536 Ga0495587_0023366 Ga0495587_0023366_1641_2222 190
50 3300046543 Ga0495645_0000351 Ga0495645_0000351_17167_17748 190
51 3300046663 Ga0495635_0020957 Ga0495635_0020957_1098_1679 190
52 3300046675 Ga0495657_0000570 Ga0495657_0000570_16920_17501 190
53 3300046678 Ga0495599_0001218 Ga0495599_0001218_1458_2039 190
54 3300046679 Ga0495623_0002945 Ga0495623_0002945_9975_10556 190
55 3300046680 Ga0495646_0001207 Ga0495646_0001207_1674_2255 190
56 3300046689 Ga0495613_0061021 Ga0495613_0061021_86_667 190
57 3300046809 Ga0495600_0000232 Ga0495600_0000232_27497_28078 190
58 3300047315 Ga0495581_0102134 Ga0495581_0102134_288_869 190
59 3300047317 Ga0495604_0000429 Ga0495604_0000429_34522_35103 190
60 3300047319 Ga0495674_0002730 Ga0495674_0002730_3704_4285 190
61 3300047471 Ga0495684_0000115 Ga0495684_0000115_13314_13895 190
62 3300048088 Ga0495602_0100458 Ga0495602_0100458_1550_2131 190
63 3300050510 nmdc:mga06r32_219190_c1 nmdc:mga06r32_219190_c1_781_1362 190
64 3300053078 Ga0495612_0000706 Ga0495612_0000706_8289_8870 190
65 3300053085 Ga0495619_0004129 Ga0495619_0004129_5785_6366 190
66 3300005328 Ga0070676_10046880 Ga0070676_100468802 191
67 3300005334 Ga0068869_100266181 Ga0068869_1002661812 191
68 3300005354 Ga0070675_100075845 Ga0070675_1000758452 191
69 3300005445 Ga0070708_100000007 Ga0070708_100000007114 191
70 3300005468 Ga0070707_100096329 Ga0070707_1000963293 191
71 3300005471 Ga0070698_100262638 Ga0070698_1002626381 191
72 3300005614 Ga0068856_100420258 Ga0068856_1004202582 191
73 3300005844 Ga0068862_100023433 Ga0068862_1000234332 191
74 3300006175 Ga0070712_100669544 Ga0070712_1006695442 191
75 3300006881 Ga0068865_100158311 Ga0068865_1001583112 191
76 3300009098 Ga0105245_10355162 Ga0105245_103551622 191
77 3300009148 Ga0105243_10369795 Ga0105243_103697952 191
78 3300009177 Ga0105248_10506360 Ga0105248_105063602 191
79 3300009177 Ga0105248_10965684 Ga0105248_109656841 191
80 3300009551 Ga0105238_10612615 Ga0105238_106126152 191
81 3300009553 Ga0105249_10069077 Ga0105249_100690772 191
82 3300011119 Ga0105246_10296663 Ga0105246_102966632 191
83 3300013104 Ga0157370_10004556 Ga0157370_100045566 191
84 3300013296 Ga0157374_10207695 Ga0157374_102076952 191
85 3300013297 Ga0157378_10217786 Ga0157378_102177862 191
86 3300013307 Ga0157372_10069158 Ga0157372_100691582 191
87 3300013308 Ga0157375_10164466 Ga0157375_101644662 191
88 3300014745 Ga0157377_10331037 Ga0157377_103310372 191
89 3300025903 Ga0207680_10278788 Ga0207680_102787882 191
90 3300025906 Ga0207699_10076986 Ga0207699_100769861 191
91 3300025907 Ga0207645_10120717 Ga0207645_101207173 191
92 3300025924 Ga0207694_10579962 Ga0207694_105799622 191
93 3300025925 Ga0207650_10369008 Ga0207650_103690082 191
94 3300025928 Ga0207700_10096576 Ga0207700_100965763 191
95 3300025934 Ga0207686_10140942 Ga0207686_101409421 191
96 3300025939 Ga0207665_10116644 Ga0207665_101166442 191
97 3300025942 Ga0207689_10117797 Ga0207689_101177972 191
98 3300025960 Ga0207651_10102122 Ga0207651_101021223 191
99 3300026023 Ga0207677_10197701 Ga0207677_101977012 191
100 3300026116 Ga0207674_10678227 Ga0207674_106782272 191
101 3300028380 Ga0268265_10441971 Ga0268265_104419712 191
102 3300035170 Ga0373943_0021560 Ga0373943_0021560_1709_2308 191
103 3300035695 Ga0373927_0014915 Ga0373927_0014915_3474_4121 191
104 3300035695 Ga0373927_0191488 Ga0373927_0191488_285_884 191
105 3300046473 Ga0495582_0107775 Ga0495582_0107775_97_744 191
106 3300046475 Ga0495639_0042443 Ga0495639_0042443_1398_1997 191
107 3300046499 Ga0495594_0054989 Ga0495594_0054989_923_1522 191
108 3300046499 Ga0495594_0072357 Ga0495594_0072357_1125_1724 191
109 3300046517 Ga0495630_0297828 Ga0495630_0297828_470_1069 191
110 3300046535 Ga0495586_0005012 Ga0495586_0005012_1182_1781 191
111 3300046663 Ga0495635_0350485 Ga0495635_0350485_334_933 191
112 3300046683 Ga0495658_0373345 Ga0495658_0373345_19_618 191
113 3300047315 Ga0495581_0105760 Ga0495581_0105760_291_890 191
114 3300047319 Ga0495674_0019274 Ga0495674_0019274_211_858 191
115 3300047471 Ga0495684_0065400 Ga0495684_0065400_1015_1614 191
116 3300048915 Ga0496112_0652152 Ga0496112_0652152_244_843 191
117 3300049570 Ga0501033_0075059 Ga0501033_0075059_630_1235 191
118 3300049571 Ga0501034_0034354 Ga0501034_0034354_1987_2592 191
119 3300049823 Ga0501044_0474372 Ga0501044_0474372_219_824 191
120 iso_pu_bacteria 2593339239 2595451482 191
121 iso_pu_bacteria 2687453130 2687581995 191
122 iso_pu_bacteria 2739367700 2739729972 191
123 iso_pu_bacteria 2884411467 2884412984 191
124 iso_pu_bacteria 2895395659 2895397246 191
125 iso_pu_bacteria 2919404418 2919404563 191
126 iso_pu_bacteria 2939611941 2939612879 191
127 3300005329 Ga0070683_100033550 Ga0070683_1000335503 192
128 3300005329 Ga0070683_100987400 Ga0070683_1009874001 192
129 3300005330 Ga0070690_100043209 Ga0070690_1000432092 192
130 3300005331 Ga0070670_100035414 Ga0070670_1000354142 192
131 3300005334 Ga0068869_100009671 Ga0068869_1000096713 192
132 3300005335 Ga0070666_10339682 Ga0070666_103396822 192
133 3300005336 Ga0070680_100008193 Ga0070680_1000081933 192
134 3300005337 Ga0070682_100021180 Ga0070682_1000211802 192
135 3300005338 Ga0068868_100057784 Ga0068868_1000577842 192
136 3300005339 Ga0070660_100112135 Ga0070660_1001121352 192
137 3300005340 Ga0070689_100080965 Ga0070689_1000809653 192
138 3300005344 Ga0070661_100020646 Ga0070661_1000206463 192
139 3300005345 Ga0070692_10006299 Ga0070692_100062995 192
140 3300005353 Ga0070669_100082972 Ga0070669_1000829722 192
141 3300005354 Ga0070675_100025653 Ga0070675_1000256533 192
142 3300005366 Ga0070659_100047533 Ga0070659_1000475332 192
143 3300005434 Ga0070709_10302788 Ga0070709_103027882 192
144 3300005444 Ga0070694_100095027 Ga0070694_1000950272 192
145 3300005457 Ga0070662_100030126 Ga0070662_1000301262 192
146 3300005458 Ga0070681_10026364 Ga0070681_100263643 192
147 3300005530 Ga0070679_100033490 Ga0070679_1000334903 192
148 3300005539 Ga0068853_100281949 Ga0068853_1002819492 192
149 3300005547 Ga0070693_100009737 Ga0070693_1000097373 192
150 3300005563 Ga0068855_100080267 Ga0068855_1000802673 192
151 3300005564 Ga0070664_100108449 Ga0070664_1001084492 192
152 3300005577 Ga0068857_100656346 Ga0068857_1006563461 192
153 3300005615 Ga0070702_100016179 Ga0070702_1000161792 192
154 3300005617 Ga0068859_100058706 Ga0068859_1000587063 192
155 3300005618 Ga0068864_100066775 Ga0068864_1000667752 192
156 3300005840 Ga0068870_10029604 Ga0068870_100296043 192
157 3300005841 Ga0068863_100015928 Ga0068863_1000159282 192
158 3300005843 Ga0068860_100048917 Ga0068860_1000489175 192
159 3300006237 Ga0097621_100021820 Ga0097621_1000218202 192
160 3300006358 Ga0068871_100025613 Ga0068871_1000256133 192
161 3300006931 Ga0097620_100058701 Ga0097620_1000587013 192
162 3300009174 Ga0105241_10045483 Ga0105241_100454831 192
163 3300009177 Ga0105248_10085167 Ga0105248_100851672 192
164 3300010375 Ga0105239_10851499 Ga0105239_108514991 192
165 3300011119 Ga0105246_10021173 Ga0105246_100211732 192
166 3300013105 Ga0157369_10150651 Ga0157369_101506512 192
167 3300013296 Ga0157374_10014004 Ga0157374_100140045 192
168 3300013307 Ga0157372_10025975 Ga0157372_100259755 192
169 3300013307 Ga0157372_10103762 Ga0157372_101037622 192
170 3300013308 Ga0157375_10519589 Ga0157375_105195892 192
171 3300014325 Ga0163163_10018334 Ga0163163_100183345 192
172 3300014745 Ga0157377_10007481 Ga0157377_100074814 192
173 3300014968 Ga0157379_10300818 Ga0157379_103008181 192
174 3300014969 Ga0157376_10006141 Ga0157376_100061415 192
175 3300025903 Ga0207680_10432295 Ga0207680_104322952 192
176 3300025908 Ga0207643_10042633 Ga0207643_100426332 192
177 3300025911 Ga0207654_10083376 Ga0207654_100833761 192
178 3300025914 Ga0207671_10597923 Ga0207671_105979231 192
179 3300025919 Ga0207657_10092282 Ga0207657_100922822 192
180 3300025921 Ga0207652_10012631 Ga0207652_100126315 192
181 3300025923 Ga0207681_10155946 Ga0207681_101559461 192
182 3300025925 Ga0207650_10015995 Ga0207650_100159953 192
183 3300025926 Ga0207659_10005820 Ga0207659_100058205 192
184 3300025927 Ga0207687_10102250 Ga0207687_101022501 192
185 3300025931 Ga0207644_10592280 Ga0207644_105922801 192
186 3300025932 Ga0207690_10034933 Ga0207690_100349333 192
187 3300025933 Ga0207706_10412971 Ga0207706_104129712 192
188 3300025941 Ga0207711_10029973 Ga0207711_100299732 192
189 3300025942 Ga0207689_10002445 Ga0207689_100024454 192
190 3300025944 Ga0207661_10419015 Ga0207661_104190152 192
191 3300025945 Ga0207679_10012035 Ga0207679_100120354 192
192 3300026041 Ga0207639_10408317 Ga0207639_104083172 192
193 3300026095 Ga0207676_10037898 Ga0207676_100378981 192
194 3300026116 Ga0207674_10003313 Ga0207674_100033136 192
195 3300026121 Ga0207683_10188535 Ga0207683_101885352 192
196 3300026142 Ga0207698_10041829 Ga0207698_100418294 192
197 3300028381 Ga0268264_10194410 Ga0268264_101944102 192
198 3300045051 Ga0451576_1347146 Ga0451576_1347146_53_655 192
199 3300049823 Ga0501044_0342416 Ga0501044_0342416_511_1095 192
200 3300005290 Ga0065712_10160772 Ga0065712_101607722 193
201 3300005336 Ga0070680_100776488 Ga0070680_1007764881 193
202 3300005364 Ga0070673_100350608 Ga0070673_1003506082 193
203 3300005435 Ga0070714_100062369 Ga0070714_1000623692 193
204 3300005530 Ga0070679_100259181 Ga0070679_1002591812 193
205 3300014968 Ga0157379_10369859 Ga0157379_103698592 193
206 3300025912 Ga0207707_10226382 Ga0207707_102263822 193
207 3300031548 Ga0307408_100513816 Ga0307408_1005138162 193
208 3300031901 Ga0307406_10099256 Ga0307406_100992562 193
209 3300032002 Ga0307416_100198820 Ga0307416_1001988202 193
210 3300005367 Ga0070667_100014067 Ga0070667_1000140674 194
211 3300005548 Ga0070665_100000333 Ga0070665_10000033344 194
212 3300010375 Ga0105239_10134230 Ga0105239_101342304 194
213 3300025986 Ga0207658_10005424 Ga0207658_100054249 194
214 3300028379 Ga0268266_10000001 Ga0268266_10000001931 194
215 3300041456 Ga0451795_0663999 Ga0451795_0663999_126_743 194
216 3300048924 Ga0496121_0196226 Ga0496121_0196226_444_1061 194
217 3300048929 Ga0496126_0177501 Ga0496126_0177501_778_1395 194
218 3300053120 Ga0500597_000037 Ga0500597_000037_11282_11899 194
219 3300001990 JGI24737J22298_10017015 JGI24737J22298_100170152 195
220 3300002067 JGI24735J21928_10008326 JGI24735J21928_100083263 195
221 3300002705 JGI25156J39149_1005881 JGI25156J39149_10058813 195
222 3300002705 JGI25156J39149_1012856 JGI25156J39149_10128563 195
223 3300002737 JGI25162J39368_1000235 JGI25162J39368_100023517 195
224 3300002737 JGI25162J39368_1001269 JGI25162J39368_100126917 195
225 3300002737 JGI25162J39368_1002195 JGI25162J39368_10021959 195
226 3300002737 JGI25162J39368_1008750 JGI25162J39368_10087503 195
227 3300002741 JGI25157J39369_1000415 JGI25157J39369_100041511 195
228 3300002741 JGI25157J39369_1001439 JGI25157J39369_10014397 195
229 3300002741 JGI25157J39369_1001600 JGI25157J39369_10016009 195
230 3300002771 JGI25163J39215_1000768 JGI25163J39215_10007689 195
231 3300002772 JGI25164J39214_1000139 JGI25164J39214_100013920 195
232 3300002772 JGI25164J39214_1001075 JGI25164J39214_10010759 195
233 3300002772 JGI25164J39214_1001475 JGI25164J39214_10014751 195
234 3300002772 JGI25164J39214_1001631 JGI25164J39214_10016316 195
235 3300003214 JGI25165J46597_1000316 JGI25165J46597_100031620 195
236 3300003214 JGI25165J46597_1001043 JGI25165J46597_100104317 195
237 3300003214 JGI25165J46597_1001299 JGI25165J46597_100129917 195
238 3300003214 JGI25165J46597_1002371 JGI25165J46597_10023711 195
239 3300003316 rootH1_10041414 rootH1_100414143 195
240 3300003316 rootH1_10068308 rootH1_100683082 195
241 3300003751 Ga0055538_1002162 Ga0055538_10021623 195
242 3300003752 Ga0055539_1001607 Ga0055539_10016073 195
243 3300003756 Ga0055533_1003938 Ga0055533_10039383 195
244 3300003759 Ga0055525_1000178 Ga0055525_100017871 195
245 3300003760 Ga0055527_1000090 Ga0055527_100009020 195
246 3300003760 Ga0055527_1000100 Ga0055527_100010017 195
247 3300003761 Ga0055535_1000201 Ga0055535_100020131 195
248 3300003761 Ga0055535_1000456 Ga0055535_100045613 195
249 3300003761 Ga0055535_1000742 Ga0055535_10007423 195
250 3300003761 Ga0055535_1001175 Ga0055535_10011756 195
251 3300003761 Ga0055535_1001446 Ga0055535_10014463 195
252 3300003761 Ga0055535_1022041 Ga0055535_10220411 195
253 3300003762 Ga0055542_1000187 Ga0055542_100018746 195
254 3300003762 Ga0055542_1000191 Ga0055542_100019111 195
255 3300003762 Ga0055542_1000212 Ga0055542_100021230 195
256 3300003762 Ga0055542_1000236 Ga0055542_100023631 195
257 3300003762 Ga0055542_1000287 Ga0055542_100028713 195
258 3300003762 Ga0055542_1001002 Ga0055542_100100217 195
259 3300003763 Ga0055529_1000256 Ga0055529_100025631 195
260 3300003763 Ga0055529_1000259 Ga0055529_100025926 195
261 3300003763 Ga0055529_1000386 Ga0055529_100038625 195
262 3300003763 Ga0055529_1001324 Ga0055529_100132410 195
263 3300005327 Ga0070658_10001497 Ga0070658_1000149716 195
264 3300005334 Ga0068869_100035408 Ga0068869_1000354085 195
265 3300005334 Ga0068869_100168927 Ga0068869_1001689273 195
266 3300005335 Ga0070666_10000013 Ga0070666_10000013182 195
267 3300005335 Ga0070666_10002943 Ga0070666_100029437 195
268 3300005337 Ga0070682_100003692 Ga0070682_1000036927 195
269 3300005337 Ga0070682_100063155 Ga0070682_1000631552 195
270 3300005337 Ga0070682_100260995 Ga0070682_1002609952 195
271 3300005337 Ga0070682_100326442 Ga0070682_1003264422 195
272 3300005338 Ga0068868_100603892 Ga0068868_1006038922 195
273 3300005339 Ga0070660_100112186 Ga0070660_1001121861 195
274 3300005339 Ga0070660_100492422 Ga0070660_1004924221 195
275 3300005340 Ga0070689_100002814 Ga0070689_1000028148 195
276 3300005340 Ga0070689_100462536 Ga0070689_1004625361 195
277 3300005344 Ga0070661_100040860 Ga0070661_1000408603 195
278 3300005344 Ga0070661_100087838 Ga0070661_1000878383 195
279 3300005344 Ga0070661_100177642 Ga0070661_1001776423 195
280 3300005345 Ga0070692_10113658 Ga0070692_101136583 195
281 3300005347 Ga0070668_100007465 Ga0070668_1000074652 195
282 3300005347 Ga0070668_100058262 Ga0070668_1000582625 195
283 3300005347 Ga0070668_100121140 Ga0070668_1001211402 195
284 3300005353 Ga0070669_100290315 Ga0070669_1002903152 195
285 3300005354 Ga0070675_100761488 Ga0070675_1007614882 195
286 3300005356 Ga0070674_100357015 Ga0070674_1003570152 195
287 3300005364 Ga0070673_100030499 Ga0070673_1000304997 195
288 3300005366 Ga0070659_100003021 Ga0070659_1000030213 195
289 3300005366 Ga0070659_100020532 Ga0070659_1000205323 195
290 3300005366 Ga0070659_100082497 Ga0070659_1000824971 195
291 3300005366 Ga0070659_100904469 Ga0070659_1009044691 195
292 3300005367 Ga0070667_100088087 Ga0070667_1000880873 195
293 3300005367 Ga0070667_100166732 Ga0070667_1001667322 195
294 3300005435 Ga0070714_100000020 Ga0070714_10000002035 195
295 3300005435 Ga0070714_100003774 Ga0070714_1000037748 195
296 3300005439 Ga0070711_100135662 Ga0070711_1001356622 195
297 3300005444 Ga0070694_100099595 Ga0070694_1000995953 195
298 3300005455 Ga0070663_100006682 Ga0070663_1000066825 195
299 3300005455 Ga0070663_100241911 Ga0070663_1002419113 195
300 3300005455 Ga0070663_100267237 Ga0070663_1002672372 195
301 3300005456 Ga0070678_100013499 Ga0070678_1000134994 195
302 3300005456 Ga0070678_100103379 Ga0070678_1001033794 195
303 3300005457 Ga0070662_100002975 Ga0070662_10000297512 195
304 3300005457 Ga0070662_100051910 Ga0070662_1000519105 195
305 3300005458 Ga0070681_10010860 Ga0070681_100108602 195
306 3300005458 Ga0070681_10027397 Ga0070681_100273975 195
307 3300005458 Ga0070681_10037699 Ga0070681_100376993 195
308 3300005458 Ga0070681_10130039 Ga0070681_101300393 195
309 3300005466 Ga0070685_10000607 Ga0070685_1000060720 195
310 3300005530 Ga0070679_100153576 Ga0070679_1001535763 195
311 3300005535 Ga0070684_100532919 Ga0070684_1005329192 195
312 3300005539 Ga0068853_100006495 Ga0068853_1000064957 195
313 3300005539 Ga0068853_100176295 Ga0068853_1001762953 195
314 3300005539 Ga0068853_100225597 Ga0068853_1002255973 195
315 3300005539 Ga0068853_100752294 Ga0068853_1007522941 195
316 3300005543 Ga0070672_100011137 Ga0070672_1000111377 195
317 3300005543 Ga0070672_100027164 Ga0070672_1000271648 195
318 3300005546 Ga0070696_100001686 Ga0070696_1000016865 195
319 3300005546 Ga0070696_100004173 Ga0070696_10000417310 195
320 3300005547 Ga0070693_100004068 Ga0070693_1000040684 195
321 3300005547 Ga0070693_100030353 Ga0070693_1000303532 195
322 3300005547 Ga0070693_100189000 Ga0070693_1001890001 195
323 3300005547 Ga0070693_100410837 Ga0070693_1004108372 195
324 3300005548 Ga0070665_100000618 Ga0070665_10000061838 195
325 3300005548 Ga0070665_100032263 Ga0070665_1000322632 195
326 3300005548 Ga0070665_100136571 Ga0070665_1001365713 195
327 3300005563 Ga0068855_100054444 Ga0068855_1000544445 195
328 3300005563 Ga0068855_100073447 Ga0068855_1000734472 195
329 3300005563 Ga0068855_100399273 Ga0068855_1003992733 195
330 3300005577 Ga0068857_100030513 Ga0068857_1000305137 195
331 3300005577 Ga0068857_100147750 Ga0068857_1001477503 195
332 3300005577 Ga0068857_100251681 Ga0068857_1002516812 195
333 3300005578 Ga0068854_100054124 Ga0068854_1000541242 195
334 3300005614 Ga0068856_100042321 Ga0068856_1000423214 195
335 3300005614 Ga0068856_100046743 Ga0068856_1000467435 195
336 3300005614 Ga0068856_100118837 Ga0068856_1001188372 195
337 3300005616 Ga0068852_100554688 Ga0068852_1005546882 195
338 3300005617 Ga0068859_100037834 Ga0068859_1000378345 195
339 3300005617 Ga0068859_100233305 Ga0068859_1002333052 195
340 3300005618 Ga0068864_101325375 Ga0068864_1013253751 195
341 3300005834 Ga0068851_10000591 Ga0068851_100005915 195
342 3300005840 Ga0068870_10247110 Ga0068870_102471101 195
343 3300005841 Ga0068863_100061756 Ga0068863_1000617562 195
344 3300005841 Ga0068863_100475107 Ga0068863_1004751072 195
345 3300005842 Ga0068858_100002640 Ga0068858_10000264015 195
346 3300005843 Ga0068860_100105639 Ga0068860_1001056395 195
347 3300005843 Ga0068860_100219453 Ga0068860_1002194532 195
348 3300005844 Ga0068862_100086124 Ga0068862_1000861243 195
349 3300005983 Ga0081540_1001157 Ga0081540_10011574 195
350 3300006175 Ga0070712_100226029 Ga0070712_1002260291 195
351 3300006237 Ga0097621_100046457 Ga0097621_1000464575 195
352 3300006237 Ga0097621_100064745 Ga0097621_1000647455 195
353 3300006237 Ga0097621_100553744 Ga0097621_1005537442 195
354 3300006358 Ga0068871_100810254 Ga0068871_1008102541 195
355 3300006871 Ga0075434_100628080 Ga0075434_1006280802 195
356 3300006881 Ga0068865_100184551 Ga0068865_1001845512 195
357 3300006881 Ga0068865_100220363 Ga0068865_1002203632 195
358 3300006931 Ga0097620_100037832 Ga0097620_1000378323 195
359 3300006931 Ga0097620_100233306 Ga0097620_1002333062 195
360 3300009093 Ga0105240_10013854 Ga0105240_1001385413 195
361 3300009093 Ga0105240_10103634 Ga0105240_101036343 195
362 3300009093 Ga0105240_10173549 Ga0105240_101735493 195
363 3300009093 Ga0105240_10388762 Ga0105240_103887622 195
364 3300009098 Ga0105245_11081389 Ga0105245_110813892 195
365 3300009174 Ga0105241_10098624 Ga0105241_100986243 195
366 3300009174 Ga0105241_10463809 Ga0105241_104638092 195
367 3300009176 Ga0105242_10128828 Ga0105242_101288282 195
368 3300009176 Ga0105242_10196201 Ga0105242_101962013 195
369 3300009177 Ga0105248_10148079 Ga0105248_101480795 195
370 3300009177 Ga0105248_11199044 Ga0105248_111990442 195
371 3300009545 Ga0105237_10025886 Ga0105237_100258862 195
372 3300009545 Ga0105237_10035711 Ga0105237_100357111 195
373 3300009545 Ga0105237_10074364 Ga0105237_100743643 195
374 3300009551 Ga0105238_10000131 Ga0105238_1000013123 195
375 3300009551 Ga0105238_10005675 Ga0105238_100056755 195
376 3300009551 Ga0105238_10011550 Ga0105238_100115503 195
377 3300009551 Ga0105238_10019359 Ga0105238_100193595 195
378 3300009551 Ga0105238_10031956 Ga0105238_100319564 195
379 3300009551 Ga0105238_10068568 Ga0105238_100685682 195
380 3300009551 Ga0105238_10626982 Ga0105238_106269821 195
381 3300010375 Ga0105239_10012447 Ga0105239_100124476 195
382 3300010375 Ga0105239_10061214 Ga0105239_100612145 195
383 3300010375 Ga0105239_10259430 Ga0105239_102594302 195
384 3300012502 Ga0157347_1004129 Ga0157347_10041292 195
385 3300013100 Ga0157373_10010449 Ga0157373_100104497 195
386 3300013100 Ga0157373_10167985 Ga0157373_101679851 195
387 3300013102 Ga0157371_10009406 Ga0157371_100094063 195
388 3300013104 Ga0157370_10005515 Ga0157370_100055154 195
389 3300013104 Ga0157370_10011083 Ga0157370_1001108310 195
390 3300013104 Ga0157370_10036580 Ga0157370_100365805 195
391 3300013104 Ga0157370_10534889 Ga0157370_105348891 195
392 3300013105 Ga0157369_10000114 Ga0157369_1000011440 195
393 3300013105 Ga0157369_10357155 Ga0157369_103571552 195
394 3300013105 Ga0157369_10761042 Ga0157369_107610422 195
395 3300013296 Ga0157374_10211096 Ga0157374_102110962 195
396 3300013297 Ga0157378_10000322 Ga0157378_1000032221 195
397 3300013297 Ga0157378_10026771 Ga0157378_100267714 195
398 3300013306 Ga0163162_10043365 Ga0163162_100433655 195
399 3300013306 Ga0163162_10080175 Ga0163162_100801753 195
400 3300013306 Ga0163162_10098108 Ga0163162_100981084 195
401 3300013306 Ga0163162_10420958 Ga0163162_104209582 195
402 3300013307 Ga0157372_10032948 Ga0157372_100329482 195
403 3300013307 Ga0157372_10249727 Ga0157372_102497273 195
404 3300013307 Ga0157372_10414469 Ga0157372_104144692 195
405 3300013307 Ga0157372_11054734 Ga0157372_110547342 195
406 3300013308 Ga0157375_10000459 Ga0157375_100004599 195
407 3300013308 Ga0157375_10035389 Ga0157375_100353896 195
408 3300013308 Ga0157375_10212061 Ga0157375_102120612 195
409 3300013308 Ga0157375_11235122 Ga0157375_112351222 195
410 3300014969 Ga0157376_10001958 Ga0157376_1000195811 195
411 3300014969 Ga0157376_10045401 Ga0157376_100454015 195
412 3300014969 Ga0157376_10050961 Ga0157376_100509615 195
413 3300015261 Ga0182006_1003066 Ga0182006_10030669 195
414 3300015261 Ga0182006_1143667 Ga0182006_11436671 195
415 3300015262 Ga0182007_10019186 Ga0182007_100191862 195
416 3300015265 Ga0182005_1035578 Ga0182005_10355782 195
417 3300015685 Ga0183369_1003 Ga0183369_1003284 195
418 3300015687 Ga0183368_1003 Ga0183368_1003448 195
419 3300025206 Ga0209435_104489 Ga0209435_1044892 195
420 3300025207 Ga0209760_100541 Ga0209760_1005419 195
421 3300025224 Ga0209784_100422 Ga0209784_10042217 195
422 3300025225 Ga0209566_101312 Ga0209566_1013127 195
423 3300025226 Ga0209674_100012 Ga0209674_100012191 195
424 3300025226 Ga0209674_100140 Ga0209674_10014076 195
425 3300025226 Ga0209674_100373 Ga0209674_10037318 195
426 3300025228 Ga0209672_100005 Ga0209672_100005442 195
427 3300025228 Ga0209672_100016 Ga0209672_100016108 195
428 3300025228 Ga0209672_100141 Ga0209672_10014115 195
429 3300025228 Ga0209672_101550 Ga0209672_1015505 195
430 3300025230 Ga0209563_100023 Ga0209563_10002398 195
431 3300025231 Ga0207427_100057 Ga0207427_10005792 195
432 3300025231 Ga0207427_100111 Ga0207427_10011153 195
433 3300025231 Ga0207427_100179 Ga0207427_10017958 195
434 3300025231 Ga0207427_100443 Ga0207427_10044311 195
435 3300025231 Ga0207427_101239 Ga0207427_10123910 195
436 3300025233 Ga0209437_100099 Ga0209437_10009989 195
437 3300025233 Ga0209437_100184 Ga0209437_10018492 195
438 3300025233 Ga0209437_100270 Ga0209437_10027048 195
439 3300025233 Ga0209437_100878 Ga0209437_1008786 195
440 3300025233 Ga0209437_102084 Ga0209437_1020842 195
441 3300025242 Ga0209258_100006 Ga0209258_100006442 195
442 3300025242 Ga0209258_100012 Ga0209258_100012249 195
443 3300025242 Ga0209258_100119 Ga0209258_10011959 195
444 3300025242 Ga0209258_100316 Ga0209258_10031611 195
445 3300025242 Ga0209258_100509 Ga0209258_10050920 195
446 3300025242 Ga0209258_101510 Ga0209258_1015108 195
447 3300025246 Ga0209646_1000487 Ga0209646_100048717 195
448 3300025246 Ga0209646_1001182 Ga0209646_10011829 195
449 3300025246 Ga0209646_1021838 Ga0209646_10218381 195
450 3300025250 Ga0209026_1000117 Ga0209026_100011732 195
451 3300025250 Ga0209026_1000276 Ga0209026_10002763 195
452 3300025250 Ga0209026_1000414 Ga0209026_100041412 195
453 3300025250 Ga0209026_1003387 Ga0209026_10033873 195
454 3300025253 Ga0209677_105076 Ga0209677_1050762 195
455 3300025254 Ga0209148_1000005 Ga0209148_10000051273 195
456 3300025254 Ga0209148_1000012 Ga0209148_1000012442 195
457 3300025254 Ga0209148_1000014 Ga0209148_1000014406 195
458 3300025254 Ga0209148_1000036 Ga0209148_1000036358 195
459 3300025254 Ga0209148_1000201 Ga0209148_100020166 195
460 3300025254 Ga0209148_1000244 Ga0209148_100024411 195
461 3300025256 Ga0209759_1000134 Ga0209759_100013491 195
462 3300025256 Ga0209759_1002336 Ga0209759_100233610 195
463 3300025256 Ga0209759_1002497 Ga0209759_10024979 195
464 3300025261 Ga0209233_1000040 Ga0209233_1000040356 195
465 3300025261 Ga0209233_1000063 Ga0209233_100006358 195
466 3300025261 Ga0209233_1000075 Ga0209233_100007531 195
467 3300025261 Ga0209233_1000077 Ga0209233_100007718 195
468 3300025261 Ga0209233_1001156 Ga0209233_10011568 195
469 3300025272 Ga0209455_1000008 Ga0209455_1000008442 195
470 3300025272 Ga0209455_1000014 Ga0209455_1000014294 195
471 3300025272 Ga0209455_1000018 Ga0209455_1000018411 195
472 3300025272 Ga0209455_1000164 Ga0209455_100016489 195
473 3300025299 Ga0209256_1002977 Ga0209256_10029772 195
474 3300025321 Ga0207656_10000662 Ga0207656_100006624 195
475 3300025903 Ga0207680_10000001 Ga0207680_10000001265 195
476 3300025903 Ga0207680_10000218 Ga0207680_1000021813 195
477 3300025903 Ga0207680_10004422 Ga0207680_100044222 195
478 3300025904 Ga0207647_10000286 Ga0207647_100002865 195
479 3300025904 Ga0207647_10022283 Ga0207647_100222836 195
480 3300025904 Ga0207647_10052007 Ga0207647_100520074 195
481 3300025908 Ga0207643_10020147 Ga0207643_100201474 195
482 3300025909 Ga0207705_10052373 Ga0207705_100523732 195
483 3300025912 Ga0207707_10013069 Ga0207707_100130694 195
484 3300025912 Ga0207707_10044862 Ga0207707_100448624 195
485 3300025912 Ga0207707_10072979 Ga0207707_100729792 195
486 3300025912 Ga0207707_10158750 Ga0207707_101587502 195
487 3300025913 Ga0207695_10000014 Ga0207695_10000014297 195
488 3300025913 Ga0207695_10007050 Ga0207695_100070504 195
489 3300025913 Ga0207695_10024339 Ga0207695_100243392 195
490 3300025913 Ga0207695_10065042 Ga0207695_100650424 195
491 3300025914 Ga0207671_10003776 Ga0207671_100037764 195
492 3300025914 Ga0207671_10016470 Ga0207671_100164705 195
493 3300025914 Ga0207671_10099109 Ga0207671_100991094 195
494 3300025914 Ga0207671_10342910 Ga0207671_103429101 195
495 3300025915 Ga0207693_10133123 Ga0207693_101331232 195
496 3300025916 Ga0207663_10086979 Ga0207663_100869793 195
497 3300025917 Ga0207660_10020818 Ga0207660_100208184 195
498 3300025917 Ga0207660_10049914 Ga0207660_100499144 195
499 3300025919 Ga0207657_10058102 Ga0207657_100581022 195
500 3300025919 Ga0207657_10078070 Ga0207657_100780703 195
501 3300025919 Ga0207657_10320578 Ga0207657_103205783 195
502 3300025919 Ga0207657_10698704 Ga0207657_106987041 195
503 3300025920 Ga0207649_10269666 Ga0207649_102696662 195
504 3300025921 Ga0207652_10041141 Ga0207652_100411412 195
505 3300025924 Ga0207694_10000168 Ga0207694_1000016818 195
506 3300025924 Ga0207694_10001142 Ga0207694_1000114210 195
507 3300025924 Ga0207694_10001700 Ga0207694_100017009 195
508 3300025924 Ga0207694_10003489 Ga0207694_100034898 195
509 3300025924 Ga0207694_10007373 Ga0207694_100073737 195
510 3300025924 Ga0207694_10040507 Ga0207694_100405072 195
511 3300025924 Ga0207694_10132569 Ga0207694_101325692 195
512 3300025925 Ga0207650_10169000 Ga0207650_101690002 195
513 3300025926 Ga0207659_10082244 Ga0207659_100822443 195
514 3300025927 Ga0207687_10561367 Ga0207687_105613672 195
515 3300025929 Ga0207664_10000023 Ga0207664_1000002369 195
516 3300025929 Ga0207664_10000200 Ga0207664_1000020021 195
517 3300025932 Ga0207690_10000138 Ga0207690_100001388 195
518 3300025932 Ga0207690_10003322 Ga0207690_100033223 195
519 3300025932 Ga0207690_10005588 Ga0207690_100055889 195
520 3300025932 Ga0207690_10009214 Ga0207690_100092149 195
521 3300025932 Ga0207690_10108188 Ga0207690_101081882 195
522 3300025933 Ga0207706_10002151 Ga0207706_1000215115 195
523 3300025933 Ga0207706_10047647 Ga0207706_100476474 195
524 3300025933 Ga0207706_10200878 Ga0207706_102008782 195
525 3300025934 Ga0207686_10187852 Ga0207686_101878522 195
526 3300025934 Ga0207686_10266529 Ga0207686_102665291 195
527 3300025936 Ga0207670_10000951 Ga0207670_1000095110 195
528 3300025936 Ga0207670_10164471 Ga0207670_101644712 195
529 3300025937 Ga0207669_10035252 Ga0207669_100352522 195
530 3300025937 Ga0207669_10486030 Ga0207669_104860302 195
531 3300025938 Ga0207704_10006533 Ga0207704_100065335 195
532 3300025938 Ga0207704_10086008 Ga0207704_100860083 195
533 3300025938 Ga0207704_10204616 Ga0207704_102046164 195
534 3300025938 Ga0207704_10238285 Ga0207704_102382852 195
535 3300025939 Ga0207665_10655675 Ga0207665_106556752 195
536 3300025940 Ga0207691_10033892 Ga0207691_100338924 195
537 3300025940 Ga0207691_10057932 Ga0207691_100579322 195
538 3300025942 Ga0207689_10021229 Ga0207689_1002122910 195
539 3300025942 Ga0207689_10169566 Ga0207689_101695662 195
540 3300025949 Ga0207667_10008241 Ga0207667_1000824112 195
541 3300025949 Ga0207667_10028030 Ga0207667_100280309 195
542 3300025960 Ga0207651_10055094 Ga0207651_100550943 195
543 3300025961 Ga0207712_10000745 Ga0207712_1000074519 195
544 3300025961 Ga0207712_10128984 Ga0207712_101289843 195
545 3300025972 Ga0207668_10037848 Ga0207668_100378483 195
546 3300025972 Ga0207668_10057888 Ga0207668_100578884 195
547 3300025972 Ga0207668_10266936 Ga0207668_102669362 195
548 3300025972 Ga0207668_10336924 Ga0207668_103369242 195
549 3300025981 Ga0207640_10004096 Ga0207640_100040966 195
550 3300025986 Ga0207658_10119922 Ga0207658_101199222 195
551 3300025986 Ga0207658_10186657 Ga0207658_101866572 195
552 3300025986 Ga0207658_10464365 Ga0207658_104643652 195
553 3300026035 Ga0207703_10002027 Ga0207703_1000202715 195
554 3300026035 Ga0207703_10597880 Ga0207703_105978802 195
555 3300026035 Ga0207703_10742087 Ga0207703_107420871 195
556 3300026041 Ga0207639_10004144 Ga0207639_100041445 195
557 3300026041 Ga0207639_10015812 Ga0207639_100158127 195
558 3300026041 Ga0207639_10148530 Ga0207639_101485303 195
559 3300026041 Ga0207639_10190980 Ga0207639_101909802 195
560 3300026041 Ga0207639_10448272 Ga0207639_104482722 195
561 3300026067 Ga0207678_10005813 Ga0207678_1000581310 195
562 3300026067 Ga0207678_10070555 Ga0207678_100705553 195
563 3300026067 Ga0207678_10195785 Ga0207678_101957852 195
564 3300026067 Ga0207678_10285600 Ga0207678_102856002 195
565 3300026067 Ga0207678_10800903 Ga0207678_108009031 195
566 3300026078 Ga0207702_10001815 Ga0207702_100018155 195
567 3300026088 Ga0207641_10235681 Ga0207641_102356812 195
568 3300026088 Ga0207641_10596934 Ga0207641_105969341 195
569 3300026088 Ga0207641_10733722 Ga0207641_107337222 195
570 3300026089 Ga0207648_10009668 Ga0207648_100096681 195
571 3300026089 Ga0207648_10605728 Ga0207648_106057282 195
572 3300026095 Ga0207676_11244773 Ga0207676_112447732 195
573 3300026116 Ga0207674_10030465 Ga0207674_100304657 195
574 3300026116 Ga0207674_10231844 Ga0207674_102318443 195
575 3300026116 Ga0207674_10285092 Ga0207674_102850923 195
576 3300026118 Ga0207675_100514386 Ga0207675_1005143861 195
577 3300026121 Ga0207683_10004646 Ga0207683_100046469 195
578 3300026121 Ga0207683_10008124 Ga0207683_100081248 195
579 3300026121 Ga0207683_10010121 Ga0207683_100101213 195
580 3300026121 Ga0207683_10680241 Ga0207683_106802412 195
581 3300028379 Ga0268266_10000013 Ga0268266_1000001391 195
582 3300028379 Ga0268266_10000075 Ga0268266_100000758 195
583 3300028380 Ga0268265_10297999 Ga0268265_102979992 195
584 3300028381 Ga0268264_10079476 Ga0268264_100794765 195
585 3300028786 Ga0307517_10154980 Ga0307517_101549802 195
586 3300033180 Ga0307510_10002367 Ga0307510_1000236714 195
587 3300033180 Ga0307510_10043003 Ga0307510_100430035 195
588 3300037312 Ga0395899_0000089 Ga0395899_0000089_122099_122686 195
589 3300037312 Ga0395899_0012531 Ga0395899_0012531_2344_2931 195
590 3300037312 Ga0395899_0147439 Ga0395899_0147439_979_1566 195
591 3300037312 Ga0395899_0177970 Ga0395899_0177970_753_1373 195
592 3300037312 Ga0395899_0236952 Ga0395899_0236952_19_606 195
593 3300037312 Ga0395899_0274215 Ga0395899_0274215_178_798 195
594 3300037418 Ga0395900_0000029 Ga0395900_0000029_205196_205783 195
595 3300037418 Ga0395900_0000651 Ga0395900_0000651_19965_20552 195
596 3300037418 Ga0395900_0007702 Ga0395900_0007702_3398_4018 195
597 3300037418 Ga0395900_0076239 Ga0395900_0076239_2017_2604 195
598 3300037418 Ga0395900_0092578 Ga0395900_0092578_1758_2345 195
599 3300037466 Ga0395898_0000018 Ga0395898_0000018_88691_89278 195
600 3300037466 Ga0395898_0000241 Ga0395898_0000241_110592_111179 195
601 3300037466 Ga0395898_0004579 Ga0395898_0004579_13898_14485 195
602 3300037466 Ga0395898_0029429 Ga0395898_0029429_4143_4763 195
603 3300037466 Ga0395898_0042982 Ga0395898_0042982_3610_4197 195
604 3300037466 Ga0395898_0111996 Ga0395898_0111996_778_1398 195
605 3300038443 Ga0395901_0000873 Ga0395901_0000873_14243_14830 195
606 3300038443 Ga0395901_0003835 Ga0395901_0003835_9250_9837 195
607 3300038443 Ga0395901_0021565 Ga0395901_0021565_4384_5004 195
608 3300038443 Ga0395901_0062534 Ga0395901_0062534_2017_2604 195
609 3300038443 Ga0395901_0273491 Ga0395901_0273491_189_809 195
610 3300038443 Ga0395901_0470476 Ga0395901_0470476_526_1113 195
611 3300041486 Ga0451807_2321265 Ga0451807_2321265_578_1168 195
612 3300042438 Ga0439459_0007326 Ga0439459_0007326_248_835 195
613 3300044656 Ga0466969_0006829 Ga0466969_0006829_3172_3759 195
614 3300044658 Ga0466972_0001275 Ga0466972_0001275_10925_11548 195
615 3300044683 Ga0466965_0044614 Ga0466965_0044614_943_1530 195
616 3300044684 Ga0466966_0045989 Ga0466966_0045989_1179_1766 195
617 3300044693 Ga0466961_0000345 Ga0466961_0000345_4786_5373 195
618 3300044693 Ga0466961_0004106 Ga0466961_0004106_4681_5268 195
619 3300044693 Ga0466961_0005564 Ga0466961_0005564_4738_5325 195
620 3300044693 Ga0466961_0012072 Ga0466961_0012072_140_727 195
621 3300044693 Ga0466961_0320382 Ga0466961_0320382_79_666 195
622 3300044694 Ga0466963_0202335 Ga0466963_0202335_530_1117 195
623 3300044719 Ga0466971_0012327 Ga0466971_0012327_2899_3486 195
624 3300044719 Ga0466971_0060637 Ga0466971_0060637_22_609 195
625 3300044765 Ga0466970_0008454 Ga0466970_0008454_504_1127 195
626 3300044765 Ga0466970_0014316 Ga0466970_0014316_3343_3930 195
627 3300044765 Ga0466970_0099205 Ga0466970_0099205_860_1447 195
628 3300044842 Ga0466957_0017384 Ga0466957_0017384_276_863 195
629 3300044842 Ga0466957_0090235 Ga0466957_0090235_865_1452 195
630 3300044842 Ga0466957_0271070 Ga0466957_0271070_274_894 195
631 3300045049 Ga0466959_0000148 Ga0466959_0000148_38923_39510 195
632 3300045049 Ga0466959_0002116 Ga0466959_0002116_10204_10791 195
633 3300045049 Ga0466959_0028465 Ga0466959_0028465_2509_3096 195
634 3300045049 Ga0466959_0109786 Ga0466959_0109786_527_1114 195
635 3300045049 Ga0466959_0128582 Ga0466959_0128582_365_985 195
636 3300045049 Ga0466959_0130936 Ga0466959_0130936_183_770 195
637 3300045836 Ga0466958_0006082 Ga0466958_0006082_3720_4307 195
638 3300045836 Ga0466958_0008710 Ga0466958_0008710_2429_3016 195
639 3300045836 Ga0466958_0079594 Ga0466958_0079594_80_667 195
640 3300045836 Ga0466958_0215517 Ga0466958_0215517_297_884 195
641 3300045836 Ga0466958_0409055 Ga0466958_0409055_59_646 195
642 3300045976 Ga0466967_0104957 Ga0466967_0104957_1698_2285 195
643 3300046460 Ga0495638_0001233 Ga0495638_0001233_14974_15561 195
644 3300046471 Ga0495650_0000350 Ga0495650_0000350_4234_4821 195
645 3300046507 Ga0495606_0000016 Ga0495606_0000016_169122_169709 195
646 3300046694 Ga0495649_0000228 Ga0495649_0000228_44591_45178 195
647 3300048904 Ga0496101_0973981 Ga0496101_0973981_44_631 195
648 3300048907 Ga0496104_0000041 Ga0496104_0000041_38458_39057 195
649 3300048908 Ga0496105_0000022 Ga0496105_0000022_38318_38917 195
650 3300048908 Ga0496105_0177054 Ga0496105_0177054_898_1485 195
651 3300048916 Ga0496113_0022532 Ga0496113_0022532_3397_3984 195
652 3300048917 Ga0496114_0084714 Ga0496114_0084714_1315_1902 195
653 3300048918 Ga0496115_0000114 Ga0496115_0000114_41223_41810 195
654 3300048918 Ga0496115_0002199 Ga0496115_0002199_5880_6467 195
655 3300048918 Ga0496115_0015302 Ga0496115_0015302_1608_2195 195
656 3300048921 Ga0496118_0000264 Ga0496118_0000264_63799_64419 195
657 3300048924 Ga0496121_0039863 Ga0496121_0039863_2023_2610 195
658 3300048924 Ga0496121_0122684 Ga0496121_0122684_478_1065 195
659 3300048928 Ga0496125_0000604 Ga0496125_0000604_49843_50463 195
660 3300048928 Ga0496125_0083196 Ga0496125_0083196_1035_1622 195
661 3300048929 Ga0496126_0005938 Ga0496126_0005938_6677_7264 195
662 3300048929 Ga0496126_0015681 Ga0496126_0015681_1722_2309 195
663 3300048929 Ga0496126_0024412 Ga0496126_0024412_1369_1956 195
664 3300049459 Ga0495678_038190 Ga0495678_038190_528_1115 195
665 3300049459 Ga0495678_165713 Ga0495678_165713_94_681 195
666 3300049568 Ga0501031_0125479 Ga0501031_0125479_149_736 195
667 3300049569 Ga0501032_0051863 Ga0501032_0051863_653_1273 195
668 3300049569 Ga0501032_0077225 Ga0501032_0077225_279_866 195
669 3300049570 Ga0501033_0011789 Ga0501033_0011789_1993_2580 195
670 3300049570 Ga0501033_0264150 Ga0501033_0264150_438_1025 195
671 3300049571 Ga0501034_0007995 Ga0501034_0007995_10537_11154 195
672 3300049571 Ga0501034_0010146 Ga0501034_0010146_82_669 195
673 3300049571 Ga0501034_0255425 Ga0501034_0255425_581_1168 195
674 3300049572 Ga0501036_0019161 Ga0501036_0019161_1815_2402 195
675 3300049572 Ga0501036_0079512 Ga0501036_0079512_1086_1706 195
676 3300049572 Ga0501036_0093793 Ga0501036_0093793_1385_1972 195
677 3300049572 Ga0501036_0528735 Ga0501036_0528735_203_820 195
678 3300049573 Ga0501037_0008152 Ga0501037_0008152_4124_4741 195
679 3300049573 Ga0501037_0009429 Ga0501037_0009429_5891_6478 195
680 3300049573 Ga0501037_0132063 Ga0501037_0132063_455_1042 195
681 3300049573 Ga0501037_0401833 Ga0501037_0401833_56_643 195
682 3300049573 Ga0501037_0448278 Ga0501037_0448278_34_621 195
683 3300049573 Ga0501037_0538030 Ga0501037_0538030_102_689 195
684 3300049574 Ga0501038_0000645 Ga0501038_0000645_2597_3214 195
685 3300049574 Ga0501038_0140085 Ga0501038_0140085_714_1301 195
686 3300049574 Ga0501038_0342571 Ga0501038_0342571_538_1125 195
687 3300049574 Ga0501038_0401927 Ga0501038_0401927_245_832 195
688 3300049575 Ga0501039_0077980 Ga0501039_0077980_1041_1628 195
689 3300049575 Ga0501039_0156809 Ga0501039_0156809_231_818 195
690 3300049575 Ga0501039_0175257 Ga0501039_0175257_747_1364 195
691 3300049578 Ga0501042_0127555 Ga0501042_0127555_1032_1619 195
692 3300049579 Ga0501043_0016067 Ga0501043_0016067_4506_5123 195
693 3300049579 Ga0501043_0045728 Ga0501043_0045728_204_791 195
694 3300049579 Ga0501043_0091025 Ga0501043_0091025_1705_2292 195
695 3300049579 Ga0501043_0158767 Ga0501043_0158767_1012_1599 195
696 3300049579 Ga0501043_0176790 Ga0501043_0176790_486_1073 195
697 3300049580 Ga0501046_0011217 Ga0501046_0011217_494_1081 195
698 3300049580 Ga0501046_0046919 Ga0501046_0046919_2602_3219 195
699 3300049580 Ga0501046_0143055 Ga0501046_0143055_529_1116 195
700 3300049580 Ga0501046_0397947 Ga0501046_0397947_12_695 195
701 3300049581 Ga0501047_0041830 Ga0501047_0041830_3679_4362 195
702 3300049581 Ga0501047_0074836 Ga0501047_0074836_510_1193 195
703 3300049581 Ga0501047_0163581 Ga0501047_0163581_39_659 195
704 3300049581 Ga0501047_0195408 Ga0501047_0195408_231_818 195
705 3300049581 Ga0501047_0227329 Ga0501047_0227329_686_1303 195
706 3300049581 Ga0501047_0541774 Ga0501047_0541774_231_818 195
707 3300049582 Ga0501048_0045725 Ga0501048_0045725_2079_2666 195
708 3300049582 Ga0501048_0070554 Ga0501048_0070554_907_1494 195
709 3300049582 Ga0501048_0710439 Ga0501048_0710439_125_712 195
710 3300049584 Ga0501068_0044775 Ga0501068_0044775_65_682 195
711 3300049586 Ga0501070_0052824 Ga0501070_0052824_1026_1613 195
712 3300049586 Ga0501070_0122601 Ga0501070_0122601_158_775 195
713 3300049587 Ga0501071_0304687 Ga0501071_0304687_372_989 195
714 3300049589 Ga0501073_0041674 Ga0501073_0041674_1102_1689 195
715 3300049589 Ga0501073_0083883 Ga0501073_0083883_453_1070 195
716 3300049589 Ga0501073_0084864 Ga0501073_0084864_211_828 195
717 3300049590 Ga0501074_0313423 Ga0501074_0313423_405_992 195
718 3300049741 Ga0501079_0415993 Ga0501079_0415993_91_678 195
719 3300049742 Ga0501080_0026675 Ga0501080_0026675_2062_2679 195
720 3300049742 Ga0501080_0060795 Ga0501080_0060795_1497_2117 195
721 3300049742 Ga0501080_0233258 Ga0501080_0233258_472_1059 195
722 3300049822 Ga0501035_0035859 Ga0501035_0035859_2057_2644 195
723 3300049822 Ga0501035_0047260 Ga0501035_0047260_1587_2204 195
724 3300049822 Ga0501035_0048891 Ga0501035_0048891_3116_3703 195
725 3300049822 Ga0501035_0052939 Ga0501035_0052939_1956_2543 195
726 3300049822 Ga0501035_0111969 Ga0501035_0111969_688_1275 195
727 3300049822 Ga0501035_0167333 Ga0501035_0167333_34_621 195
728 3300049822 Ga0501035_0191640 Ga0501035_0191640_488_1105 195
729 3300049822 Ga0501035_0226084 Ga0501035_0226084_324_911 195
730 3300049822 Ga0501035_0439685 Ga0501035_0439685_413_1000 195
731 3300049822 Ga0501035_0652078 Ga0501035_0652078_111_698 195
732 3300049823 Ga0501044_0022729 Ga0501044_0022729_5427_6014 195
733 3300049823 Ga0501044_0030494 Ga0501044_0030494_4022_4639 195
734 3300049823 Ga0501044_0093702 Ga0501044_0093702_367_954 195
735 3300049823 Ga0501044_0221312 Ga0501044_0221312_1047_1634 195
736 3300049823 Ga0501044_0284672 Ga0501044_0284672_39_626 195
737 3300049823 Ga0501044_0367726 Ga0501044_0367726_467_1087 195
738 3300049823 Ga0501044_0637572 Ga0501044_0637572_200_787 195
739 3300053090 Ga0500646_0007243 Ga0500646_0007243_1032_1619 195
740 3300053120 Ga0500597_161391 Ga0500597_161391_97_720 195
741 3300060353 Ga0501082_0110921 Ga0501082_0110921_1494_2111 195
742 3300061719 Ga0466962_0030288 Ga0466962_0030288_1311_1898 195
743 iso_pu_bacteria 2643221562 2643829401 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

187

227

0.98

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

48

134

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hmx-assembly1.cif.gz_A crystal structure of phzg from burkholderia lata 383 in complex with tetrahydrophenazine-1-carboxylic acid 0.9432 7 195
1t9m-assembly1.cif.gz_B x-ray crystal structure of phzg from pseudomonas aeruginosa 0.9359 7 195
4hmt-assembly1.cif.gz_B crystal structure of phzg from pseudomonas fluorescens 2-79 in complex with hexahydrophenazine-1,6-dicarboxylic acid 0.9304 7 195
1nrg-assembly1.cif.gz_A-2 structure and properties of recombinant human pyridoxine-5'-phosphate oxidase 0.9286 8 195
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9204 2 195
ID Description Score Start End Superfamily
4hmxA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9432 7 195 2.30.110.10
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9394 2 184 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9392 2 195 2.30.110.10
4hmtB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9304 7 195 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9209 2 145 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A0H2X535-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9809 5 116 GO:0004733
GO:0008615
GO:0010181
AF-A0A7K2MJX4-F1-model_v4 Oxidase 0.9714 7 102 GO:0004733
GO:0008615
GO:0010181
AF-A0A7Z9IK15-F1-model_v4 Pyridoxal 5'-phosphate synthase (EC 1.4.3.5) 0.9699 8 118 GO:0004733
GO:0008615
GO:0010181
AF-T0ZGX9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.967 1 171 GO:0004733
GO:0008615
GO:0010181
AF-A0A0N5A5Q2-F1-model_v4 pyridoxal 5'-phosphate synthase (EC 1.4.3.5) 0.9669 4 98 GO:0004733
GO:0008615
GO:0010181

Feature Viewer

pLDDT pTM Quality
95.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map