F478687

General Info

Members Datasets Scaffolds Average Seq Length
743 349 740 88

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10006209|Ga0213876_100062095
Length 100
Sequence MPAYPLGVSQVVGIVMLVIWIAILVMAVYAFVHAAMQRPDAYTAADKLTKPVWLVILGAAVALNAVRVFGVLGMAIAACAAGVYLVDVRPKLLEIQGKSR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
340 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.8
Nodule 0
Rhizoplane 8.21
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC29203_g1 2010549000 Bacteria 541
2 JGI24746J21847_1064679 3300001977 Bacteria 526
3 JGI24739J22299_10105663 3300001989 Bacteria 847
4 JGI24737J22298_10039093 3300001990 Bacteria 1459
5 JGI24737J22298_10076471 3300001990 Bacteria 998
6 JGI24743J22301_10060984 3300001991 Bacteria 777
7 JGI24743J22301_10069475 3300001991 Bacteria 734
8 JGI24750J21931_1024546 3300002070 Bacteria 860
9 JGI24750J21931_1028678 3300002070 Bacteria 809
10 JGI24745J21846_1006210 3300002073 Bacteria 1320
11 JGI24748J21848_1012428 3300002074 Bacteria 1004
12 JGI24738J21930_10118491 3300002075 Bacteria 574
13 JGI24749J21850_1041439 3300002076 Bacteria 675
14 JGI24744J21845_10000637 3300002077 Bacteria 6411
15 JGI24744J21845_10001167 3300002077 Bacteria 5116
16 JGI24034J26672_10090629 3300002239 Bacteria 567
17 JGI24742J22300_10000515 3300002244 Bacteria 5758
18 JGI24751J29686_10007367 3300002459 Bacteria 2247
19 Ga0070676_10122740 3300005328 Bacteria 1633
20 Ga0070683_100972309 3300005329 Bacteria 815
21 Ga0070690_100010439 3300005330 Bacteria 5406
22 Ga0070677_10538921 3300005333 Bacteria 638
23 Ga0068869_100062777 3300005334 Bacteria 2727
24 Ga0070666_10003954 3300005335 Bacteria 8997
25 Ga0070666_10313295 3300005335 Bacteria 1119
26 Ga0070680_100132664 3300005336 Bacteria 2085
27 Ga0070682_100057276 3300005337 Bacteria 2454
28 Ga0070682_101526051 3300005337 Bacteria 575
29 Ga0070682_101891290 3300005337 Bacteria 522
30 Ga0068868_100003443 3300005338 Bacteria 11019
31 Ga0068868_100156231 3300005338 Bacteria 1881
32 Ga0068868_102368094 3300005338 Bacteria 507
33 Ga0070660_100309610 3300005339 Bacteria 1296
34 Ga0070689_100008880 3300005340 Bacteria 7102
35 Ga0070689_100190789 3300005340 Bacteria 1668
36 Ga0070689_101824962 3300005340 Bacteria 555
37 Ga0070691_10003658 3300005341 Bacteria 6941
38 Ga0070691_10924266 3300005341 Bacteria 540
39 Ga0070687_100922540 3300005343 Bacteria 628
40 Ga0070661_101097611 3300005344 Bacteria 663
41 Ga0070661_101222783 3300005344 Bacteria 629
42 Ga0070692_10045472 3300005345 Bacteria 2264
43 Ga0070692_10320456 3300005345 Bacteria 953
44 Ga0070668_100008713 3300005347 Bacteria 7533
45 Ga0070668_100210006 3300005347 Bacteria 1601
46 Ga0070668_100524748 3300005347 Bacteria 1028
47 Ga0070669_100037908 3300005353 Bacteria 3498
48 Ga0070669_100274591 3300005353 Bacteria 1349
49 Ga0070675_100117867 3300005354 Bacteria 2254
50 Ga0070671_100061096 3300005355 Bacteria 3138
51 Ga0070671_100389561 3300005355 Bacteria 1191
52 Ga0070671_101214152 3300005355 Bacteria 664
53 Ga0070671_101635248 3300005355 Bacteria 571
54 Ga0070671_102088947 3300005355 Bacteria 505
55 Ga0070674_100000896 3300005356 Bacteria 15568
56 Ga0070674_100251026 3300005356 Bacteria 1389
57 Ga0070673_100132002 3300005364 Bacteria 2097
58 Ga0070673_101597244 3300005364 Bacteria 616
59 Ga0070688_100690413 3300005365 Bacteria 790
60 Ga0070659_100413746 3300005366 Bacteria 1140
61 Ga0070667_100001428 3300005367 Bacteria 21404
62 Ga0070667_100048517 3300005367 Bacteria 3574
63 Ga0070667_100284911 3300005367 Bacteria 1484
64 Ga0070709_10008036 3300005434 Bacteria 5789
65 Ga0070714_100012275 3300005435 Bacteria 6835
66 Ga0070714_101057289 3300005435 Bacteria 791
67 Ga0070710_10000757 3300005437 Bacteria 15392
68 Ga0070710_10265670 3300005437 Bacteria 1108
69 Ga0070701_10000936 3300005438 Bacteria 10562
70 Ga0070701_10858142 3300005438 Bacteria 624
71 Ga0070711_100001244 3300005439 Bacteria 13782
72 Ga0070711_100021879 3300005439 Bacteria 4138
73 Ga0070711_100143549 3300005439 Bacteria 1793
74 Ga0070705_100187850 3300005440 Bacteria 1405
75 Ga0070705_101058414 3300005440 Bacteria 661
76 Ga0070700_100004370 3300005441 Bacteria 7376
77 Ga0070700_100187860 3300005441 Bacteria 1442
78 Ga0070700_100363251 3300005441 Bacteria 1077
79 Ga0070694_100047718 3300005444 Bacteria 2879
80 Ga0070694_100071853 3300005444 Bacteria 2386
81 Ga0070708_100886327 3300005445 Bacteria 838
82 Ga0070663_100016744 3300005455 Bacteria 4770
83 Ga0070663_100303454 3300005455 Bacteria 1279
84 Ga0070663_100380009 3300005455 Bacteria 1150
85 Ga0070663_100381144 3300005455 Bacteria 1148
86 Ga0070678_100000686 3300005456 Bacteria 16691
87 Ga0070678_100151521 3300005456 Bacteria 1868
88 Ga0068867_100034236 3300005459 Bacteria 3681
89 Ga0070685_10203700 3300005466 Bacteria 1287
90 Ga0070685_11139379 3300005466 Bacteria 591
91 Ga0070706_100972900 3300005467 Bacteria 783
92 Ga0070684_100482852 3300005535 Bacteria 1147
93 Ga0070684_100907124 3300005535 Bacteria 826
94 Ga0070697_101920348 3300005536 Bacteria 530
95 Ga0068853_100011795 3300005539 Bacteria 7104
96 Ga0068853_100710977 3300005539 Bacteria 959
97 Ga0068853_100832533 3300005539 Bacteria 884
98 Ga0068853_101491507 3300005539 Bacteria 655
99 Ga0070672_100128985 3300005543 Bacteria 2077
100 Ga0070686_100192523 3300005544 Bacteria 1456
101 Ga0070695_100038333 3300005545 Bacteria 3023
102 Ga0070696_100002978 3300005546 Bacteria 11250
103 Ga0070696_100170524 3300005546 Bacteria 1608
104 Ga0070665_100008810 3300005548 Bacteria 10212
105 Ga0070665_100032322 3300005548 Bacteria 5267
106 Ga0070665_100120811 3300005548 Bacteria 2621
107 Ga0070665_100199808 3300005548 Bacteria 2000
108 Ga0070665_101478202 3300005548 Bacteria 688
109 Ga0070704_100000067 3300005549 Bacteria 34228
110 Ga0070704_101087943 3300005549 Bacteria 726
111 Ga0068855_101621229 3300005563 Bacteria 662
112 Ga0068855_102389378 3300005563 Bacteria 528
113 Ga0068857_101101273 3300005577 Bacteria 767
114 Ga0068854_100002312 3300005578 Bacteria 11744
115 Ga0068854_100133932 3300005578 Bacteria 1895
116 Ga0068854_100343085 3300005578 Bacteria 1220
117 Ga0068856_101600414 3300005614 Bacteria 665
118 Ga0070702_100001268 3300005615 Bacteria 10258
119 Ga0070702_100012484 3300005615 Bacteria 4258
120 Ga0068852_100056324 3300005616 Bacteria 3397
121 Ga0068852_100067992 3300005616 Bacteria 3116
122 Ga0068852_100239638 3300005616 Bacteria 1732
123 Ga0068859_100023821 3300005617 Bacteria 6144
124 Ga0068859_102069662 3300005617 Bacteria 628
125 Ga0068864_100035545 3300005618 Bacteria 4242
126 Ga0068864_100279418 3300005618 Bacteria 1558
127 Ga0068866_10001888 3300005718 Bacteria 8773
128 Ga0068866_10101877 3300005718 Bacteria 1585
129 Ga0068861_100013874 3300005719 Bacteria 5647
130 Ga0068861_100378374 3300005719 Bacteria 1250
131 Ga0068861_100384863 3300005719 Bacteria 1240
132 Ga0068861_100704243 3300005719 Bacteria 939
133 Ga0068851_10060512 3300005834 Bacteria 1939
134 Ga0068863_100323222 3300005841 Bacteria 1499
135 Ga0068863_100360867 3300005841 Bacteria 1416
136 Ga0068858_100003627 3300005842 Bacteria 15274
137 Ga0068858_101335080 3300005842 Bacteria 706
138 Ga0068860_100001873 3300005843 Bacteria 22347
139 Ga0068860_101897932 3300005843 Bacteria 617
140 Ga0068862_100004548 3300005844 Bacteria 11692
141 Ga0068862_100300989 3300005844 Bacteria 1475
142 Ga0068862_100396755 3300005844 Bacteria 1290
143 Ga0068862_101091975 3300005844 Bacteria 793
144 Ga0081455_10100590 3300005937 Bacteria 2322
145 Ga0081540_1064746 3300005983 Bacteria 1723
146 Ga0070717_10082371 3300006028 Bacteria 2704
147 Ga0070717_10516726 3300006028 Bacteria 1080
148 Ga0075365_10002248 3300006038 Bacteria 9353
149 Ga0075365_10065228 3300006038 Bacteria 2440
150 Ga0075365_10238274 3300006038 Bacteria 1278
151 Ga0075365_10679375 3300006038 Bacteria 728
152 Ga0075368_10018491 3300006042 Bacteria 2620
153 Ga0075368_10118983 3300006042 Bacteria 1093
154 Ga0075368_10217181 3300006042 Bacteria 812
155 Ga0075368_10379182 3300006042 Bacteria 619
156 Ga0075363_100005367 3300006048 Bacteria 5695
157 Ga0075363_100008865 3300006048 Bacteria 4706
158 Ga0075363_100010660 3300006048 Bacteria 4375
159 Ga0075363_100025211 3300006048 Bacteria 3030
160 Ga0075363_100046656 3300006048 Bacteria 2299
161 Ga0075363_100057463 3300006048 Bacteria 2088
162 Ga0075363_100198497 3300006048 Bacteria 1146
163 Ga0075363_100533877 3300006048 Bacteria 699
164 Ga0075363_100583813 3300006048 Bacteria 668
165 Ga0075363_100782378 3300006048 Bacteria 579
166 Ga0075364_10001392 3300006051 Bacteria 13075
167 Ga0075364_10004076 3300006051 Bacteria 8383
168 Ga0075364_10031967 3300006051 Bacteria 3380
169 Ga0075364_10033199 3300006051 Bacteria 3321
170 Ga0075364_10044023 3300006051 Bacteria 2902
171 Ga0075364_10061163 3300006051 Bacteria 2470
172 Ga0075364_10081659 3300006051 Bacteria 2137
173 Ga0075364_10146126 3300006051 Bacteria 1592
174 Ga0075364_10748554 3300006051 Bacteria 667
175 Ga0075364_10862275 3300006051 Bacteria 617
176 Ga0070715_10053684 3300006163 Bacteria 1743
177 Ga0070716_100001157 3300006173 Bacteria 11622
178 Ga0070716_100038304 3300006173 Bacteria 2654
179 Ga0070712_100005216 3300006175 Bacteria 8037
180 Ga0070712_100006240 3300006175 Bacteria 7382
181 Ga0075362_10023774 3300006177 Bacteria 2595
182 Ga0075362_10721787 3300006177 Bacteria 521
183 Ga0075367_10049051 3300006178 Bacteria 2488
184 Ga0075367_10233701 3300006178 Bacteria 1151
185 Ga0075367_10299420 3300006178 Bacteria 1012
186 Ga0075367_10404859 3300006178 Bacteria 863
187 Ga0075369_10004855 3300006186 Bacteria 5003
188 Ga0075369_10011940 3300006186 Bacteria 3424
189 Ga0075369_10030555 3300006186 Bacteria 2270
190 Ga0075369_10076913 3300006186 Bacteria 1476
191 Ga0075369_10103686 3300006186 Bacteria 1278
192 Ga0075369_10111547 3300006186 Bacteria 1233
193 Ga0075369_10515401 3300006186 Bacteria 569
194 Ga0075366_10591606 3300006195 Bacteria 688
195 Ga0097621_100146739 3300006237 Bacteria 2021
196 Ga0075370_10006409 3300006353 Bacteria 5916
197 Ga0075370_10026618 3300006353 Bacteria 3205
198 Ga0075370_10097864 3300006353 Bacteria 1696
199 Ga0075370_10175164 3300006353 Bacteria 1262
200 Ga0075370_10847523 3300006353 Bacteria 558
201 Ga0068871_100090028 3300006358 Bacteria 2555
202 Ga0075428_100009997 3300006844 Bacteria 10540
203 Ga0075430_100009331 3300006846 Bacteria 8293
204 Ga0075431_100211932 3300006847 Bacteria 1978
205 Ga0075434_101084781 3300006871 Bacteria 814
206 Ga0068865_100002054 3300006881 Bacteria 11889
207 Ga0068865_100054923 3300006881 Bacteria 2770
208 Ga0097620_100023820 3300006931 Bacteria 6144
209 Ga0097620_102069625 3300006931 Bacteria 628
210 Ga0105250_10023063 3300009092 Bacteria 2508
211 Ga0111539_12374295 3300009094 Bacteria 615
212 Ga0111539_13538663 3300009094 Bacteria 501
213 Ga0105245_10002934 3300009098 Bacteria 15311
214 Ga0105245_10189846 3300009098 Bacteria 1967
215 Ga0105245_10243309 3300009098 Bacteria 1745
216 Ga0105245_10494819 3300009098 Bacteria 1238
217 Ga0105245_10923804 3300009098 Bacteria 915
218 Ga0105247_10007322 3300009101 Bacteria 6781
219 Ga0105247_11057394 3300009101 Bacteria 638
220 Ga0114129_10036824 3300009147 Bacteria 6909
221 Ga0114129_10587038 3300009147 Bacteria 1445
222 Ga0105243_10001892 3300009148 Bacteria 17850
223 Ga0105243_10123247 3300009148 Bacteria 2189
224 Ga0105243_10401202 3300009148 Bacteria 1274
225 Ga0105241_10070822 3300009174 Bacteria 2706
226 Ga0105241_11491771 3300009174 Bacteria 650
227 Ga0105242_10003653 3300009176 Bacteria 11971
228 Ga0105242_11287971 3300009176 Bacteria 754
229 Ga0105242_13328972 3300009176 Bacteria 500
230 Ga0105248_10030730 3300009177 Bacteria 6000
231 Ga0105248_10507514 3300009177 Bacteria 1360
232 Ga0105248_10963000 3300009177 Bacteria 964
233 Ga0105237_10037561 3300009545 Bacteria 4894
234 Ga0105237_10248172 3300009545 Bacteria 1782
235 Ga0105237_10846903 3300009545 Bacteria 921
236 Ga0105238_10271523 3300009551 Bacteria 1676
237 Ga0105238_10661891 3300009551 Bacteria 1055
238 Ga0105249_10034660 3300009553 Bacteria 4574
239 Ga0105249_10294841 3300009553 Bacteria 1624
240 Ga0105249_10737536 3300009553 Bacteria 1047
241 Ga0105239_10050198 3300010375 Bacteria 4576
242 Ga0105239_11191569 3300010375 Bacteria 878
243 Ga0105246_10034395 3300011119 Bacteria 3376
244 Ga0157373_10502005 3300013100 Bacteria 876
245 Ga0157371_10195240 3300013102 Bacteria 1450
246 Ga0157369_10295679 3300013105 Bacteria 1685
247 Ga0157369_10817910 3300013105 Bacteria 957
248 Ga0157369_10826783 3300013105 Bacteria 951
249 Ga0157369_11249968 3300013105 Bacteria 757
250 Ga0157374_10085471 3300013296 Bacteria 3000
251 Ga0157374_10136824 3300013296 Bacteria 2375
252 Ga0157378_10000749 3300013297 Bacteria 30381
253 Ga0157378_10169887 3300013297 Bacteria 2044
254 Ga0163162_10006559 3300013306 Bacteria 11273
255 Ga0163162_10140182 3300013306 Bacteria 2531
256 Ga0163162_10375304 3300013306 Bacteria 1555
257 Ga0163162_11843176 3300013306 Bacteria 692
258 Ga0163162_12215108 3300013306 Bacteria 631
259 Ga0163162_12252913 3300013306 Bacteria 626
260 Ga0157372_10093928 3300013307 Bacteria 3414
261 Ga0157372_10171540 3300013307 Bacteria 2510
262 Ga0157372_12235023 3300013307 Bacteria 628
263 Ga0157375_10013118 3300013308 Bacteria 7365
264 Ga0157375_10361649 3300013308 Bacteria 1617
265 Ga0163163_10124808 3300014325 Bacteria 2611
266 Ga0163163_10656421 3300014325 Bacteria 1112
267 Ga0163163_11914968 3300014325 Bacteria 653
268 Ga0157380_10002388 3300014326 Bacteria 12627
269 Ga0157380_10195347 3300014326 Bacteria 1790
270 Ga0157380_10729436 3300014326 Bacteria 1000
271 Ga0182008_10499095 3300014497 Bacteria 669
272 Ga0157377_10037870 3300014745 Bacteria 2659
273 Ga0157377_10082881 3300014745 Bacteria 1878
274 Ga0157377_10116531 3300014745 Bacteria 1613
275 Ga0157379_10024948 3300014968 Bacteria 5306
276 Ga0157379_11195655 3300014968 Bacteria 731
277 Ga0157376_10043615 3300014969 Bacteria 3682
278 Ga0157376_10082415 3300014969 Bacteria 2764
279 Ga0163161_10058377 3300017792 Bacteria 2805
280 Ga0163161_10236801 3300017792 Bacteria 1418
281 Ga0163161_10284669 3300017792 Bacteria 1298
282 Ga0213873_10188601 3300021358 Bacteria 635
283 Ga0213874_10040689 3300021377 Bacteria 1389
284 Ga0213876_10004134 3300021384 Bacteria 8152
285 Ga0213876_10006209 3300021384 Bacteria 6519
286 Ga0213876_10088697 3300021384 Bacteria 1638
287 Ga0213876_10190833 3300021384 Bacteria 1090
288 Ga0213875_10024382 3300021388 Bacteria 2885
289 Ga0213875_10079894 3300021388 Bacteria 1526
290 Ga0209025_1116270 3300025294 Bacteria 809
291 Ga0209051_1141086 3300025303 Bacteria 579
292 Ga0207697_10077866 3300025315 Bacteria 1394
293 Ga0207656_10452744 3300025321 Bacteria 649
294 Ga0207653_10071124 3300025885 Bacteria 1189
295 Ga0207692_10001181 3300025898 Bacteria 9672
296 Ga0207692_10038390 3300025898 Bacteria 2348
297 Ga0207692_10098595 3300025898 Bacteria 1599
298 Ga0207642_10000298 3300025899 Bacteria 14852
299 Ga0207642_10210124 3300025899 Bacteria 1081
300 Ga0207642_10472026 3300025899 Bacteria 764
301 Ga0207710_10004941 3300025900 Bacteria 5778
302 Ga0207710_10741882 3300025900 Bacteria 516
303 Ga0207688_10017752 3300025901 Bacteria 3871
304 Ga0207688_10027795 3300025901 Bacteria 3111
305 Ga0207647_10047021 3300025904 Bacteria 2686
306 Ga0207685_10082925 3300025905 Bacteria 1331
307 Ga0207699_10037229 3300025906 Bacteria 2780
308 Ga0207699_10052570 3300025906 Bacteria 2412
309 Ga0207699_10458653 3300025906 Bacteria 915
310 Ga0207645_10006992 3300025907 Bacteria 8034
311 Ga0207645_10030445 3300025907 Bacteria 3477
312 Ga0207643_10312580 3300025908 Bacteria 980
313 Ga0207684_10685299 3300025910 Bacteria 872
314 Ga0207654_10021736 3300025911 Bacteria 3415
315 Ga0207654_10558975 3300025911 Bacteria 813
316 Ga0207654_11357456 3300025911 Bacteria 518
317 Ga0207671_10116398 3300025914 Bacteria 2039
318 Ga0207693_10006231 3300025915 Bacteria 9895
319 Ga0207693_10022627 3300025915 Bacteria 4993
320 Ga0207663_10011886 3300025916 Bacteria 4688
321 Ga0207663_10081981 3300025916 Bacteria 2114
322 Ga0207663_10142833 3300025916 Bacteria 1670
323 Ga0207660_11313937 3300025917 Bacteria 587
324 Ga0207662_10135344 3300025918 Bacteria 1557
325 Ga0207657_11367101 3300025919 Bacteria 533
326 Ga0207649_11015015 3300025920 Bacteria 653
327 Ga0207649_11469919 3300025920 Bacteria 539
328 Ga0207652_10433294 3300025921 Bacteria 1185
329 Ga0207652_11210726 3300025921 Bacteria 657
330 Ga0207681_10037058 3300025923 Bacteria 3221
331 Ga0207681_10184399 3300025923 Bacteria 1592
332 Ga0207694_10119702 3300025924 Bacteria 2101
333 Ga0207694_10642656 3300025924 Bacteria 894
334 Ga0207659_11126192 3300025926 Bacteria 675
335 Ga0207687_10000787 3300025927 Bacteria 21377
336 Ga0207687_10107299 3300025927 Bacteria 2066
337 Ga0207687_10369795 3300025927 Bacteria 1172
338 Ga0207687_10472149 3300025927 Bacteria 1043
339 Ga0207700_10551822 3300025928 Bacteria 1023
340 Ga0207664_10035288 3300025929 Bacteria 3858
341 Ga0207664_10043052 3300025929 Bacteria 3529
342 Ga0207664_10553727 3300025929 Bacteria 1032
343 Ga0207664_11551397 3300025929 Bacteria 584
344 Ga0207664_11675566 3300025929 Bacteria 558
345 Ga0207644_10055683 3300025931 Bacteria 2851
346 Ga0207644_10150319 3300025931 Bacteria 1801
347 Ga0207644_11210881 3300025931 Bacteria 635
348 Ga0207644_11473861 3300025931 Bacteria 571
349 Ga0207690_10006108 3300025932 Bacteria 7137
350 Ga0207706_10005968 3300025933 Bacteria 11331
351 Ga0207686_10837404 3300025934 Bacteria 739
352 Ga0207709_10027163 3300025935 Bacteria 3294
353 Ga0207709_10087047 3300025935 Bacteria 2030
354 Ga0207670_10172990 3300025936 Bacteria 1621
355 Ga0207669_10046156 3300025937 Bacteria 2572
356 Ga0207669_10874645 3300025937 Bacteria 749
357 Ga0207704_10000348 3300025938 Bacteria 21539
358 Ga0207704_10637685 3300025938 Bacteria 876
359 Ga0207665_10003947 3300025939 Bacteria 9929
360 Ga0207665_10004368 3300025939 Bacteria 9387
361 Ga0207691_10078966 3300025940 Bacteria 2962
362 Ga0207711_10014542 3300025941 Bacteria 6542
363 Ga0207711_10238177 3300025941 Bacteria 1668
364 Ga0207711_10458387 3300025941 Bacteria 1187
365 Ga0207711_10860707 3300025941 Bacteria 843
366 Ga0207689_10002180 3300025942 Bacteria 18382
367 Ga0207689_10027743 3300025942 Bacteria 4738
368 Ga0207661_10863209 3300025944 Bacteria 833
369 Ga0207651_11883594 3300025960 Bacteria 538
370 Ga0207712_10028701 3300025961 Bacteria 3724
371 Ga0207712_10033947 3300025961 Bacteria 3453
372 Ga0207712_10520009 3300025961 Bacteria 1020
373 Ga0207712_10662584 3300025961 Bacteria 908
374 Ga0207668_10005313 3300025972 Bacteria 7580
375 Ga0207668_10067835 3300025972 Bacteria 2534
376 Ga0207668_10178540 3300025972 Bacteria 1672
377 Ga0207640_10054970 3300025981 Bacteria 2605
378 Ga0207640_10189603 3300025981 Bacteria 1549
379 Ga0207640_10602302 3300025981 Bacteria 930
380 Ga0207640_11393651 3300025981 Bacteria 628
381 Ga0207658_10044332 3300025986 Bacteria 3238
382 Ga0207658_10285037 3300025986 Bacteria 1417
383 Ga0207658_11744179 3300025986 Bacteria 568
384 Ga0207677_10017210 3300026023 Bacteria 4304
385 Ga0207677_10050166 3300026023 Bacteria 2821
386 Ga0207677_10145860 3300026023 Bacteria 1819
387 Ga0207677_11830171 3300026023 Bacteria 564
388 Ga0207703_10009434 3300026035 Bacteria 7665
389 Ga0207703_10042930 3300026035 Bacteria 3627
390 Ga0207639_10393440 3300026041 Bacteria 1247
391 Ga0207639_10431215 3300026041 Bacteria 1194
392 Ga0207678_10039154 3300026067 Bacteria 4115
393 Ga0207678_10066530 3300026067 Bacteria 3095
394 Ga0207678_10140294 3300026067 Bacteria 2062
395 Ga0207678_10598207 3300026067 Bacteria 967
396 Ga0207708_10000696 3300026075 Bacteria 25516
397 Ga0207708_10010104 3300026075 Bacteria 7008
398 Ga0207708_10631516 3300026075 Bacteria 910
399 Ga0207641_10211917 3300026088 Bacteria 1792
400 Ga0207641_10232667 3300026088 Bacteria 1713
401 Ga0207648_10003748 3300026089 Bacteria 15887
402 Ga0207676_10032203 3300026095 Bacteria 3949
403 Ga0207676_10334926 3300026095 Bacteria 1394
404 Ga0207675_100000897 3300026118 Bacteria 29742
405 Ga0207675_100147585 3300026118 Bacteria 2237
406 Ga0207675_100719120 3300026118 Bacteria 1008
407 Ga0207683_10000413 3300026121 Bacteria 39512
408 Ga0207683_10051058 3300026121 Bacteria 3623
409 Ga0207698_10072441 3300026142 Bacteria 2739
410 Ga0209813_10193277 3300027866 Bacteria 750
411 Ga0209813_10350551 3300027866 Bacteria 584
412 Ga0268266_10002437 3300028379 Bacteria 19971
413 Ga0268266_10369506 3300028379 Bacteria 1351
414 Ga0268266_10393897 3300028379 Bacteria 1308
415 Ga0268265_10036115 3300028380 Bacteria 3617
416 Ga0268265_10045597 3300028380 Bacteria 3272
417 Ga0268265_12447630 3300028380 Bacteria 528
418 Ga0268264_10001236 3300028381 Bacteria 24521
419 Ga0268264_10469433 3300028381 Bacteria 1222
420 Ga0268264_12311814 3300028381 Bacteria 544
421 Ga0307408_100229271 3300031548 Bacteria 1520
422 Ga0316578_10043613 3300031728 Bacteria 2606
423 Ga0307413_10015428 3300031824 Bacteria 3915
424 Ga0307410_11437538 3300031852 Bacteria 606
425 Ga0307410_11811283 3300031852 Bacteria 542
426 Ga0307406_10222048 3300031901 Bacteria 1405
427 Ga0307407_10263560 3300031903 Bacteria 1186
428 Ga0307409_100049085 3300031995 Bacteria 3216
429 Ga0307409_100417513 3300031995 Bacteria 1286
430 Ga0307409_100439392 3300031995 Bacteria 1256
431 Ga0307416_100071088 3300032002 Bacteria 2889
432 Ga0307416_102760732 3300032002 Bacteria 587
433 Ga0307414_10485839 3300032004 Bacteria 1090
434 Ga0307415_100312749 3300032126 Bacteria 1306
435 Ga0373929_0133108 3300035085 Bacteria 654
436 Ga0373952_0045350 3300035092 Bacteria 1030
437 Ga0373932_0140981 3300035112 Bacteria 820
438 Ga0373939_0096195 3300035114 Bacteria 1009
439 Ga0373939_0175267 3300035114 Bacteria 796
440 Ga0373941_0049213 3300035115 Bacteria 1334
441 Ga0373960_0059289 3300035121 Bacteria 1157
442 Ga0373942_0085691 3300035207 Bacteria 942
443 Ga0373961_0049759 3300035241 Bacteria 1240
444 Ga0373931_0205317 3300035691 Bacteria 1179
445 Ga0373935_1128009 3300035692 Bacteria 584
446 Ga0373947_0392007 3300035725 Bacteria 936
447 Ga0316582_0856441 3300036647 Bacteria 622
448 Ga0316584_0009567 3300036712 Bacteria 6735
449 Ga0395900_1474356 3300037418 Bacteria 593
450 Ga0436364_0325252 3300037853 Bacteria 27012
451 Ga0436364_0374418 3300037853 Bacteria 13843
452 Ga0436364_1461304 3300037853 Bacteria 10672
453 Ga0436365_0203528 3300039437 Bacteria 8563
454 Ga0436365_0787906 3300039437 Bacteria 1561
455 Ga0436365_1001910 3300039437 Bacteria 6737
456 Ga0436365_1017373 3300039437 Bacteria 11123
457 Ga0436365_1462010 3300039437 Bacteria 9126
458 Ga0436365_1621114 3300039437 Bacteria 79407
459 Ga0436360_0656772 3300039438 Bacteria 1959
460 Ga0436363_0761249 3300039450 Bacteria 2786
461 Ga0436363_0978816 3300039450 Bacteria 841
462 Ga0436362_1140811 3300039453 Bacteria 660
463 Ga0439466_0004312 3300041411 Bacteria 5489
464 Ga0439465_0000668 3300041413 Bacteria 10489
465 Ga0451793_0529812 3300041452 Bacteria 835
466 Ga0451802_1453621 3300041460 Bacteria 516
467 Ga0451807_0326284 3300041486 Bacteria 636
468 Ga0451849_1280191 3300041505 Bacteria 697
469 Ga0451853_2004371 3300041512 Bacteria 968
470 Ga0451853_2423564 3300041512 Bacteria 512
471 Ga0439431_0038262 3300041997 Bacteria 1214
472 Ga0439433_0168933 3300041999 Bacteria 569
473 Ga0439445_0035264 3300042004 Bacteria 1313
474 Ga0439448_0229730 3300042005 Bacteria 653
475 Ga0439434_0026438 3300042435 Bacteria 1753
476 Ga0466969_0042194 3300044656 Bacteria 2279
477 Ga0466969_0107692 3300044656 Bacteria 1307
478 Ga0466972_0010733 3300044658 Bacteria 4597
479 Ga0466972_0039852 3300044658 Bacteria 2291
480 Ga0466972_0114372 3300044658 Bacteria 1274
481 Ga0466972_0130209 3300044658 Bacteria 1185
482 Ga0466972_0221576 3300044658 Bacteria 885
483 Ga0466972_0413623 3300044658 Bacteria 632
484 Ga0466965_0050447 3300044683 Bacteria 2063
485 Ga0466965_0077219 3300044683 Bacteria 1682
486 Ga0466965_0133623 3300044683 Bacteria 1288
487 Ga0466965_0269707 3300044683 Bacteria 917
488 Ga0466966_0006273 3300044684 Bacteria 7866
489 Ga0466966_0039209 3300044684 Bacteria 3051
490 Ga0466966_0059717 3300044684 Bacteria 2408
491 Ga0466966_0463830 3300044684 Bacteria 761
492 Ga0466961_0007216 3300044693 Bacteria 7068
493 Ga0466961_0017737 3300044693 Bacteria 4574
494 Ga0466961_0045929 3300044693 Bacteria 2794
495 Ga0466963_0052885 3300044694 Bacteria 2696
496 Ga0466963_0074610 3300044694 Bacteria 2288
497 Ga0466963_0270292 3300044694 Bacteria 1194
498 Ga0466963_0282581 3300044694 Bacteria 1166
499 Ga0466963_0472300 3300044694 Bacteria 885
500 Ga0466964_0266824 3300044706 Bacteria 850
501 Ga0466971_0008530 3300044719 Bacteria 4470
502 Ga0466971_0141353 3300044719 Bacteria 1121
503 Ga0466971_0691497 3300044719 Bacteria 512
504 Ga0466968_0012169 3300044735 Bacteria 3361
505 Ga0466968_0076810 3300044735 Bacteria 1462
506 Ga0466968_0423255 3300044735 Bacteria 655
507 Ga0466968_0621185 3300044735 Bacteria 547
508 Ga0466970_0003840 3300044765 Bacteria 7357
509 Ga0466970_0014438 3300044765 Bacteria 4056
510 Ga0466970_0691567 3300044765 Bacteria 594
511 Ga0466957_0009732 3300044842 Bacteria 5489
512 Ga0466957_0035760 3300044842 Bacteria 2982
513 Ga0466957_0293476 3300044842 Bacteria 1091
514 Ga0466957_0606800 3300044842 Bacteria 766
515 Ga0466960_0000372 3300044901 Bacteria 15325
516 Ga0466960_0014871 3300044901 Bacteria 3344
517 Ga0466960_0020752 3300044901 Bacteria 2915
518 Ga0466960_0095270 3300044901 Bacteria 1524
519 Ga0466960_0193779 3300044901 Bacteria 1107
520 Ga0466960_0946408 3300044901 Bacteria 527
521 Ga0466959_0021429 3300045049 Bacteria 4766
522 Ga0466959_0086556 3300045049 Bacteria 2254
523 Ga0466959_0380987 3300045049 Bacteria 960
524 Ga0466958_0002994 3300045836 Bacteria 8658
525 Ga0466958_0003841 3300045836 Bacteria 7852
526 Ga0466958_0023804 3300045836 Bacteria 3599
527 Ga0466958_0266382 3300045836 Bacteria 1097
528 Ga0466967_0018062 3300045976 Bacteria 5625
529 Ga0466967_0024967 3300045976 Bacteria 4921
530 Ga0466967_0948806 3300045976 Bacteria 856
531 Ga0466967_1127677 3300045976 Bacteria 781
532 Ga0466967_1180029 3300045976 Bacteria 763
533 Ga0495603_0049363 3300046455 Bacteria 2505
534 Ga0495629_0043593 3300046459 Bacteria 3149
535 Ga0495638_0011643 3300046460 Bacteria 6057
536 Ga0495638_0649939 3300046460 Bacteria 513
537 Ga0495582_0066893 3300046473 Bacteria 1985
538 Ga0495639_0164784 3300046475 Bacteria 1074
539 Ga0495662_0079947 3300046476 Bacteria 1590
540 Ga0495664_0191656 3300046477 Bacteria 1239
541 Ga0495594_0044311 3300046499 Bacteria 2440
542 Ga0495620_0339428 3300046515 Bacteria 570
543 Ga0495643_0313120 3300046522 Bacteria 712
544 Ga0495666_0404572 3300046526 Bacteria 613
545 Ga0495665_0202111 3300046531 Bacteria 1030
546 Ga0495634_0188660 3300046642 Bacteria 1287
547 Ga0495588_0086626 3300046674 Bacteria 1638
548 Ga0495658_0108945 3300046683 Bacteria 1663
549 Ga0495624_0182716 3300046690 Bacteria 1277
550 Ga0495581_0012840 3300047315 Bacteria 4852
551 Ga0495674_0377959 3300047319 Bacteria 1146
552 Ga0495672_0061989 3300047320 Bacteria 2153
553 Ga0495676_0104634 3300047321 Bacteria 2088
554 Ga0495680_0463701 3300047322 Bacteria 865
555 Ga0495686_0318245 3300047472 Bacteria 854
556 Ga0495593_0015467 3300047673 Bacteria 4321
557 Ga0495614_0294628 3300048089 Bacteria 749
558 Ga0496100_0004372 3300048903 Bacteria 7484
559 Ga0496100_0013521 3300048903 Bacteria 4711
560 Ga0496100_0184369 3300048903 Bacteria 1511
561 Ga0496100_0683833 3300048903 Bacteria 800
562 Ga0496101_0014567 3300048904 Bacteria 5286
563 Ga0496101_0070129 3300048904 Bacteria 2566
564 Ga0496101_0078929 3300048904 Bacteria 2429
565 Ga0496101_0588474 3300048904 Bacteria 880
566 Ga0496101_1190226 3300048904 Bacteria 597
567 Ga0496101_1331008 3300048904 Bacteria 561
568 Ga0496102_0005139 3300048905 Bacteria 11098
569 Ga0496102_0124596 3300048905 Bacteria 2408
570 Ga0496102_0207986 3300048905 Bacteria 1845
571 Ga0496102_0211477 3300048905 Bacteria 1828
572 Ga0496102_0268435 3300048905 Bacteria 1609
573 Ga0496102_0284382 3300048905 Bacteria 1559
574 Ga0496102_0522728 3300048905 Bacteria 1109
575 Ga0496102_1946997 3300048905 Bacteria 504
576 Ga0496103_0000592 3300048906 Bacteria 28566
577 Ga0496103_0058753 3300048906 Bacteria 2389
578 Ga0496103_0790700 3300048906 Bacteria 599
579 Ga0496104_0010831 3300048907 Bacteria 8156
580 Ga0496104_0148926 3300048907 Bacteria 2247
581 Ga0496104_1590626 3300048907 Bacteria 556
582 Ga0496105_0107787 3300048908 Bacteria 2300
583 Ga0496106_0003432 3300048909 Bacteria 11805
584 Ga0496106_0331647 3300048909 Bacteria 1221
585 Ga0496106_0785422 3300048909 Bacteria 756
586 Ga0496107_0000802 3300048910 Bacteria 18236
587 Ga0496107_0152444 3300048910 Bacteria 1710
588 Ga0496108_0003955 3300048911 Bacteria 11903
589 Ga0496108_0024669 3300048911 Bacteria 4953
590 Ga0496108_0278538 3300048911 Bacteria 1456
591 Ga0496109_0006471 3300048912 Bacteria 9863
592 Ga0496109_0050253 3300048912 Bacteria 3798
593 Ga0496109_0195510 3300048912 Bacteria 1901
594 Ga0496109_0336463 3300048912 Bacteria 1425
595 Ga0496109_1992538 3300048912 Bacteria 513
596 Ga0496110_0084323 3300048913 Bacteria 2836
597 Ga0496110_0146096 3300048913 Bacteria 2139
598 Ga0496111_0192782 3300048914 Bacteria 1515
599 Ga0496111_0874220 3300048914 Bacteria 648
600 Ga0496112_0003857 3300048915 Bacteria 12524
601 Ga0496112_0037169 3300048915 Bacteria 4753
602 Ga0496112_0043159 3300048915 Bacteria 4414
603 Ga0496112_0080879 3300048915 Bacteria 3213
604 Ga0496112_0085593 3300048915 Bacteria 3119
605 Ga0496112_0102654 3300048915 Bacteria 2830
606 Ga0496112_1047380 3300048915 Bacteria 735
607 Ga0496113_0033107 3300048916 Bacteria 3761
608 Ga0496113_0035604 3300048916 Bacteria 3641
609 Ga0496113_0132410 3300048916 Bacteria 1957
610 Ga0496113_0617710 3300048916 Bacteria 868
611 Ga0496113_0674819 3300048916 Bacteria 826
612 Ga0496114_0000487 3300048917 Bacteria 29129
613 Ga0496115_0018299 3300048918 Bacteria 5376
614 Ga0496115_0048925 3300048918 Bacteria 3382
615 Ga0496115_1364742 3300048918 Bacteria 525
616 Ga0496117_0145344 3300048920 Bacteria 1413
617 Ga0496121_0875928 3300048924 Bacteria 519
618 Ga0496122_0030344 3300048925 Bacteria 4531
619 Ga0496123_0039432 3300048926 Bacteria 3304
620 Ga0496125_0233111 3300048928 Bacteria 1175
621 Ga0496125_0401811 3300048928 Bacteria 800
622 Ga0496126_0001976 3300048929 Bacteria 29048
623 Ga0496126_0010527 3300048929 Bacteria 9685
624 Ga0496126_0161474 3300048929 Bacteria 1914
625 Ga0501032_0005028 3300049569 Bacteria 9883
626 Ga0501032_0005216 3300049569 Bacteria 9670
627 Ga0501033_0061936 3300049570 Bacteria 2756
628 Ga0501033_0092261 3300049570 Bacteria 2215
629 Ga0501033_0152624 3300049570 Bacteria 1666
630 Ga0501033_0441147 3300049570 Bacteria 905
631 Ga0501034_0010017 3300049571 Bacteria 9902
632 Ga0501034_0037809 3300049571 Bacteria 4888
633 Ga0501034_0056731 3300049571 Bacteria 3940
634 Ga0501034_0567611 3300049571 Bacteria 1043
635 Ga0501034_1111044 3300049571 Bacteria 671
636 Ga0501036_0007496 3300049572 Bacteria 8899
637 Ga0501036_0676913 3300049572 Bacteria 853
638 Ga0501036_1748899 3300049572 Bacteria 501
639 Ga0501037_0001645 3300049573 Bacteria 16251
640 Ga0501037_0069065 3300049573 Bacteria 2573
641 Ga0501038_0091240 3300049574 Bacteria 2552
642 Ga0501039_0000415 3300049575 Bacteria 30627
643 Ga0501039_0805579 3300049575 Bacteria 733
644 Ga0501043_0001031 3300049579 Bacteria 24463
645 Ga0501043_0336312 3300049579 Bacteria 1149
646 Ga0501046_0003427 3300049580 Bacteria 14558
647 Ga0501047_0030230 3300049581 Bacteria 5222
648 Ga0501047_0046761 3300049581 Bacteria 4182
649 Ga0501047_0217582 3300049581 Bacteria 1767
650 Ga0501047_0359591 3300049581 Bacteria 1292
651 Ga0501047_0385658 3300049581 Bacteria 1235
652 Ga0501048_0258816 3300049582 Bacteria 1236
653 Ga0501067_0259502 3300049583 Bacteria 967
654 Ga0501069_0048928 3300049585 Bacteria 2349
655 Ga0501070_0000517 3300049586 Bacteria 35418
656 Ga0501070_0003022 3300049586 Bacteria 14642
657 Ga0501070_0627289 3300049586 Bacteria 855
658 Ga0501070_0764524 3300049586 Bacteria 761
659 Ga0501073_0022631 3300049589 Bacteria 4522
660 Ga0501077_0089915 3300049593 Bacteria 1946
661 Ga0501080_0189438 3300049742 Bacteria 1891
662 Ga0501080_0946515 3300049742 Bacteria 749
663 Ga0501035_0001193 3300049822 Bacteria 27068
664 Ga0501035_0118991 3300049822 Bacteria 2311
665 Ga0501035_0370584 3300049822 Bacteria 1195
666 Ga0501044_0000320 3300049823 Bacteria 60627
667 Ga0501044_0003141 3300049823 Bacteria 18689
668 Ga0501044_0011535 3300049823 Bacteria 9575
669 Ga0501044_0076931 3300049823 Bacteria 3385
670 Ga0501044_0609618 3300049823 Bacteria 984
671 Ga0501044_0724734 3300049823 Bacteria 878
672 nmdc:mga03683_279374_c1 3300050489 Bacteria 780
673 nmdc:mga03683_51840_c1 3300050489 Bacteria 1714
674 nmdc:mga03683_9067_c1 3300050489 Bacteria 3522
675 nmdc:mga03n38_13535_c1 3300050490 Bacteria 3102
676 nmdc:mga03n38_175726_c1 3300050490 Bacteria 1094
677 nmdc:mga03n38_27563_c1 3300050490 Bacteria 2358
678 nmdc:mga03n38_330086_c1 3300050490 Bacteria 826
679 nmdc:mga03n38_4358_c1 3300050490 Bacteria 4678
680 nmdc:mga03n38_464648_c1 3300050490 Bacteria 706
681 nmdc:mga03n38_856493_c1 3300050490 Bacteria 532
682 nmdc:mga00v17_155290_c1 3300050491 Bacteria 1471
683 nmdc:mga00v17_2148_c1 3300050491 Bacteria 10132
684 nmdc:mga00v17_217430_c1 3300050491 Bacteria 1237
685 nmdc:mga00v17_259639_c1 3300050491 Bacteria 1127
686 nmdc:mga00v17_348190_c1 3300050491 Bacteria 963
687 nmdc:mga00v17_37801_c1 3300050491 Bacteria 2884
688 nmdc:mga00v17_43343_c1 3300050491 Bacteria 2709
689 nmdc:mga00v17_447438_c1 3300050491 Bacteria 839
690 nmdc:mga0yw44_1008405_c1 3300050492 Bacteria 563
691 nmdc:mga0yw44_1250162_c1 3300050492 Bacteria 501
692 nmdc:mga0yw44_135427_c1 3300050492 Bacteria 1598
693 nmdc:mga0yw44_194798_c1 3300050492 Bacteria 1337
694 nmdc:mga0yw44_26172_c1 3300050492 Bacteria 3329
695 nmdc:mga0yw44_292519_c1 3300050492 Bacteria 1090
696 nmdc:mga0yw44_460411_c1 3300050492 Bacteria 862
697 nmdc:mga06z11_365921_c1 3300050494 Bacteria 865
698 nmdc:mga06z11_517283_c1 3300050494 Bacteria 723
699 nmdc:mga04h51_13848_c1 3300050495 Bacteria 2293
700 nmdc:mga04h51_190272_c1 3300050495 Bacteria 802
701 nmdc:mga07m45_12350_c1 3300050496 Bacteria 4512
702 nmdc:mga07m45_149775_c1 3300050496 Bacteria 1353
703 nmdc:mga07m45_160768_c1 3300050496 Bacteria 1304
704 nmdc:mga07m45_248181_c1 3300050496 Bacteria 1036
705 nmdc:mga07m45_303117_c1 3300050496 Bacteria 929
706 nmdc:mga07m45_75920_c1 3300050496 Bacteria 1915
707 nmdc:mga05p37_144066_c1 3300050507 Bacteria 2918
708 nmdc:mga0qj67_8192_c1 3300050509 Bacteria 7746
709 nmdc:mga06r32_908187_c1 3300050510 Bacteria 837
710 nmdc:mga08y16_1516679_c1 3300050511 Bacteria 630
711 nmdc:mga0n895_750201_c1 3300050512 Bacteria 969
712 nmdc:mga0sz30_1370_c2 3300050516 Bacteria 5452
713 nmdc:mga0sz30_20867_c1 3300050516 Bacteria 2646
714 nmdc:mga0sz30_221375_c1 3300050516 Bacteria 841
715 nmdc:mga0sz30_244077_c1 3300050516 Bacteria 799
716 nmdc:mga0sz30_279036_c1 3300050516 Bacteria 744
717 nmdc:mga0sz30_32150_c1 3300050516 Bacteria 2175
718 nmdc:mga0sz30_92030_c1 3300050516 Bacteria 1320
719 Ga0495601_1062841 3300053077 Bacteria 507
720 Ga0500635_0012614 3300053080 Bacteria 2432
721 Ga0495655_0022324 3300053083 Bacteria 1444
722 Ga0495655_0046550 3300053083 Bacteria 1131
723 Ga0495619_0127029 3300053085 Bacteria 1751
724 Ga0500578_0254080 3300053086 Bacteria 1058
725 Ga0500643_008087 3300053087 Bacteria 4166
726 Ga0500641_0275757 3300053096 Bacteria 698
727 Ga0500650_0163551 3300053098 Bacteria 1026
728 Ga0500642_0158899 3300053130 Bacteria 1060
729 Ga0500652_002160 3300053131 Bacteria 5911
730 Ga0500652_254686 3300053131 Bacteria 694
731 Ga0500658_0565477 3300053134 Bacteria 511
732 Ga0500559_0519899 3300053136 Bacteria 545
733 Ga0500568_0140430 3300053139 Bacteria 896
734 Ga0500588_0105197 3300053146 Bacteria 978
735 Ga0500588_0153564 3300053146 Bacteria 834
736 Ga0500627_0004036 3300053158 Bacteria 4642
737 Ga0500645_000104 3300053730 Bacteria 67349
738 Ga0500645_012533 3300053730 Bacteria 2738
739 Ga0466962_0223413 3300061719 Bacteria 922
740 Ga0466962_0623714 3300061719 Bacteria 550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100972309 Ga0070683_1009723092 73
2 3300005345 Ga0070692_10320456 Ga0070692_103204563 73
3 3300005347 Ga0070668_100524748 Ga0070668_1005247482 73
4 3300005355 Ga0070671_101214152 Ga0070671_1012141521 73
5 3300005364 Ga0070673_101597244 Ga0070673_1015972441 73
6 3300005438 Ga0070701_10858142 Ga0070701_108581422 73
7 3300005441 Ga0070700_100363251 Ga0070700_1003632513 73
8 3300005466 Ga0070685_11139379 Ga0070685_111393791 73
9 3300005535 Ga0070684_100907124 Ga0070684_1009071241 73
10 3300005539 Ga0068853_100710977 Ga0068853_1007109771 73
11 3300005539 Ga0068853_101491507 Ga0068853_1014915071 73
12 3300005548 Ga0070665_100199808 Ga0070665_1001998084 73
13 3300005616 Ga0068852_100056324 Ga0068852_1000563244 73
14 3300005719 Ga0068861_100378374 Ga0068861_1003783742 73
15 3300005844 Ga0068862_100396755 Ga0068862_1003967552 73
16 3300006048 Ga0075363_100008865 Ga0075363_1000088654 73
17 3300006178 Ga0075367_10299420 Ga0075367_102994202 73
18 3300009098 Ga0105245_10923804 Ga0105245_109238042 73
19 3300009148 Ga0105243_10401202 Ga0105243_104012022 73
20 3300009177 Ga0105248_10963000 Ga0105248_109630001 73
21 3300009551 Ga0105238_10661891 Ga0105238_106618912 73
22 3300013307 Ga0157372_12235023 Ga0157372_122350231 73
23 3300014325 Ga0163163_10656421 Ga0163163_106564212 73
24 3300014326 Ga0157380_10729436 Ga0157380_107294362 73
25 3300014745 Ga0157377_10116531 Ga0157377_101165312 73
26 3300025899 Ga0207642_10210124 Ga0207642_102101242 73
27 3300025908 Ga0207643_10312580 Ga0207643_103125801 73
28 3300025924 Ga0207694_10642656 Ga0207694_106426561 73
29 3300025927 Ga0207687_10369795 Ga0207687_103697951 73
30 3300025931 Ga0207644_11210881 Ga0207644_112108811 73
31 3300025941 Ga0207711_10860707 Ga0207711_108607073 73
32 3300025944 Ga0207661_10863209 Ga0207661_108632092 73
33 3300025960 Ga0207651_11883594 Ga0207651_118835942 73
34 3300026023 Ga0207677_10145860 Ga0207677_101458602 73
35 3300026041 Ga0207639_10431215 Ga0207639_104312153 73
36 3300026067 Ga0207678_10140294 Ga0207678_101402945 73
37 3300028379 Ga0268266_10369506 Ga0268266_103695063 73
38 3300028380 Ga0268265_12447630 Ga0268265_124476301 73
39 3300041452 Ga0451793_0529812 Ga0451793_0529812_66_350 73
40 3300041486 Ga0451807_0326284 Ga0451807_0326284_315_599 73
41 3300041512 Ga0451853_2004371 Ga0451853_2004371_662_946 73
42 3300046460 Ga0495638_0649939 Ga0495638_0649939_122_406 73
43 3300046515 Ga0495620_0339428 Ga0495620_0339428_153_437 73
44 3300046522 Ga0495643_0313120 Ga0495643_0313120_20_304 73
45 3300047472 Ga0495686_0318245 Ga0495686_0318245_147_431 73
46 3300048904 Ga0496101_0588474 Ga0496101_0588474_239_523 73
47 3300048907 Ga0496104_1590626 Ga0496104_1590626_138_422 73
48 3300048911 Ga0496108_0024669 Ga0496108_0024669_1827_2111 73
49 3300048912 Ga0496109_0336463 Ga0496109_0336463_809_1093 73
50 3300048914 Ga0496111_0192782 Ga0496111_0192782_501_785 73
51 3300048915 Ga0496112_0037169 Ga0496112_0037169_3624_3908 73
52 3300048915 Ga0496112_0102654 Ga0496112_0102654_1989_2273 73
53 3300048916 Ga0496113_0033107 Ga0496113_0033107_130_414 73
54 3300050490 nmdc:mga03n38_27563_c1 nmdc:mga03n38_27563_c1_434_718 73
55 3300050494 nmdc:mga06z11_517283_c1 nmdc:mga06z11_517283_c1_383_667 73
56 3300050496 nmdc:mga07m45_75920_c1 nmdc:mga07m45_75920_c1_460_744 73
57 3300053083 Ga0495655_0022324 Ga0495655_0022324_492_776 73
58 3300005344 Ga0070661_101097611 Ga0070661_1010976112 75
59 3300006871 Ga0075434_101084781 Ga0075434_1010847812 75
60 3300009094 Ga0111539_12374295 Ga0111539_123742952 75
61 3300009098 Ga0105245_10243309 Ga0105245_102433093 75
62 3300009174 Ga0105241_11491771 Ga0105241_114917712 75
63 3300009176 Ga0105242_13328972 Ga0105242_133289722 75
64 3300013306 Ga0163162_12215108 Ga0163162_122151082 75
65 3300025911 Ga0207654_10558975 Ga0207654_105589752 75
66 3300025920 Ga0207649_11015015 Ga0207649_110150151 75
67 3300025927 Ga0207687_10472149 Ga0207687_104721493 75
68 3300035692 Ga0373935_1128009 Ga0373935_1128009_110_394 75
69 3300035725 Ga0373947_0392007 Ga0373947_0392007_162_446 75
70 3300044658 Ga0466972_0413623 Ga0466972_0413623_275_559 75
71 3300045976 Ga0466967_1180029 Ga0466967_1180029_112_396 75
72 3300046455 Ga0495603_0049363 Ga0495603_0049363_1077_1361 75
73 3300046477 Ga0495664_0191656 Ga0495664_0191656_264_548 75
74 3300046674 Ga0495588_0086626 Ga0495588_0086626_1085_1369 75
75 3300047321 Ga0495676_0104634 Ga0495676_0104634_763_1047 75
76 3300048089 Ga0495614_0294628 Ga0495614_0294628_40_324 75
77 3300048903 Ga0496100_0184369 Ga0496100_0184369_547_831 75
78 3300048905 Ga0496102_0284382 Ga0496102_0284382_945_1229 75
79 3300048906 Ga0496103_0790700 Ga0496103_0790700_131_415 75
80 3300048909 Ga0496106_0785422 Ga0496106_0785422_98_382 75
81 3300048912 Ga0496109_0195510 Ga0496109_0195510_623_907 75
82 3300048915 Ga0496112_0085593 Ga0496112_0085593_1250_1534 75
83 3300048916 Ga0496113_0617710 Ga0496113_0617710_193_477 75
84 3300049569 Ga0501032_0005028 Ga0501032_0005028_4290_4574 75
85 3300049570 Ga0501033_0152624 Ga0501033_0152624_738_1022 75
86 3300049571 Ga0501034_0010017 Ga0501034_0010017_4276_4560 75
87 3300049572 Ga0501036_0007496 Ga0501036_0007496_5326_5610 75
88 3300049573 Ga0501037_0001645 Ga0501037_0001645_3688_3972 75
89 3300049574 Ga0501038_0091240 Ga0501038_0091240_2034_2318 75
90 3300049575 Ga0501039_0000415 Ga0501039_0000415_18064_18348 75
91 3300049579 Ga0501043_0001031 Ga0501043_0001031_3688_3972 75
92 3300049583 Ga0501067_0259502 Ga0501067_0259502_664_948 75
93 3300049586 Ga0501070_0000517 Ga0501070_0000517_12167_12451 75
94 3300049589 Ga0501073_0022631 Ga0501073_0022631_1344_1628 75
95 3300049593 Ga0501077_0089915 Ga0501077_0089915_1535_1819 75
96 3300049823 Ga0501044_0011535 Ga0501044_0011535_6064_6348 75
97 3300050511 nmdc:mga08y16_1516679_c1 nmdc:mga08y16_1516679_c1_143_427 75
98 3300005439 Ga0070711_100143549 Ga0070711_1001435492 76
99 3300025916 Ga0207663_10142833 Ga0207663_101428332 76
100 3300046459 Ga0495629_0043593 Ga0495629_0043593_585_869 76
101 3300046473 Ga0495582_0066893 Ga0495582_0066893_471_755 76
102 3300046475 Ga0495639_0164784 Ga0495639_0164784_252_536 76
103 3300046476 Ga0495662_0079947 Ga0495662_0079947_625_909 76
104 3300046499 Ga0495594_0044311 Ga0495594_0044311_1258_1542 76
105 3300046526 Ga0495666_0404572 Ga0495666_0404572_309_593 76
106 3300046531 Ga0495665_0202111 Ga0495665_0202111_585_869 76
107 3300046642 Ga0495634_0188660 Ga0495634_0188660_221_505 76
108 3300046683 Ga0495658_0108945 Ga0495658_0108945_881_1165 76
109 3300046690 Ga0495624_0182716 Ga0495624_0182716_880_1164 76
110 3300047315 Ga0495581_0012840 Ga0495581_0012840_2571_2855 76
111 3300047319 Ga0495674_0377959 Ga0495674_0377959_492_776 76
112 3300047322 Ga0495680_0463701 Ga0495680_0463701_158_442 76
113 3300047673 Ga0495593_0015467 Ga0495593_0015467_556_840 76
114 3300048905 Ga0496102_1946997 Ga0496102_1946997_21_272 76
115 3300053077 Ga0495601_1062841 Ga0495601_1062841_211_495 76
116 3300053085 Ga0495619_0127029 Ga0495619_0127029_520_804 76
117 3300036647 Ga0316582_0856441 Ga0316582_0856441_124_366 77
118 3300050489 nmdc:mga03683_279374_c1 nmdc:mga03683_279374_c1_154_411 77
119 3300050490 nmdc:mga03n38_330086_c1 nmdc:mga03n38_330086_c1_219_476 77
120 3300050490 nmdc:mga03n38_4358_c1 nmdc:mga03n38_4358_c1_1889_2146 77
121 3300050490 nmdc:mga03n38_856493_c1 nmdc:mga03n38_856493_c1_226_483 77
122 3300050491 nmdc:mga00v17_155290_c1 nmdc:mga00v17_155290_c1_1062_1319 77
123 3300050491 nmdc:mga00v17_217430_c1 nmdc:mga00v17_217430_c1_222_479 77
124 3300050491 nmdc:mga00v17_37801_c1 nmdc:mga00v17_37801_c1_1812_2069 77
125 3300050492 nmdc:mga0yw44_1250162_c1 nmdc:mga0yw44_1250162_c1_145_402 77
126 3300050492 nmdc:mga0yw44_135427_c1 nmdc:mga0yw44_135427_c1_377_634 77
127 3300050492 nmdc:mga0yw44_194798_c1 nmdc:mga0yw44_194798_c1_20_262 77
128 3300050495 nmdc:mga04h51_13848_c1 nmdc:mga04h51_13848_c1_1633_1890 77
129 3300050496 nmdc:mga07m45_248181_c1 nmdc:mga07m45_248181_c1_50_307 77
130 3300050496 nmdc:mga07m45_303117_c1 nmdc:mga07m45_303117_c1_321_578 77
131 3300050516 nmdc:mga0sz30_1370_c2 nmdc:mga0sz30_1370_c2_2816_3058 77
132 3300050516 nmdc:mga0sz30_221375_c1 nmdc:mga0sz30_221375_c1_374_631 77
133 3300053096 Ga0500641_0275757 Ga0500641_0275757_401_685 77
134 3300041460 Ga0451802_1453621 Ga0451802_1453621_110_394 78
135 3300005535 Ga0070684_100482852 Ga0070684_1004828522 80
136 3300006048 Ga0075363_100025211 Ga0075363_1000252113 80
137 3300006051 Ga0075364_10001392 Ga0075364_1000139210 80
138 3300006178 Ga0075367_10404859 Ga0075367_104048592 80
139 3300006186 Ga0075369_10011940 Ga0075369_100119404 80
140 3300006353 Ga0075370_10026618 Ga0075370_100266184 80
141 3300013105 Ga0157369_10295679 Ga0157369_102956793 80
142 3300021384 Ga0213876_10004134 Ga0213876_100041343 80
143 3300025921 Ga0207652_11210726 Ga0207652_112107262 80
144 3300025929 Ga0207664_10043052 Ga0207664_100430522 80
145 3300025929 Ga0207664_10553727 Ga0207664_105537272 80
146 3300039437 Ga0436365_0203528 Ga0436365_0203528_7590_7853 80
147 3300039437 Ga0436365_1017373 Ga0436365_1017373_18_281 80
148 3300044694 Ga0466963_0052885 Ga0466963_0052885_130_393 80
149 3300044694 Ga0466963_0282581 Ga0466963_0282581_823_1086 80
150 3300044694 Ga0466963_0472300 Ga0466963_0472300_98_361 80
151 3300044842 Ga0466957_0293476 Ga0466957_0293476_217_480 80
152 3300045836 Ga0466958_0266382 Ga0466958_0266382_103_366 80
153 3300045976 Ga0466967_0018062 Ga0466967_0018062_2152_2415 80
154 3300045976 Ga0466967_0024967 Ga0466967_0024967_4023_4286 80
155 3300048915 Ga0496112_1047380 Ga0496112_1047380_437_700 80
156 3300048929 Ga0496126_0010527 Ga0496126_0010527_2970_3233 80
157 3300049569 Ga0501032_0005216 Ga0501032_0005216_287_550 80
158 3300049570 Ga0501033_0441147 Ga0501033_0441147_44_307 80
159 3300049571 Ga0501034_0037809 Ga0501034_0037809_4416_4679 80
160 3300049571 Ga0501034_1111044 Ga0501034_1111044_140_403 80
161 3300049572 Ga0501036_1748899 Ga0501036_1748899_228_491 80
162 3300049579 Ga0501043_0336312 Ga0501043_0336312_112_375 80
163 3300049580 Ga0501046_0003427 Ga0501046_0003427_185_448 80
164 3300049581 Ga0501047_0217582 Ga0501047_0217582_273_536 80
165 3300049586 Ga0501070_0003022 Ga0501070_0003022_13520_13783 80
166 3300049823 Ga0501044_0003141 Ga0501044_0003141_174_437 80
167 3300049823 Ga0501044_0609618 Ga0501044_0609618_170_433 80
168 3300049823 Ga0501044_0724734 Ga0501044_0724734_587_850 80
169 3300050491 nmdc:mga00v17_2148_c1 nmdc:mga00v17_2148_c1_2478_2741 80
170 3300050492 nmdc:mga0yw44_292519_c1 nmdc:mga0yw44_292519_c1_114_377 80
171 3300050494 nmdc:mga06z11_365921_c1 nmdc:mga06z11_365921_c1_161_424 80
172 3300050496 nmdc:mga07m45_12350_c1 nmdc:mga07m45_12350_c1_1807_2070 80
173 3300050512 nmdc:mga0n895_750201_c1 nmdc:mga0n895_750201_c1_169_432 80
174 3300050516 nmdc:mga0sz30_32150_c1 nmdc:mga0sz30_32150_c1_1195_1458 80
175 3300053086 Ga0500578_0254080 Ga0500578_0254080_301_564 80
176 3300049571 Ga0501034_0567611 Ga0501034_0567611_115_390 82
177 3300001977 JGI24746J21847_1064679 JGI24746J21847_10646792 84
178 3300001989 JGI24739J22299_10105663 JGI24739J22299_101056631 84
179 3300001990 JGI24737J22298_10076471 JGI24737J22298_100764712 84
180 3300001991 JGI24743J22301_10060984 JGI24743J22301_100609841 84
181 3300001991 JGI24743J22301_10069475 JGI24743J22301_100694751 84
182 3300002070 JGI24750J21931_1024546 JGI24750J21931_10245462 84
183 3300002070 JGI24750J21931_1028678 JGI24750J21931_10286782 84
184 3300002073 JGI24745J21846_1006210 JGI24745J21846_10062102 84
185 3300002074 JGI24748J21848_1012428 JGI24748J21848_10124282 84
186 3300002076 JGI24749J21850_1041439 JGI24749J21850_10414392 84
187 3300002239 JGI24034J26672_10090629 JGI24034J26672_100906292 84
188 3300002244 JGI24742J22300_10000515 JGI24742J22300_100005151 84
189 3300002459 JGI24751J29686_10007367 JGI24751J29686_100073674 84
190 3300005333 Ga0070677_10538921 Ga0070677_105389211 84
191 3300005335 Ga0070666_10313295 Ga0070666_103132952 84
192 3300005336 Ga0070680_100132664 Ga0070680_1001326642 84
193 3300005338 Ga0068868_100156231 Ga0068868_1001562313 84
194 3300005339 Ga0070660_100309610 Ga0070660_1003096102 84
195 3300005340 Ga0070689_100008880 Ga0070689_1000088804 84
196 3300005340 Ga0070689_100190789 Ga0070689_1001907892 84
197 3300005340 Ga0070689_101824962 Ga0070689_1018249621 84
198 3300005341 Ga0070691_10003658 Ga0070691_100036581 84
199 3300005341 Ga0070691_10924266 Ga0070691_109242662 84
200 3300005343 Ga0070687_100922540 Ga0070687_1009225401 84
201 3300005345 Ga0070692_10045472 Ga0070692_100454723 84
202 3300005353 Ga0070669_100274591 Ga0070669_1002745912 84
203 3300005354 Ga0070675_100117867 Ga0070675_1001178671 84
204 3300005355 Ga0070671_100061096 Ga0070671_1000610964 84
205 3300005355 Ga0070671_102088947 Ga0070671_1020889472 84
206 3300005356 Ga0070674_100000896 Ga0070674_10000089614 84
207 3300005364 Ga0070673_100132002 Ga0070673_1001320022 84
208 3300005365 Ga0070688_100690413 Ga0070688_1006904132 84
209 3300005366 Ga0070659_100413746 Ga0070659_1004137462 84
210 3300005367 Ga0070667_100001428 Ga0070667_10000142817 84
211 3300005367 Ga0070667_100048517 Ga0070667_1000485176 84
212 3300005435 Ga0070714_100012275 Ga0070714_1000122759 84
213 3300005437 Ga0070710_10000757 Ga0070710_100007577 84
214 3300005437 Ga0070710_10265670 Ga0070710_102656702 84
215 3300005438 Ga0070701_10000936 Ga0070701_1000093611 84
216 3300005439 Ga0070711_100001244 Ga0070711_1000012443 84
217 3300005439 Ga0070711_100021879 Ga0070711_1000218796 84
218 3300005440 Ga0070705_101058414 Ga0070705_1010584142 84
219 3300005441 Ga0070700_100004370 Ga0070700_1000043708 84
220 3300005444 Ga0070694_100071853 Ga0070694_1000718533 84
221 3300005455 Ga0070663_100381144 Ga0070663_1003811442 84
222 3300005456 Ga0070678_100000686 Ga0070678_10000068614 84
223 3300005466 Ga0070685_10203700 Ga0070685_102037003 84
224 3300005536 Ga0070697_101920348 Ga0070697_1019203482 84
225 3300005539 Ga0068853_100011795 Ga0068853_1000117957 84
226 3300005539 Ga0068853_100832533 Ga0068853_1008325332 84
227 3300005543 Ga0070672_100128985 Ga0070672_1001289854 84
228 3300005544 Ga0070686_100192523 Ga0070686_1001925232 84
229 3300005545 Ga0070695_100038333 Ga0070695_1000383334 84
230 3300005546 Ga0070696_100002978 Ga0070696_10000297810 84
231 3300005546 Ga0070696_100170524 Ga0070696_1001705243 84
232 3300005548 Ga0070665_100032322 Ga0070665_1000323221 84
233 3300005548 Ga0070665_100120811 Ga0070665_1001208112 84
234 3300005549 Ga0070704_100000067 Ga0070704_10000006720 84
235 3300005549 Ga0070704_101087943 Ga0070704_1010879432 84
236 3300005563 Ga0068855_101621229 Ga0068855_1016212292 84
237 3300005563 Ga0068855_102389378 Ga0068855_1023893781 84
238 3300005578 Ga0068854_100133932 Ga0068854_1001339323 84
239 3300005616 Ga0068852_100067992 Ga0068852_1000679923 84
240 3300005617 Ga0068859_100023821 Ga0068859_1000238214 84
241 3300005617 Ga0068859_102069662 Ga0068859_1020696622 84
242 3300005618 Ga0068864_100035545 Ga0068864_1000355455 84
243 3300005718 Ga0068866_10001888 Ga0068866_100018885 84
244 3300005718 Ga0068866_10101877 Ga0068866_101018772 84
245 3300005719 Ga0068861_100013874 Ga0068861_10001387410 84
246 3300005719 Ga0068861_100384863 Ga0068861_1003848633 84
247 3300005719 Ga0068861_100704243 Ga0068861_1007042432 84
248 3300005834 Ga0068851_10060512 Ga0068851_100605123 84
249 3300005841 Ga0068863_100323222 Ga0068863_1003232221 84
250 3300005841 Ga0068863_100360867 Ga0068863_1003608673 84
251 3300005842 Ga0068858_100003627 Ga0068858_10000362716 84
252 3300005843 Ga0068860_100001873 Ga0068860_1000018738 84
253 3300005844 Ga0068862_100004548 Ga0068862_1000045484 84
254 3300005844 Ga0068862_100300989 Ga0068862_1003009892 84
255 3300005844 Ga0068862_101091975 Ga0068862_1010919751 84
256 3300005983 Ga0081540_1064746 Ga0081540_10647462 84
257 3300006028 Ga0070717_10516726 Ga0070717_105167263 84
258 3300006038 Ga0075365_10065228 Ga0075365_100652282 84
259 3300006042 Ga0075368_10118983 Ga0075368_101189832 84
260 3300006048 Ga0075363_100046656 Ga0075363_1000466563 84
261 3300006048 Ga0075363_100583813 Ga0075363_1005838132 84
262 3300006048 Ga0075363_100782378 Ga0075363_1007823781 84
263 3300006051 Ga0075364_10031967 Ga0075364_100319672 84
264 3300006051 Ga0075364_10081659 Ga0075364_100816594 84
265 3300006163 Ga0070715_10053684 Ga0070715_100536843 84
266 3300006173 Ga0070716_100038304 Ga0070716_1000383044 84
267 3300006175 Ga0070712_100005216 Ga0070712_1000052164 84
268 3300006175 Ga0070712_100006240 Ga0070712_10000624010 84
269 3300006177 Ga0075362_10023774 Ga0075362_100237744 84
270 3300006186 Ga0075369_10004855 Ga0075369_100048556 84
271 3300006237 Ga0097621_100146739 Ga0097621_1001467393 84
272 3300006353 Ga0075370_10175164 Ga0075370_101751642 84
273 3300006358 Ga0068871_100090028 Ga0068871_1000900284 84
274 3300006881 Ga0068865_100054923 Ga0068865_1000549232 84
275 3300006931 Ga0097620_100023820 Ga0097620_1000238204 84
276 3300006931 Ga0097620_102069625 Ga0097620_1020696252 84
277 3300009092 Ga0105250_10023063 Ga0105250_100230633 84
278 3300009098 Ga0105245_10002934 Ga0105245_100029342 84
279 3300009098 Ga0105245_10189846 Ga0105245_101898463 84
280 3300009098 Ga0105245_10494819 Ga0105245_104948193 84
281 3300009101 Ga0105247_10007322 Ga0105247_100073223 84
282 3300009101 Ga0105247_11057394 Ga0105247_110573942 84
283 3300009147 Ga0114129_10587038 Ga0114129_105870382 84
284 3300009148 Ga0105243_10001892 Ga0105243_1000189210 84
285 3300009148 Ga0105243_10123247 Ga0105243_101232474 84
286 3300009174 Ga0105241_10070822 Ga0105241_100708221 84
287 3300009176 Ga0105242_10003653 Ga0105242_1000365314 84
288 3300009176 Ga0105242_11287971 Ga0105242_112879712 84
289 3300009177 Ga0105248_10030730 Ga0105248_100307303 84
290 3300009177 Ga0105248_10507514 Ga0105248_105075142 84
291 3300009545 Ga0105237_10037561 Ga0105237_100375614 84
292 3300009545 Ga0105237_10846903 Ga0105237_108469032 84
293 3300009551 Ga0105238_10271523 Ga0105238_102715233 84
294 3300009553 Ga0105249_10034660 Ga0105249_100346603 84
295 3300009553 Ga0105249_10294841 Ga0105249_102948413 84
296 3300009553 Ga0105249_10737536 Ga0105249_107375362 84
297 3300010375 Ga0105239_10050198 Ga0105239_100501988 84
298 3300010375 Ga0105239_11191569 Ga0105239_111915692 84
299 3300011119 Ga0105246_10034395 Ga0105246_100343952 84
300 3300013100 Ga0157373_10502005 Ga0157373_105020052 84
301 3300013102 Ga0157371_10195240 Ga0157371_101952402 84
302 3300013105 Ga0157369_10826783 Ga0157369_108267831 84
303 3300013105 Ga0157369_11249968 Ga0157369_112499682 84
304 3300013296 Ga0157374_10085471 Ga0157374_100854712 84
305 3300013296 Ga0157374_10136824 Ga0157374_101368243 84
306 3300013297 Ga0157378_10000749 Ga0157378_100007494 84
307 3300013297 Ga0157378_10169887 Ga0157378_101698873 84
308 3300013306 Ga0163162_10006559 Ga0163162_100065597 84
309 3300013306 Ga0163162_10140182 Ga0163162_101401823 84
310 3300013306 Ga0163162_10375304 Ga0163162_103753043 84
311 3300013306 Ga0163162_12252913 Ga0163162_122529131 84
312 3300013307 Ga0157372_10093928 Ga0157372_100939282 84
313 3300013307 Ga0157372_10171540 Ga0157372_101715405 84
314 3300013308 Ga0157375_10013118 Ga0157375_100131183 84
315 3300013308 Ga0157375_10361649 Ga0157375_103616493 84
316 3300014325 Ga0163163_10124808 Ga0163163_101248083 84
317 3300014325 Ga0163163_11914968 Ga0163163_119149681 84
318 3300014326 Ga0157380_10002388 Ga0157380_100023887 84
319 3300014326 Ga0157380_10195347 Ga0157380_101953473 84
320 3300014497 Ga0182008_10499095 Ga0182008_104990952 84
321 3300014745 Ga0157377_10037870 Ga0157377_100378705 84
322 3300014745 Ga0157377_10082881 Ga0157377_100828813 84
323 3300014968 Ga0157379_10024948 Ga0157379_100249482 84
324 3300014968 Ga0157379_11195655 Ga0157379_111956552 84
325 3300014969 Ga0157376_10043615 Ga0157376_100436155 84
326 3300014969 Ga0157376_10082415 Ga0157376_100824154 84
327 3300017792 Ga0163161_10058377 Ga0163161_100583774 84
328 3300017792 Ga0163161_10284669 Ga0163161_102846692 84
329 3300021358 Ga0213873_10188601 Ga0213873_101886011 84
330 3300021388 Ga0213875_10024382 Ga0213875_100243823 84
331 3300025321 Ga0207656_10452744 Ga0207656_104527442 84
332 3300025885 Ga0207653_10071124 Ga0207653_100711242 84
333 3300025898 Ga0207692_10001181 Ga0207692_100011819 84
334 3300025898 Ga0207692_10038390 Ga0207692_100383903 84
335 3300025898 Ga0207692_10098595 Ga0207692_100985952 84
336 3300025899 Ga0207642_10000298 Ga0207642_100002989 84
337 3300025900 Ga0207710_10004941 Ga0207710_100049413 84
338 3300025900 Ga0207710_10741882 Ga0207710_107418822 84
339 3300025901 Ga0207688_10017752 Ga0207688_100177525 84
340 3300025901 Ga0207688_10027795 Ga0207688_100277953 84
341 3300025904 Ga0207647_10047021 Ga0207647_100470214 84
342 3300025905 Ga0207685_10082925 Ga0207685_100829252 84
343 3300025906 Ga0207699_10037229 Ga0207699_100372293 84
344 3300025906 Ga0207699_10052570 Ga0207699_100525704 84
345 3300025907 Ga0207645_10006992 Ga0207645_100069928 84
346 3300025907 Ga0207645_10030445 Ga0207645_100304456 84
347 3300025911 Ga0207654_10021736 Ga0207654_100217365 84
348 3300025911 Ga0207654_11357456 Ga0207654_113574561 84
349 3300025915 Ga0207693_10022627 Ga0207693_100226279 84
350 3300025916 Ga0207663_10081981 Ga0207663_100819812 84
351 3300025917 Ga0207660_11313937 Ga0207660_113139371 84
352 3300025918 Ga0207662_10135344 Ga0207662_101353443 84
353 3300025920 Ga0207649_11469919 Ga0207649_114699192 84
354 3300025923 Ga0207681_10037058 Ga0207681_100370584 84
355 3300025923 Ga0207681_10184399 Ga0207681_101843993 84
356 3300025924 Ga0207694_10119702 Ga0207694_101197023 84
357 3300025926 Ga0207659_11126192 Ga0207659_111261921 84
358 3300025927 Ga0207687_10000787 Ga0207687_100007877 84
359 3300025927 Ga0207687_10107299 Ga0207687_101072994 84
360 3300025929 Ga0207664_10035288 Ga0207664_100352885 84
361 3300025929 Ga0207664_11551397 Ga0207664_115513972 84
362 3300025931 Ga0207644_10055683 Ga0207644_100556835 84
363 3300025931 Ga0207644_10150319 Ga0207644_101503193 84
364 3300025932 Ga0207690_10006108 Ga0207690_100061086 84
365 3300025933 Ga0207706_10005968 Ga0207706_1000596812 84
366 3300025935 Ga0207709_10027163 Ga0207709_100271635 84
367 3300025935 Ga0207709_10087047 Ga0207709_100870472 84
368 3300025937 Ga0207669_10046156 Ga0207669_100461563 84
369 3300025938 Ga0207704_10000348 Ga0207704_1000034819 84
370 3300025938 Ga0207704_10637685 Ga0207704_106376851 84
371 3300025939 Ga0207665_10003947 Ga0207665_100039473 84
372 3300025939 Ga0207665_10004368 Ga0207665_1000436811 84
373 3300025940 Ga0207691_10078966 Ga0207691_100789663 84
374 3300025941 Ga0207711_10014542 Ga0207711_100145424 84
375 3300025941 Ga0207711_10238177 Ga0207711_102381773 84
376 3300025941 Ga0207711_10458387 Ga0207711_104583871 84
377 3300025942 Ga0207689_10002180 Ga0207689_1000218011 84
378 3300025942 Ga0207689_10027743 Ga0207689_100277431 84
379 3300025961 Ga0207712_10028701 Ga0207712_100287013 84
380 3300025961 Ga0207712_10520009 Ga0207712_105200092 84
381 3300025961 Ga0207712_10662584 Ga0207712_106625842 84
382 3300025972 Ga0207668_10005313 Ga0207668_100053133 84
383 3300025972 Ga0207668_10178540 Ga0207668_101785403 84
384 3300025981 Ga0207640_10054970 Ga0207640_100549703 84
385 3300025981 Ga0207640_10189603 Ga0207640_101896033 84
386 3300025981 Ga0207640_10602302 Ga0207640_106023023 84
387 3300025986 Ga0207658_10044332 Ga0207658_100443323 84
388 3300025986 Ga0207658_10285037 Ga0207658_102850371 84
389 3300025986 Ga0207658_11744179 Ga0207658_117441792 84
390 3300026023 Ga0207677_10017210 Ga0207677_100172101 84
391 3300026023 Ga0207677_10050166 Ga0207677_100501664 84
392 3300026035 Ga0207703_10009434 Ga0207703_100094346 84
393 3300026035 Ga0207703_10042930 Ga0207703_100429303 84
394 3300026041 Ga0207639_10393440 Ga0207639_103934401 84
395 3300026067 Ga0207678_10039154 Ga0207678_100391542 84
396 3300026067 Ga0207678_10066530 Ga0207678_100665305 84
397 3300026075 Ga0207708_10000696 Ga0207708_1000069621 84
398 3300026075 Ga0207708_10010104 Ga0207708_100101048 84
399 3300026088 Ga0207641_10211917 Ga0207641_102119171 84
400 3300026088 Ga0207641_10232667 Ga0207641_102326673 84
401 3300026089 Ga0207648_10003748 Ga0207648_1000374810 84
402 3300026095 Ga0207676_10032203 Ga0207676_100322034 84
403 3300026118 Ga0207675_100000897 Ga0207675_10000089710 84
404 3300026118 Ga0207675_100147585 Ga0207675_1001475854 84
405 3300026118 Ga0207675_100719120 Ga0207675_1007191202 84
406 3300026121 Ga0207683_10000413 Ga0207683_1000041310 84
407 3300026121 Ga0207683_10051058 Ga0207683_100510583 84
408 3300026142 Ga0207698_10072441 Ga0207698_100724414 84
409 3300028379 Ga0268266_10002437 Ga0268266_100024375 84
410 3300028379 Ga0268266_10393897 Ga0268266_103938973 84
411 3300028380 Ga0268265_10036115 Ga0268265_100361153 84
412 3300028380 Ga0268265_10045597 Ga0268265_100455974 84
413 3300028381 Ga0268264_10001236 Ga0268264_100012369 84
414 3300028381 Ga0268264_10469433 Ga0268264_104694333 84
415 3300031852 Ga0307410_11437538 Ga0307410_114375381 84
416 3300031995 Ga0307409_100417513 Ga0307409_1004175132 84
417 3300032002 Ga0307416_102760732 Ga0307416_1027607322 84
418 3300035085 Ga0373929_0133108 Ga0373929_0133108_222_485 84
419 3300035092 Ga0373952_0045350 Ga0373952_0045350_610_873 84
420 3300035112 Ga0373932_0140981 Ga0373932_0140981_334_597 84
421 3300035114 Ga0373939_0096195 Ga0373939_0096195_197_460 84
422 3300035114 Ga0373939_0175267 Ga0373939_0175267_491_754 84
423 3300035115 Ga0373941_0049213 Ga0373941_0049213_738_1001 84
424 3300035121 Ga0373960_0059289 Ga0373960_0059289_585_848 84
425 3300035207 Ga0373942_0085691 Ga0373942_0085691_640_903 84
426 3300035241 Ga0373961_0049759 Ga0373961_0049759_806_1069 84
427 3300035691 Ga0373931_0205317 Ga0373931_0205317_119_382 84
428 3300036712 Ga0316584_0009567 Ga0316584_0009567_3921_4184 84
429 3300037418 Ga0395900_1474356 Ga0395900_1474356_223_486 84
430 3300037853 Ga0436364_0325252 Ga0436364_0325252_7962_8225 84
431 3300039437 Ga0436365_1462010 Ga0436365_1462010_2750_3013 84
432 3300039453 Ga0436362_1140811 Ga0436362_1140811_350_613 84
433 3300041512 Ga0451853_2423564 Ga0451853_2423564_146_409 84
434 3300044656 Ga0466969_0107692 Ga0466969_0107692_299_562 84
435 3300044658 Ga0466972_0010733 Ga0466972_0010733_1742_2005 84
436 3300044658 Ga0466972_0039852 Ga0466972_0039852_64_327 84
437 3300044658 Ga0466972_0114372 Ga0466972_0114372_137_400 84
438 3300044658 Ga0466972_0221576 Ga0466972_0221576_62_325 84
439 3300044683 Ga0466965_0077219 Ga0466965_0077219_242_505 84
440 3300044684 Ga0466966_0463830 Ga0466966_0463830_316_579 84
441 3300044693 Ga0466961_0045929 Ga0466961_0045929_430_693 84
442 3300044719 Ga0466971_0008530 Ga0466971_0008530_2596_2859 84
443 3300044735 Ga0466968_0076810 Ga0466968_0076810_1053_1316 84
444 3300044735 Ga0466968_0423255 Ga0466968_0423255_213_476 84
445 3300044765 Ga0466970_0003840 Ga0466970_0003840_1665_1928 84
446 3300044842 Ga0466957_0009732 Ga0466957_0009732_977_1240 84
447 3300044901 Ga0466960_0014871 Ga0466960_0014871_1137_1400 84
448 3300044901 Ga0466960_0095270 Ga0466960_0095270_745_1008 84
449 3300044901 Ga0466960_0193779 Ga0466960_0193779_671_934 84
450 3300044901 Ga0466960_0946408 Ga0466960_0946408_51_314 84
451 3300045049 Ga0466959_0021429 Ga0466959_0021429_1255_1518 84
452 3300045049 Ga0466959_0380987 Ga0466959_0380987_44_307 84
453 3300045836 Ga0466958_0002994 Ga0466958_0002994_1680_1943 84
454 3300048903 Ga0496100_0004372 Ga0496100_0004372_6101_6364 84
455 3300048903 Ga0496100_0683833 Ga0496100_0683833_392_655 84
456 3300048904 Ga0496101_0014567 Ga0496101_0014567_4629_4892 84
457 3300048904 Ga0496101_0070129 Ga0496101_0070129_35_298 84
458 3300048904 Ga0496101_1190226 Ga0496101_1190226_206_469 84
459 3300048905 Ga0496102_0005139 Ga0496102_0005139_2507_2770 84
460 3300048905 Ga0496102_0211477 Ga0496102_0211477_659_922 84
461 3300048905 Ga0496102_0268435 Ga0496102_0268435_120_383 84
462 3300048906 Ga0496103_0000592 Ga0496103_0000592_23988_24251 84
463 3300048906 Ga0496103_0058753 Ga0496103_0058753_796_1059 84
464 3300048907 Ga0496104_0010831 Ga0496104_0010831_1843_2106 84
465 3300048907 Ga0496104_0148926 Ga0496104_0148926_1032_1295 84
466 3300048908 Ga0496105_0107787 Ga0496105_0107787_404_667 84
467 3300048909 Ga0496106_0003432 Ga0496106_0003432_2920_3183 84
468 3300048909 Ga0496106_0331647 Ga0496106_0331647_76_339 84
469 3300048910 Ga0496107_0000802 Ga0496107_0000802_3447_3710 84
470 3300048910 Ga0496107_0152444 Ga0496107_0152444_721_984 84
471 3300048911 Ga0496108_0003955 Ga0496108_0003955_7409_7672 84
472 3300048911 Ga0496108_0278538 Ga0496108_0278538_1183_1446 84
473 3300048912 Ga0496109_0006471 Ga0496109_0006471_7130_7393 84
474 3300048912 Ga0496109_0050253 Ga0496109_0050253_2952_3215 84
475 3300048913 Ga0496110_0084323 Ga0496110_0084323_1556_1819 84
476 3300048913 Ga0496110_0146096 Ga0496110_0146096_15_278 84
477 3300048914 Ga0496111_0874220 Ga0496111_0874220_162_425 84
478 3300048915 Ga0496112_0003857 Ga0496112_0003857_8311_8574 84
479 3300048915 Ga0496112_0043159 Ga0496112_0043159_820_1083 84
480 3300048916 Ga0496113_0035604 Ga0496113_0035604_3304_3567 84
481 3300048917 Ga0496114_0000487 Ga0496114_0000487_19823_20086 84
482 3300048918 Ga0496115_0018299 Ga0496115_0018299_872_1135 84
483 3300048918 Ga0496115_0048925 Ga0496115_0048925_49_312 84
484 3300050489 nmdc:mga03683_51840_c1 nmdc:mga03683_51840_c1_449_712 84
485 3300050490 nmdc:mga03n38_175726_c1 nmdc:mga03n38_175726_c1_65_328 84
486 3300050490 nmdc:mga03n38_464648_c1 nmdc:mga03n38_464648_c1_86_349 84
487 3300050492 nmdc:mga0yw44_26172_c1 nmdc:mga0yw44_26172_c1_1267_1530 84
488 3300050495 nmdc:mga04h51_190272_c1 nmdc:mga04h51_190272_c1_106_369 84
489 3300050496 nmdc:mga07m45_149775_c1 nmdc:mga07m45_149775_c1_946_1209 84
490 3300050516 nmdc:mga0sz30_20867_c1 nmdc:mga0sz30_20867_c1_1051_1314 84
491 3300053083 Ga0495655_0046550 Ga0495655_0046550_91_354 84
492 3300061719 Ga0466962_0223413 Ga0466962_0223413_185_448 84
493 3300006048 Ga0075363_100533877 Ga0075363_1005338772 85
494 3300006051 Ga0075364_10748554 Ga0075364_107485542 85
495 3300009545 Ga0105237_10248172 Ga0105237_102481723 85
496 3300013105 Ga0157369_10817910 Ga0157369_108179102 85
497 iso_pu_bacteria 2738541274 2738702689 85
498 iso_pu_bacteria 2738543028 2739329599 85
499 iso_pu_bacteria 2902799365 2902803175 86
500 3300005435 Ga0070714_101057289 Ga0070714_1010572891 87
501 3300006028 Ga0070717_10082371 Ga0070717_100823712 87
502 3300021388 Ga0213875_10079894 Ga0213875_100798941 87
503 3300025929 Ga0207664_11675566 Ga0207664_116755662 87
504 3300037853 Ga0436364_1461304 Ga0436364_1461304_1081_1362 87
505 3300044656 Ga0466969_0042194 Ga0466969_0042194_1996_2268 87
506 3300044684 Ga0466966_0039209 Ga0466966_0039209_1093_1365 87
507 3300044693 Ga0466961_0017737 Ga0466961_0017737_2492_2764 87
508 3300044694 Ga0466963_0074610 Ga0466963_0074610_842_1114 87
509 3300044719 Ga0466971_0141353 Ga0466971_0141353_749_1021 87
510 3300044735 Ga0466968_0621185 Ga0466968_0621185_138_410 87
511 3300044765 Ga0466970_0691567 Ga0466970_0691567_228_500 87
512 3300044842 Ga0466957_0035760 Ga0466957_0035760_881_1153 87
513 3300044901 Ga0466960_0020752 Ga0466960_0020752_1034_1318 87
514 3300045049 Ga0466959_0086556 Ga0466959_0086556_1673_1945 87
515 3300045836 Ga0466958_0003841 Ga0466958_0003841_7112_7384 87
516 3300049570 Ga0501033_0061936 Ga0501033_0061936_1096_1368 87
517 3300049572 Ga0501036_0676913 Ga0501036_0676913_229_501 87
518 3300049573 Ga0501037_0069065 Ga0501037_0069065_2107_2379 87
519 3300049575 Ga0501039_0805579 Ga0501039_0805579_140_412 87
520 3300049581 Ga0501047_0046761 Ga0501047_0046761_1274_1546 87
521 3300049582 Ga0501048_0258816 Ga0501048_0258816_449_721 87
522 3300049585 Ga0501069_0048928 Ga0501069_0048928_16_288 87
523 3300049822 Ga0501035_0001193 Ga0501035_0001193_21660_21932 87
524 3300049823 Ga0501044_0000320 Ga0501044_0000320_27101_27373 87
525 3300005337 Ga0070682_101526051 Ga0070682_1015260512 88
526 3300005842 Ga0068858_101335080 Ga0068858_1013350802 88
527 3300028381 Ga0268264_12311814 Ga0268264_123118142 88
528 3300031728 Ga0316578_10043613 Ga0316578_100436133 88
529 3300044684 Ga0466966_0006273 Ga0466966_0006273_7235_7510 88
530 3300044684 Ga0466966_0059717 Ga0466966_0059717_451_726 88
531 3300044693 Ga0466961_0007216 Ga0466961_0007216_638_913 88
532 3300044694 Ga0466963_0270292 Ga0466963_0270292_668_943 88
533 3300044719 Ga0466971_0691497 Ga0466971_0691497_75_350 88
534 3300044735 Ga0466968_0012169 Ga0466968_0012169_2943_3218 88
535 3300044765 Ga0466970_0014438 Ga0466970_0014438_217_492 88
536 3300044842 Ga0466957_0606800 Ga0466957_0606800_197_472 88
537 3300045836 Ga0466958_0023804 Ga0466958_0023804_3086_3361 88
538 3300045976 Ga0466967_0948806 Ga0466967_0948806_515_790 88
539 3300048905 Ga0496102_0207986 Ga0496102_0207986_192_467 88
540 3300049570 Ga0501033_0092261 Ga0501033_0092261_291_578 88
541 3300049581 Ga0501047_0030230 Ga0501047_0030230_4648_4935 88
542 3300049581 Ga0501047_0385658 Ga0501047_0385658_526_801 88
543 3300049742 Ga0501080_0189438 Ga0501080_0189438_873_1160 88
544 3300049822 Ga0501035_0118991 Ga0501035_0118991_1483_1770 88
545 3300049822 Ga0501035_0370584 Ga0501035_0370584_875_1162 88
546 3300049823 Ga0501044_0076931 Ga0501044_0076931_2933_3220 88
547 3300061719 Ga0466962_0623714 Ga0466962_0623714_24_299 88
548 2010549000 RicEn_FSXC29203_g1 RicEn_330580 89
549 3300001990 JGI24737J22298_10039093 JGI24737J22298_100390931 89
550 3300002075 JGI24738J21930_10118491 JGI24738J21930_101184912 89
551 3300002077 JGI24744J21845_10000637 JGI24744J21845_100006373 89
552 3300002077 JGI24744J21845_10001167 JGI24744J21845_100011674 89
553 3300005328 Ga0070676_10122740 Ga0070676_101227404 89
554 3300005330 Ga0070690_100010439 Ga0070690_1000104392 89
555 3300005334 Ga0068869_100062777 Ga0068869_1000627772 89
556 3300005335 Ga0070666_10003954 Ga0070666_1000395412 89
557 3300005337 Ga0070682_100057276 Ga0070682_1000572764 89
558 3300005337 Ga0070682_101891290 Ga0070682_1018912901 89
559 3300005338 Ga0068868_100003443 Ga0068868_10000344314 89
560 3300005338 Ga0068868_102368094 Ga0068868_1023680941 89
561 3300005344 Ga0070661_101222783 Ga0070661_1012227832 89
562 3300005347 Ga0070668_100008713 Ga0070668_10000871310 89
563 3300005347 Ga0070668_100210006 Ga0070668_1002100063 89
564 3300005353 Ga0070669_100037908 Ga0070669_1000379083 89
565 3300005355 Ga0070671_100389561 Ga0070671_1003895611 89
566 3300005355 Ga0070671_101635248 Ga0070671_1016352481 89
567 3300005356 Ga0070674_100251026 Ga0070674_1002510262 89
568 3300005367 Ga0070667_100284911 Ga0070667_1002849113 89
569 3300005434 Ga0070709_10008036 Ga0070709_100080364 89
570 3300005440 Ga0070705_100187850 Ga0070705_1001878502 89
571 3300005441 Ga0070700_100187860 Ga0070700_1001878603 89
572 3300005444 Ga0070694_100047718 Ga0070694_1000477185 89
573 3300005445 Ga0070708_100886327 Ga0070708_1008863272 89
574 3300005455 Ga0070663_100016744 Ga0070663_1000167446 89
575 3300005455 Ga0070663_100303454 Ga0070663_1003034543 89
576 3300005455 Ga0070663_100380009 Ga0070663_1003800092 89
577 3300005456 Ga0070678_100151521 Ga0070678_1001515213 89
578 3300005459 Ga0068867_100034236 Ga0068867_1000342361 89
579 3300005467 Ga0070706_100972900 Ga0070706_1009729002 89
580 3300005548 Ga0070665_100008810 Ga0070665_1000088109 89
581 3300005548 Ga0070665_101478202 Ga0070665_1014782022 89
582 3300005577 Ga0068857_101101273 Ga0068857_1011012732 89
583 3300005578 Ga0068854_100002312 Ga0068854_1000023123 89
584 3300005578 Ga0068854_100343085 Ga0068854_1003430852 89
585 3300005614 Ga0068856_101600414 Ga0068856_1016004141 89
586 3300005615 Ga0070702_100001268 Ga0070702_1000012681 89
587 3300005615 Ga0070702_100012484 Ga0070702_1000124843 89
588 3300005616 Ga0068852_100239638 Ga0068852_1002396383 89
589 3300005618 Ga0068864_100279418 Ga0068864_1002794183 89
590 3300005843 Ga0068860_101897932 Ga0068860_1018979322 89
591 3300005937 Ga0081455_10100590 Ga0081455_101005904 89
592 3300006038 Ga0075365_10002248 Ga0075365_100022485 89
593 3300006038 Ga0075365_10238274 Ga0075365_102382742 89
594 3300006038 Ga0075365_10679375 Ga0075365_106793752 89
595 3300006042 Ga0075368_10018491 Ga0075368_100184912 89
596 3300006042 Ga0075368_10217181 Ga0075368_102171812 89
597 3300006042 Ga0075368_10379182 Ga0075368_103791822 89
598 3300006048 Ga0075363_100005367 Ga0075363_1000053673 89
599 3300006048 Ga0075363_100010660 Ga0075363_1000106603 89
600 3300006048 Ga0075363_100057463 Ga0075363_1000574634 89
601 3300006048 Ga0075363_100198497 Ga0075363_1001984972 89
602 3300006051 Ga0075364_10004076 Ga0075364_100040763 89
603 3300006051 Ga0075364_10033199 Ga0075364_100331995 89
604 3300006051 Ga0075364_10044023 Ga0075364_100440233 89
605 3300006051 Ga0075364_10061163 Ga0075364_100611634 89
606 3300006051 Ga0075364_10146126 Ga0075364_101461262 89
607 3300006051 Ga0075364_10862275 Ga0075364_108622752 89
608 3300006173 Ga0070716_100001157 Ga0070716_1000011572 89
609 3300006177 Ga0075362_10721787 Ga0075362_107217871 89
610 3300006178 Ga0075367_10049051 Ga0075367_100490513 89
611 3300006178 Ga0075367_10233701 Ga0075367_102337012 89
612 3300006186 Ga0075369_10030555 Ga0075369_100305551 89
613 3300006186 Ga0075369_10076913 Ga0075369_100769131 89
614 3300006186 Ga0075369_10103686 Ga0075369_101036863 89
615 3300006186 Ga0075369_10111547 Ga0075369_101115472 89
616 3300006186 Ga0075369_10515401 Ga0075369_105154012 89
617 3300006195 Ga0075366_10591606 Ga0075366_105916062 89
618 3300006353 Ga0075370_10006409 Ga0075370_100064095 89
619 3300006353 Ga0075370_10097864 Ga0075370_100978643 89
620 3300006353 Ga0075370_10847523 Ga0075370_108475232 89
621 3300006844 Ga0075428_100009997 Ga0075428_1000099979 89
622 3300006846 Ga0075430_100009331 Ga0075430_1000093319 89
623 3300006847 Ga0075431_100211932 Ga0075431_1002119324 89
624 3300006881 Ga0068865_100002054 Ga0068865_1000020542 89
625 3300009094 Ga0111539_13538663 Ga0111539_135386631 89
626 3300009147 Ga0114129_10036824 Ga0114129_100368248 89
627 3300013306 Ga0163162_11843176 Ga0163162_118431762 89
628 3300017792 Ga0163161_10236801 Ga0163161_102368013 89
629 3300021377 Ga0213874_10040689 Ga0213874_100406892 89
630 3300021384 Ga0213876_10006209 Ga0213876_100062095 89
631 3300021384 Ga0213876_10088697 Ga0213876_100886973 89
632 3300021384 Ga0213876_10190833 Ga0213876_101908332 89
633 3300025294 Ga0209025_1116270 Ga0209025_11162702 89
634 3300025303 Ga0209051_1141086 Ga0209051_11410861 89
635 3300025315 Ga0207697_10077866 Ga0207697_100778663 89
636 3300025899 Ga0207642_10472026 Ga0207642_104720262 89
637 3300025906 Ga0207699_10458653 Ga0207699_104586531 89
638 3300025910 Ga0207684_10685299 Ga0207684_106852992 89
639 3300025914 Ga0207671_10116398 Ga0207671_101163982 89
640 3300025915 Ga0207693_10006231 Ga0207693_1000623112 89
641 3300025916 Ga0207663_10011886 Ga0207663_100118867 89
642 3300025919 Ga0207657_11367101 Ga0207657_113671011 89
643 3300025921 Ga0207652_10433294 Ga0207652_104332942 89
644 3300025928 Ga0207700_10551822 Ga0207700_105518223 89
645 3300025931 Ga0207644_11473861 Ga0207644_114738611 89
646 3300025934 Ga0207686_10837404 Ga0207686_108374042 89
647 3300025936 Ga0207670_10172990 Ga0207670_101729903 89
648 3300025937 Ga0207669_10874645 Ga0207669_108746452 89
649 3300025961 Ga0207712_10033947 Ga0207712_100339471 89
650 3300025972 Ga0207668_10067835 Ga0207668_100678352 89
651 3300025981 Ga0207640_11393651 Ga0207640_113936512 89
652 3300026023 Ga0207677_11830171 Ga0207677_118301711 89
653 3300026067 Ga0207678_10598207 Ga0207678_105982072 89
654 3300026075 Ga0207708_10631516 Ga0207708_106315162 89
655 3300026095 Ga0207676_10334926 Ga0207676_103349263 89
656 3300027866 Ga0209813_10193277 Ga0209813_101932771 89
657 3300027866 Ga0209813_10350551 Ga0209813_103505512 89
658 3300031548 Ga0307408_100229271 Ga0307408_1002292713 89
659 3300031824 Ga0307413_10015428 Ga0307413_100154286 89
660 3300031852 Ga0307410_11811283 Ga0307410_118112831 89
661 3300031901 Ga0307406_10222048 Ga0307406_102220482 89
662 3300031903 Ga0307407_10263560 Ga0307407_102635603 89
663 3300031995 Ga0307409_100049085 Ga0307409_1000490855 89
664 3300031995 Ga0307409_100439392 Ga0307409_1004393923 89
665 3300032002 Ga0307416_100071088 Ga0307416_1000710884 89
666 3300032004 Ga0307414_10485839 Ga0307414_104858391 89
667 3300032126 Ga0307415_100312749 Ga0307415_1003127491 89
668 3300037853 Ga0436364_0374418 Ga0436364_0374418_8570_8872 89
669 3300039437 Ga0436365_0787906 Ga0436365_0787906_70_360 89
670 3300039437 Ga0436365_1001910 Ga0436365_1001910_1527_1805 89
671 3300039437 Ga0436365_1621114 Ga0436365_1621114_35869_36171 89
672 3300039438 Ga0436360_0656772 Ga0436360_0656772_1024_1305 89
673 3300039450 Ga0436363_0761249 Ga0436363_0761249_1404_1682 89
674 3300039450 Ga0436363_0978816 Ga0436363_0978816_44_322 89
675 3300041411 Ga0439466_0004312 Ga0439466_0004312_1340_1624 89
676 3300041413 Ga0439465_0000668 Ga0439465_0000668_4297_4581 89
677 3300041505 Ga0451849_1280191 Ga0451849_1280191_271_567 89
678 3300041997 Ga0439431_0038262 Ga0439431_0038262_504_788 89
679 3300041999 Ga0439433_0168933 Ga0439433_0168933_164_448 89
680 3300042004 Ga0439445_0035264 Ga0439445_0035264_628_912 89
681 3300042005 Ga0439448_0229730 Ga0439448_0229730_310_591 89
682 3300042435 Ga0439434_0026438 Ga0439434_0026438_1242_1526 89
683 3300044658 Ga0466972_0130209 Ga0466972_0130209_657_941 89
684 3300044683 Ga0466965_0050447 Ga0466965_0050447_1509_1793 89
685 3300044683 Ga0466965_0133623 Ga0466965_0133623_374_658 89
686 3300044683 Ga0466965_0269707 Ga0466965_0269707_333_614 89
687 3300044706 Ga0466964_0266824 Ga0466964_0266824_82_363 89
688 3300044901 Ga0466960_0000372 Ga0466960_0000372_8266_8550 89
689 3300045976 Ga0466967_1127677 Ga0466967_1127677_291_572 89
690 3300046460 Ga0495638_0011643 Ga0495638_0011643_5176_5454 89
691 3300047320 Ga0495672_0061989 Ga0495672_0061989_1107_1385 89
692 3300048903 Ga0496100_0013521 Ga0496100_0013521_1176_1457 89
693 3300048904 Ga0496101_0078929 Ga0496101_0078929_1891_2172 89
694 3300048904 Ga0496101_1331008 Ga0496101_1331008_185_463 89
695 3300048905 Ga0496102_0124596 Ga0496102_0124596_924_1205 89
696 3300048905 Ga0496102_0522728 Ga0496102_0522728_177_458 89
697 3300048912 Ga0496109_1992538 Ga0496109_1992538_29_307 89
698 3300048915 Ga0496112_0080879 Ga0496112_0080879_1823_2104 89
699 3300048916 Ga0496113_0132410 Ga0496113_0132410_1005_1286 89
700 3300048916 Ga0496113_0674819 Ga0496113_0674819_290_574 89
701 3300048918 Ga0496115_1364742 Ga0496115_1364742_78_356 89
702 3300048920 Ga0496117_0145344 Ga0496117_0145344_832_1113 89
703 3300048924 Ga0496121_0875928 Ga0496121_0875928_135_413 89
704 3300048925 Ga0496122_0030344 Ga0496122_0030344_373_654 89
705 3300048926 Ga0496123_0039432 Ga0496123_0039432_382_663 89
706 3300048928 Ga0496125_0233111 Ga0496125_0233111_230_508 89
707 3300048928 Ga0496125_0401811 Ga0496125_0401811_468_749 89
708 3300048929 Ga0496126_0001976 Ga0496126_0001976_27474_27755 89
709 3300048929 Ga0496126_0161474 Ga0496126_0161474_1567_1845 89
710 3300049571 Ga0501034_0056731 Ga0501034_0056731_3274_3555 89
711 3300049581 Ga0501047_0359591 Ga0501047_0359591_596_877 89
712 3300049586 Ga0501070_0627289 Ga0501070_0627289_507_803 89
713 3300049586 Ga0501070_0764524 Ga0501070_0764524_33_314 89
714 3300049742 Ga0501080_0946515 Ga0501080_0946515_458_739 89
715 3300050489 nmdc:mga03683_9067_c1 nmdc:mga03683_9067_c1_42_323 89
716 3300050490 nmdc:mga03n38_13535_c1 nmdc:mga03n38_13535_c1_2422_2718 89
717 3300050491 nmdc:mga00v17_259639_c1 nmdc:mga00v17_259639_c1_247_528 89
718 3300050491 nmdc:mga00v17_348190_c1 nmdc:mga00v17_348190_c1_652_933 89
719 3300050491 nmdc:mga00v17_43343_c1 nmdc:mga00v17_43343_c1_2071_2352 89
720 3300050491 nmdc:mga00v17_447438_c1 nmdc:mga00v17_447438_c1_491_787 89
721 3300050492 nmdc:mga0yw44_1008405_c1 nmdc:mga0yw44_1008405_c1_177_458 89
722 3300050492 nmdc:mga0yw44_460411_c1 nmdc:mga0yw44_460411_c1_59_340 89
723 3300050496 nmdc:mga07m45_160768_c1 nmdc:mga07m45_160768_c1_387_683 89
724 3300050507 nmdc:mga05p37_144066_c1 nmdc:mga05p37_144066_c1_442_723 89
725 3300050509 nmdc:mga0qj67_8192_c1 nmdc:mga0qj67_8192_c1_935_1216 89
726 3300050510 nmdc:mga06r32_908187_c1 nmdc:mga06r32_908187_c1_140_421 89
727 3300050516 nmdc:mga0sz30_244077_c1 nmdc:mga0sz30_244077_c1_450_731 89
728 3300050516 nmdc:mga0sz30_279036_c1 nmdc:mga0sz30_279036_c1_218_496 89
729 3300050516 nmdc:mga0sz30_92030_c1 nmdc:mga0sz30_92030_c1_254_538 89
730 3300053080 Ga0500635_0012614 Ga0500635_0012614_1425_1703 89
731 3300053087 Ga0500643_008087 Ga0500643_008087_3329_3607 89
732 3300053098 Ga0500650_0163551 Ga0500650_0163551_672_950 89
733 3300053130 Ga0500642_0158899 Ga0500642_0158899_588_866 89
734 3300053131 Ga0500652_002160 Ga0500652_002160_4274_4552 89
735 3300053131 Ga0500652_254686 Ga0500652_254686_181_459 89
736 3300053134 Ga0500658_0565477 Ga0500658_0565477_138_416 89
737 3300053136 Ga0500559_0519899 Ga0500559_0519899_209_487 89
738 3300053139 Ga0500568_0140430 Ga0500568_0140430_311_589 89
739 3300053146 Ga0500588_0105197 Ga0500588_0105197_58_336 89
740 3300053146 Ga0500588_0153564 Ga0500588_0153564_86_364 89
741 3300053158 Ga0500627_0004036 Ga0500627_0004036_601_879 89
742 3300053730 Ga0500645_000104 Ga0500645_000104_19098_19376 89
743 3300053730 Ga0500645_012533 Ga0500645_012533_1809_2087 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10724

DUF2516

Protein of unknown function (DUF2516)

9

99

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t49-assembly1.cif.gz_A crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom 0.4901 17 87
2qff-assembly1.cif.gz_A crystal structure of staphylococcal complement inhibitor 0.4701 13 84
3t49-assembly1.cif.gz_A crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom 0.4683 17 87
4h6h-assembly2.cif.gz_B crystal structure of staphylococcal complement inhibitor scin-b(4-85) 0.4647 11 87
2qff-assembly1.cif.gz_A crystal structure of staphylococcal complement inhibitor 0.454 13 84
ID Description Score Start End Superfamily
af_P9WKW1_1_86_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.9611 11 88 1.20.140.150
af_P9WKW1_1_86_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8636 11 88 1.20.140.150
af_P37147_6_115_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6455 8 88 1.10.1760.20
af_Q54CS1_1_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6239 3 76 1.20.1250.20
af_Q8GUM2_551_650_1.20.1270.10 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.5692 3 86 1.20.1270.10
ID Description Score Start End GO Terms
AF-A0A375YU08-F1-model_v4 Transmembrane protein [Mycobacterium tuberculosis H37Rv] 0.9969 14 88 GO:0016020
AF-A4T311-F1-model_v4 Conserved membrane protein 0.9937 2 88 GO:0016020
AF-A0A1A1YBK0-F1-model_v4 deleted 0.9886 2 88
AF-A0A3L8NWY0-F1-model_v4 DUF2516 family protein 0.9875 9 88 GO:0016020
AF-A0A7I7PEC5-F1-model_v4 DUF2516 domain-containing protein 0.9867 6 88 GO:0016020

Feature Viewer

pLDDT pTM Quality
95.62 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map