F478687
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 349 | 740 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10006209|Ga0213876_100062095 |
| Length | 100 |
| Sequence | MPAYPLGVSQVVGIVMLVIWIAILVMAVYAFVHAAMQRPDAYTAADKLTKPVWLVILGAAVALNAVRVFGVLGMAIAACAAGVYLVDVRPKLLEIQGKSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 4 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 339 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 342 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 343 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.8 |
| Nodule | 0 |
| Rhizoplane | 8.21 |
| Rhizosphere | 72.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC29203_g1 | 2010549000 | Bacteria | 541 |
| 2 | JGI24746J21847_1064679 | 3300001977 | Bacteria | 526 |
| 3 | JGI24739J22299_10105663 | 3300001989 | Bacteria | 847 |
| 4 | JGI24737J22298_10039093 | 3300001990 | Bacteria | 1459 |
| 5 | JGI24737J22298_10076471 | 3300001990 | Bacteria | 998 |
| 6 | JGI24743J22301_10060984 | 3300001991 | Bacteria | 777 |
| 7 | JGI24743J22301_10069475 | 3300001991 | Bacteria | 734 |
| 8 | JGI24750J21931_1024546 | 3300002070 | Bacteria | 860 |
| 9 | JGI24750J21931_1028678 | 3300002070 | Bacteria | 809 |
| 10 | JGI24745J21846_1006210 | 3300002073 | Bacteria | 1320 |
| 11 | JGI24748J21848_1012428 | 3300002074 | Bacteria | 1004 |
| 12 | JGI24738J21930_10118491 | 3300002075 | Bacteria | 574 |
| 13 | JGI24749J21850_1041439 | 3300002076 | Bacteria | 675 |
| 14 | JGI24744J21845_10000637 | 3300002077 | Bacteria | 6411 |
| 15 | JGI24744J21845_10001167 | 3300002077 | Bacteria | 5116 |
| 16 | JGI24034J26672_10090629 | 3300002239 | Bacteria | 567 |
| 17 | JGI24742J22300_10000515 | 3300002244 | Bacteria | 5758 |
| 18 | JGI24751J29686_10007367 | 3300002459 | Bacteria | 2247 |
| 19 | Ga0070676_10122740 | 3300005328 | Bacteria | 1633 |
| 20 | Ga0070683_100972309 | 3300005329 | Bacteria | 815 |
| 21 | Ga0070690_100010439 | 3300005330 | Bacteria | 5406 |
| 22 | Ga0070677_10538921 | 3300005333 | Bacteria | 638 |
| 23 | Ga0068869_100062777 | 3300005334 | Bacteria | 2727 |
| 24 | Ga0070666_10003954 | 3300005335 | Bacteria | 8997 |
| 25 | Ga0070666_10313295 | 3300005335 | Bacteria | 1119 |
| 26 | Ga0070680_100132664 | 3300005336 | Bacteria | 2085 |
| 27 | Ga0070682_100057276 | 3300005337 | Bacteria | 2454 |
| 28 | Ga0070682_101526051 | 3300005337 | Bacteria | 575 |
| 29 | Ga0070682_101891290 | 3300005337 | Bacteria | 522 |
| 30 | Ga0068868_100003443 | 3300005338 | Bacteria | 11019 |
| 31 | Ga0068868_100156231 | 3300005338 | Bacteria | 1881 |
| 32 | Ga0068868_102368094 | 3300005338 | Bacteria | 507 |
| 33 | Ga0070660_100309610 | 3300005339 | Bacteria | 1296 |
| 34 | Ga0070689_100008880 | 3300005340 | Bacteria | 7102 |
| 35 | Ga0070689_100190789 | 3300005340 | Bacteria | 1668 |
| 36 | Ga0070689_101824962 | 3300005340 | Bacteria | 555 |
| 37 | Ga0070691_10003658 | 3300005341 | Bacteria | 6941 |
| 38 | Ga0070691_10924266 | 3300005341 | Bacteria | 540 |
| 39 | Ga0070687_100922540 | 3300005343 | Bacteria | 628 |
| 40 | Ga0070661_101097611 | 3300005344 | Bacteria | 663 |
| 41 | Ga0070661_101222783 | 3300005344 | Bacteria | 629 |
| 42 | Ga0070692_10045472 | 3300005345 | Bacteria | 2264 |
| 43 | Ga0070692_10320456 | 3300005345 | Bacteria | 953 |
| 44 | Ga0070668_100008713 | 3300005347 | Bacteria | 7533 |
| 45 | Ga0070668_100210006 | 3300005347 | Bacteria | 1601 |
| 46 | Ga0070668_100524748 | 3300005347 | Bacteria | 1028 |
| 47 | Ga0070669_100037908 | 3300005353 | Bacteria | 3498 |
| 48 | Ga0070669_100274591 | 3300005353 | Bacteria | 1349 |
| 49 | Ga0070675_100117867 | 3300005354 | Bacteria | 2254 |
| 50 | Ga0070671_100061096 | 3300005355 | Bacteria | 3138 |
| 51 | Ga0070671_100389561 | 3300005355 | Bacteria | 1191 |
| 52 | Ga0070671_101214152 | 3300005355 | Bacteria | 664 |
| 53 | Ga0070671_101635248 | 3300005355 | Bacteria | 571 |
| 54 | Ga0070671_102088947 | 3300005355 | Bacteria | 505 |
| 55 | Ga0070674_100000896 | 3300005356 | Bacteria | 15568 |
| 56 | Ga0070674_100251026 | 3300005356 | Bacteria | 1389 |
| 57 | Ga0070673_100132002 | 3300005364 | Bacteria | 2097 |
| 58 | Ga0070673_101597244 | 3300005364 | Bacteria | 616 |
| 59 | Ga0070688_100690413 | 3300005365 | Bacteria | 790 |
| 60 | Ga0070659_100413746 | 3300005366 | Bacteria | 1140 |
| 61 | Ga0070667_100001428 | 3300005367 | Bacteria | 21404 |
| 62 | Ga0070667_100048517 | 3300005367 | Bacteria | 3574 |
| 63 | Ga0070667_100284911 | 3300005367 | Bacteria | 1484 |
| 64 | Ga0070709_10008036 | 3300005434 | Bacteria | 5789 |
| 65 | Ga0070714_100012275 | 3300005435 | Bacteria | 6835 |
| 66 | Ga0070714_101057289 | 3300005435 | Bacteria | 791 |
| 67 | Ga0070710_10000757 | 3300005437 | Bacteria | 15392 |
| 68 | Ga0070710_10265670 | 3300005437 | Bacteria | 1108 |
| 69 | Ga0070701_10000936 | 3300005438 | Bacteria | 10562 |
| 70 | Ga0070701_10858142 | 3300005438 | Bacteria | 624 |
| 71 | Ga0070711_100001244 | 3300005439 | Bacteria | 13782 |
| 72 | Ga0070711_100021879 | 3300005439 | Bacteria | 4138 |
| 73 | Ga0070711_100143549 | 3300005439 | Bacteria | 1793 |
| 74 | Ga0070705_100187850 | 3300005440 | Bacteria | 1405 |
| 75 | Ga0070705_101058414 | 3300005440 | Bacteria | 661 |
| 76 | Ga0070700_100004370 | 3300005441 | Bacteria | 7376 |
| 77 | Ga0070700_100187860 | 3300005441 | Bacteria | 1442 |
| 78 | Ga0070700_100363251 | 3300005441 | Bacteria | 1077 |
| 79 | Ga0070694_100047718 | 3300005444 | Bacteria | 2879 |
| 80 | Ga0070694_100071853 | 3300005444 | Bacteria | 2386 |
| 81 | Ga0070708_100886327 | 3300005445 | Bacteria | 838 |
| 82 | Ga0070663_100016744 | 3300005455 | Bacteria | 4770 |
| 83 | Ga0070663_100303454 | 3300005455 | Bacteria | 1279 |
| 84 | Ga0070663_100380009 | 3300005455 | Bacteria | 1150 |
| 85 | Ga0070663_100381144 | 3300005455 | Bacteria | 1148 |
| 86 | Ga0070678_100000686 | 3300005456 | Bacteria | 16691 |
| 87 | Ga0070678_100151521 | 3300005456 | Bacteria | 1868 |
| 88 | Ga0068867_100034236 | 3300005459 | Bacteria | 3681 |
| 89 | Ga0070685_10203700 | 3300005466 | Bacteria | 1287 |
| 90 | Ga0070685_11139379 | 3300005466 | Bacteria | 591 |
| 91 | Ga0070706_100972900 | 3300005467 | Bacteria | 783 |
| 92 | Ga0070684_100482852 | 3300005535 | Bacteria | 1147 |
| 93 | Ga0070684_100907124 | 3300005535 | Bacteria | 826 |
| 94 | Ga0070697_101920348 | 3300005536 | Bacteria | 530 |
| 95 | Ga0068853_100011795 | 3300005539 | Bacteria | 7104 |
| 96 | Ga0068853_100710977 | 3300005539 | Bacteria | 959 |
| 97 | Ga0068853_100832533 | 3300005539 | Bacteria | 884 |
| 98 | Ga0068853_101491507 | 3300005539 | Bacteria | 655 |
| 99 | Ga0070672_100128985 | 3300005543 | Bacteria | 2077 |
| 100 | Ga0070686_100192523 | 3300005544 | Bacteria | 1456 |
| 101 | Ga0070695_100038333 | 3300005545 | Bacteria | 3023 |
| 102 | Ga0070696_100002978 | 3300005546 | Bacteria | 11250 |
| 103 | Ga0070696_100170524 | 3300005546 | Bacteria | 1608 |
| 104 | Ga0070665_100008810 | 3300005548 | Bacteria | 10212 |
| 105 | Ga0070665_100032322 | 3300005548 | Bacteria | 5267 |
| 106 | Ga0070665_100120811 | 3300005548 | Bacteria | 2621 |
| 107 | Ga0070665_100199808 | 3300005548 | Bacteria | 2000 |
| 108 | Ga0070665_101478202 | 3300005548 | Bacteria | 688 |
| 109 | Ga0070704_100000067 | 3300005549 | Bacteria | 34228 |
| 110 | Ga0070704_101087943 | 3300005549 | Bacteria | 726 |
| 111 | Ga0068855_101621229 | 3300005563 | Bacteria | 662 |
| 112 | Ga0068855_102389378 | 3300005563 | Bacteria | 528 |
| 113 | Ga0068857_101101273 | 3300005577 | Bacteria | 767 |
| 114 | Ga0068854_100002312 | 3300005578 | Bacteria | 11744 |
| 115 | Ga0068854_100133932 | 3300005578 | Bacteria | 1895 |
| 116 | Ga0068854_100343085 | 3300005578 | Bacteria | 1220 |
| 117 | Ga0068856_101600414 | 3300005614 | Bacteria | 665 |
| 118 | Ga0070702_100001268 | 3300005615 | Bacteria | 10258 |
| 119 | Ga0070702_100012484 | 3300005615 | Bacteria | 4258 |
| 120 | Ga0068852_100056324 | 3300005616 | Bacteria | 3397 |
| 121 | Ga0068852_100067992 | 3300005616 | Bacteria | 3116 |
| 122 | Ga0068852_100239638 | 3300005616 | Bacteria | 1732 |
| 123 | Ga0068859_100023821 | 3300005617 | Bacteria | 6144 |
| 124 | Ga0068859_102069662 | 3300005617 | Bacteria | 628 |
| 125 | Ga0068864_100035545 | 3300005618 | Bacteria | 4242 |
| 126 | Ga0068864_100279418 | 3300005618 | Bacteria | 1558 |
| 127 | Ga0068866_10001888 | 3300005718 | Bacteria | 8773 |
| 128 | Ga0068866_10101877 | 3300005718 | Bacteria | 1585 |
| 129 | Ga0068861_100013874 | 3300005719 | Bacteria | 5647 |
| 130 | Ga0068861_100378374 | 3300005719 | Bacteria | 1250 |
| 131 | Ga0068861_100384863 | 3300005719 | Bacteria | 1240 |
| 132 | Ga0068861_100704243 | 3300005719 | Bacteria | 939 |
| 133 | Ga0068851_10060512 | 3300005834 | Bacteria | 1939 |
| 134 | Ga0068863_100323222 | 3300005841 | Bacteria | 1499 |
| 135 | Ga0068863_100360867 | 3300005841 | Bacteria | 1416 |
| 136 | Ga0068858_100003627 | 3300005842 | Bacteria | 15274 |
| 137 | Ga0068858_101335080 | 3300005842 | Bacteria | 706 |
| 138 | Ga0068860_100001873 | 3300005843 | Bacteria | 22347 |
| 139 | Ga0068860_101897932 | 3300005843 | Bacteria | 617 |
| 140 | Ga0068862_100004548 | 3300005844 | Bacteria | 11692 |
| 141 | Ga0068862_100300989 | 3300005844 | Bacteria | 1475 |
| 142 | Ga0068862_100396755 | 3300005844 | Bacteria | 1290 |
| 143 | Ga0068862_101091975 | 3300005844 | Bacteria | 793 |
| 144 | Ga0081455_10100590 | 3300005937 | Bacteria | 2322 |
| 145 | Ga0081540_1064746 | 3300005983 | Bacteria | 1723 |
| 146 | Ga0070717_10082371 | 3300006028 | Bacteria | 2704 |
| 147 | Ga0070717_10516726 | 3300006028 | Bacteria | 1080 |
| 148 | Ga0075365_10002248 | 3300006038 | Bacteria | 9353 |
| 149 | Ga0075365_10065228 | 3300006038 | Bacteria | 2440 |
| 150 | Ga0075365_10238274 | 3300006038 | Bacteria | 1278 |
| 151 | Ga0075365_10679375 | 3300006038 | Bacteria | 728 |
| 152 | Ga0075368_10018491 | 3300006042 | Bacteria | 2620 |
| 153 | Ga0075368_10118983 | 3300006042 | Bacteria | 1093 |
| 154 | Ga0075368_10217181 | 3300006042 | Bacteria | 812 |
| 155 | Ga0075368_10379182 | 3300006042 | Bacteria | 619 |
| 156 | Ga0075363_100005367 | 3300006048 | Bacteria | 5695 |
| 157 | Ga0075363_100008865 | 3300006048 | Bacteria | 4706 |
| 158 | Ga0075363_100010660 | 3300006048 | Bacteria | 4375 |
| 159 | Ga0075363_100025211 | 3300006048 | Bacteria | 3030 |
| 160 | Ga0075363_100046656 | 3300006048 | Bacteria | 2299 |
| 161 | Ga0075363_100057463 | 3300006048 | Bacteria | 2088 |
| 162 | Ga0075363_100198497 | 3300006048 | Bacteria | 1146 |
| 163 | Ga0075363_100533877 | 3300006048 | Bacteria | 699 |
| 164 | Ga0075363_100583813 | 3300006048 | Bacteria | 668 |
| 165 | Ga0075363_100782378 | 3300006048 | Bacteria | 579 |
| 166 | Ga0075364_10001392 | 3300006051 | Bacteria | 13075 |
| 167 | Ga0075364_10004076 | 3300006051 | Bacteria | 8383 |
| 168 | Ga0075364_10031967 | 3300006051 | Bacteria | 3380 |
| 169 | Ga0075364_10033199 | 3300006051 | Bacteria | 3321 |
| 170 | Ga0075364_10044023 | 3300006051 | Bacteria | 2902 |
| 171 | Ga0075364_10061163 | 3300006051 | Bacteria | 2470 |
| 172 | Ga0075364_10081659 | 3300006051 | Bacteria | 2137 |
| 173 | Ga0075364_10146126 | 3300006051 | Bacteria | 1592 |
| 174 | Ga0075364_10748554 | 3300006051 | Bacteria | 667 |
| 175 | Ga0075364_10862275 | 3300006051 | Bacteria | 617 |
| 176 | Ga0070715_10053684 | 3300006163 | Bacteria | 1743 |
| 177 | Ga0070716_100001157 | 3300006173 | Bacteria | 11622 |
| 178 | Ga0070716_100038304 | 3300006173 | Bacteria | 2654 |
| 179 | Ga0070712_100005216 | 3300006175 | Bacteria | 8037 |
| 180 | Ga0070712_100006240 | 3300006175 | Bacteria | 7382 |
| 181 | Ga0075362_10023774 | 3300006177 | Bacteria | 2595 |
| 182 | Ga0075362_10721787 | 3300006177 | Bacteria | 521 |
| 183 | Ga0075367_10049051 | 3300006178 | Bacteria | 2488 |
| 184 | Ga0075367_10233701 | 3300006178 | Bacteria | 1151 |
| 185 | Ga0075367_10299420 | 3300006178 | Bacteria | 1012 |
| 186 | Ga0075367_10404859 | 3300006178 | Bacteria | 863 |
| 187 | Ga0075369_10004855 | 3300006186 | Bacteria | 5003 |
| 188 | Ga0075369_10011940 | 3300006186 | Bacteria | 3424 |
| 189 | Ga0075369_10030555 | 3300006186 | Bacteria | 2270 |
| 190 | Ga0075369_10076913 | 3300006186 | Bacteria | 1476 |
| 191 | Ga0075369_10103686 | 3300006186 | Bacteria | 1278 |
| 192 | Ga0075369_10111547 | 3300006186 | Bacteria | 1233 |
| 193 | Ga0075369_10515401 | 3300006186 | Bacteria | 569 |
| 194 | Ga0075366_10591606 | 3300006195 | Bacteria | 688 |
| 195 | Ga0097621_100146739 | 3300006237 | Bacteria | 2021 |
| 196 | Ga0075370_10006409 | 3300006353 | Bacteria | 5916 |
| 197 | Ga0075370_10026618 | 3300006353 | Bacteria | 3205 |
| 198 | Ga0075370_10097864 | 3300006353 | Bacteria | 1696 |
| 199 | Ga0075370_10175164 | 3300006353 | Bacteria | 1262 |
| 200 | Ga0075370_10847523 | 3300006353 | Bacteria | 558 |
| 201 | Ga0068871_100090028 | 3300006358 | Bacteria | 2555 |
| 202 | Ga0075428_100009997 | 3300006844 | Bacteria | 10540 |
| 203 | Ga0075430_100009331 | 3300006846 | Bacteria | 8293 |
| 204 | Ga0075431_100211932 | 3300006847 | Bacteria | 1978 |
| 205 | Ga0075434_101084781 | 3300006871 | Bacteria | 814 |
| 206 | Ga0068865_100002054 | 3300006881 | Bacteria | 11889 |
| 207 | Ga0068865_100054923 | 3300006881 | Bacteria | 2770 |
| 208 | Ga0097620_100023820 | 3300006931 | Bacteria | 6144 |
| 209 | Ga0097620_102069625 | 3300006931 | Bacteria | 628 |
| 210 | Ga0105250_10023063 | 3300009092 | Bacteria | 2508 |
| 211 | Ga0111539_12374295 | 3300009094 | Bacteria | 615 |
| 212 | Ga0111539_13538663 | 3300009094 | Bacteria | 501 |
| 213 | Ga0105245_10002934 | 3300009098 | Bacteria | 15311 |
| 214 | Ga0105245_10189846 | 3300009098 | Bacteria | 1967 |
| 215 | Ga0105245_10243309 | 3300009098 | Bacteria | 1745 |
| 216 | Ga0105245_10494819 | 3300009098 | Bacteria | 1238 |
| 217 | Ga0105245_10923804 | 3300009098 | Bacteria | 915 |
| 218 | Ga0105247_10007322 | 3300009101 | Bacteria | 6781 |
| 219 | Ga0105247_11057394 | 3300009101 | Bacteria | 638 |
| 220 | Ga0114129_10036824 | 3300009147 | Bacteria | 6909 |
| 221 | Ga0114129_10587038 | 3300009147 | Bacteria | 1445 |
| 222 | Ga0105243_10001892 | 3300009148 | Bacteria | 17850 |
| 223 | Ga0105243_10123247 | 3300009148 | Bacteria | 2189 |
| 224 | Ga0105243_10401202 | 3300009148 | Bacteria | 1274 |
| 225 | Ga0105241_10070822 | 3300009174 | Bacteria | 2706 |
| 226 | Ga0105241_11491771 | 3300009174 | Bacteria | 650 |
| 227 | Ga0105242_10003653 | 3300009176 | Bacteria | 11971 |
| 228 | Ga0105242_11287971 | 3300009176 | Bacteria | 754 |
| 229 | Ga0105242_13328972 | 3300009176 | Bacteria | 500 |
| 230 | Ga0105248_10030730 | 3300009177 | Bacteria | 6000 |
| 231 | Ga0105248_10507514 | 3300009177 | Bacteria | 1360 |
| 232 | Ga0105248_10963000 | 3300009177 | Bacteria | 964 |
| 233 | Ga0105237_10037561 | 3300009545 | Bacteria | 4894 |
| 234 | Ga0105237_10248172 | 3300009545 | Bacteria | 1782 |
| 235 | Ga0105237_10846903 | 3300009545 | Bacteria | 921 |
| 236 | Ga0105238_10271523 | 3300009551 | Bacteria | 1676 |
| 237 | Ga0105238_10661891 | 3300009551 | Bacteria | 1055 |
| 238 | Ga0105249_10034660 | 3300009553 | Bacteria | 4574 |
| 239 | Ga0105249_10294841 | 3300009553 | Bacteria | 1624 |
| 240 | Ga0105249_10737536 | 3300009553 | Bacteria | 1047 |
| 241 | Ga0105239_10050198 | 3300010375 | Bacteria | 4576 |
| 242 | Ga0105239_11191569 | 3300010375 | Bacteria | 878 |
| 243 | Ga0105246_10034395 | 3300011119 | Bacteria | 3376 |
| 244 | Ga0157373_10502005 | 3300013100 | Bacteria | 876 |
| 245 | Ga0157371_10195240 | 3300013102 | Bacteria | 1450 |
| 246 | Ga0157369_10295679 | 3300013105 | Bacteria | 1685 |
| 247 | Ga0157369_10817910 | 3300013105 | Bacteria | 957 |
| 248 | Ga0157369_10826783 | 3300013105 | Bacteria | 951 |
| 249 | Ga0157369_11249968 | 3300013105 | Bacteria | 757 |
| 250 | Ga0157374_10085471 | 3300013296 | Bacteria | 3000 |
| 251 | Ga0157374_10136824 | 3300013296 | Bacteria | 2375 |
| 252 | Ga0157378_10000749 | 3300013297 | Bacteria | 30381 |
| 253 | Ga0157378_10169887 | 3300013297 | Bacteria | 2044 |
| 254 | Ga0163162_10006559 | 3300013306 | Bacteria | 11273 |
| 255 | Ga0163162_10140182 | 3300013306 | Bacteria | 2531 |
| 256 | Ga0163162_10375304 | 3300013306 | Bacteria | 1555 |
| 257 | Ga0163162_11843176 | 3300013306 | Bacteria | 692 |
| 258 | Ga0163162_12215108 | 3300013306 | Bacteria | 631 |
| 259 | Ga0163162_12252913 | 3300013306 | Bacteria | 626 |
| 260 | Ga0157372_10093928 | 3300013307 | Bacteria | 3414 |
| 261 | Ga0157372_10171540 | 3300013307 | Bacteria | 2510 |
| 262 | Ga0157372_12235023 | 3300013307 | Bacteria | 628 |
| 263 | Ga0157375_10013118 | 3300013308 | Bacteria | 7365 |
| 264 | Ga0157375_10361649 | 3300013308 | Bacteria | 1617 |
| 265 | Ga0163163_10124808 | 3300014325 | Bacteria | 2611 |
| 266 | Ga0163163_10656421 | 3300014325 | Bacteria | 1112 |
| 267 | Ga0163163_11914968 | 3300014325 | Bacteria | 653 |
| 268 | Ga0157380_10002388 | 3300014326 | Bacteria | 12627 |
| 269 | Ga0157380_10195347 | 3300014326 | Bacteria | 1790 |
| 270 | Ga0157380_10729436 | 3300014326 | Bacteria | 1000 |
| 271 | Ga0182008_10499095 | 3300014497 | Bacteria | 669 |
| 272 | Ga0157377_10037870 | 3300014745 | Bacteria | 2659 |
| 273 | Ga0157377_10082881 | 3300014745 | Bacteria | 1878 |
| 274 | Ga0157377_10116531 | 3300014745 | Bacteria | 1613 |
| 275 | Ga0157379_10024948 | 3300014968 | Bacteria | 5306 |
| 276 | Ga0157379_11195655 | 3300014968 | Bacteria | 731 |
| 277 | Ga0157376_10043615 | 3300014969 | Bacteria | 3682 |
| 278 | Ga0157376_10082415 | 3300014969 | Bacteria | 2764 |
| 279 | Ga0163161_10058377 | 3300017792 | Bacteria | 2805 |
| 280 | Ga0163161_10236801 | 3300017792 | Bacteria | 1418 |
| 281 | Ga0163161_10284669 | 3300017792 | Bacteria | 1298 |
| 282 | Ga0213873_10188601 | 3300021358 | Bacteria | 635 |
| 283 | Ga0213874_10040689 | 3300021377 | Bacteria | 1389 |
| 284 | Ga0213876_10004134 | 3300021384 | Bacteria | 8152 |
| 285 | Ga0213876_10006209 | 3300021384 | Bacteria | 6519 |
| 286 | Ga0213876_10088697 | 3300021384 | Bacteria | 1638 |
| 287 | Ga0213876_10190833 | 3300021384 | Bacteria | 1090 |
| 288 | Ga0213875_10024382 | 3300021388 | Bacteria | 2885 |
| 289 | Ga0213875_10079894 | 3300021388 | Bacteria | 1526 |
| 290 | Ga0209025_1116270 | 3300025294 | Bacteria | 809 |
| 291 | Ga0209051_1141086 | 3300025303 | Bacteria | 579 |
| 292 | Ga0207697_10077866 | 3300025315 | Bacteria | 1394 |
| 293 | Ga0207656_10452744 | 3300025321 | Bacteria | 649 |
| 294 | Ga0207653_10071124 | 3300025885 | Bacteria | 1189 |
| 295 | Ga0207692_10001181 | 3300025898 | Bacteria | 9672 |
| 296 | Ga0207692_10038390 | 3300025898 | Bacteria | 2348 |
| 297 | Ga0207692_10098595 | 3300025898 | Bacteria | 1599 |
| 298 | Ga0207642_10000298 | 3300025899 | Bacteria | 14852 |
| 299 | Ga0207642_10210124 | 3300025899 | Bacteria | 1081 |
| 300 | Ga0207642_10472026 | 3300025899 | Bacteria | 764 |
| 301 | Ga0207710_10004941 | 3300025900 | Bacteria | 5778 |
| 302 | Ga0207710_10741882 | 3300025900 | Bacteria | 516 |
| 303 | Ga0207688_10017752 | 3300025901 | Bacteria | 3871 |
| 304 | Ga0207688_10027795 | 3300025901 | Bacteria | 3111 |
| 305 | Ga0207647_10047021 | 3300025904 | Bacteria | 2686 |
| 306 | Ga0207685_10082925 | 3300025905 | Bacteria | 1331 |
| 307 | Ga0207699_10037229 | 3300025906 | Bacteria | 2780 |
| 308 | Ga0207699_10052570 | 3300025906 | Bacteria | 2412 |
| 309 | Ga0207699_10458653 | 3300025906 | Bacteria | 915 |
| 310 | Ga0207645_10006992 | 3300025907 | Bacteria | 8034 |
| 311 | Ga0207645_10030445 | 3300025907 | Bacteria | 3477 |
| 312 | Ga0207643_10312580 | 3300025908 | Bacteria | 980 |
| 313 | Ga0207684_10685299 | 3300025910 | Bacteria | 872 |
| 314 | Ga0207654_10021736 | 3300025911 | Bacteria | 3415 |
| 315 | Ga0207654_10558975 | 3300025911 | Bacteria | 813 |
| 316 | Ga0207654_11357456 | 3300025911 | Bacteria | 518 |
| 317 | Ga0207671_10116398 | 3300025914 | Bacteria | 2039 |
| 318 | Ga0207693_10006231 | 3300025915 | Bacteria | 9895 |
| 319 | Ga0207693_10022627 | 3300025915 | Bacteria | 4993 |
| 320 | Ga0207663_10011886 | 3300025916 | Bacteria | 4688 |
| 321 | Ga0207663_10081981 | 3300025916 | Bacteria | 2114 |
| 322 | Ga0207663_10142833 | 3300025916 | Bacteria | 1670 |
| 323 | Ga0207660_11313937 | 3300025917 | Bacteria | 587 |
| 324 | Ga0207662_10135344 | 3300025918 | Bacteria | 1557 |
| 325 | Ga0207657_11367101 | 3300025919 | Bacteria | 533 |
| 326 | Ga0207649_11015015 | 3300025920 | Bacteria | 653 |
| 327 | Ga0207649_11469919 | 3300025920 | Bacteria | 539 |
| 328 | Ga0207652_10433294 | 3300025921 | Bacteria | 1185 |
| 329 | Ga0207652_11210726 | 3300025921 | Bacteria | 657 |
| 330 | Ga0207681_10037058 | 3300025923 | Bacteria | 3221 |
| 331 | Ga0207681_10184399 | 3300025923 | Bacteria | 1592 |
| 332 | Ga0207694_10119702 | 3300025924 | Bacteria | 2101 |
| 333 | Ga0207694_10642656 | 3300025924 | Bacteria | 894 |
| 334 | Ga0207659_11126192 | 3300025926 | Bacteria | 675 |
| 335 | Ga0207687_10000787 | 3300025927 | Bacteria | 21377 |
| 336 | Ga0207687_10107299 | 3300025927 | Bacteria | 2066 |
| 337 | Ga0207687_10369795 | 3300025927 | Bacteria | 1172 |
| 338 | Ga0207687_10472149 | 3300025927 | Bacteria | 1043 |
| 339 | Ga0207700_10551822 | 3300025928 | Bacteria | 1023 |
| 340 | Ga0207664_10035288 | 3300025929 | Bacteria | 3858 |
| 341 | Ga0207664_10043052 | 3300025929 | Bacteria | 3529 |
| 342 | Ga0207664_10553727 | 3300025929 | Bacteria | 1032 |
| 343 | Ga0207664_11551397 | 3300025929 | Bacteria | 584 |
| 344 | Ga0207664_11675566 | 3300025929 | Bacteria | 558 |
| 345 | Ga0207644_10055683 | 3300025931 | Bacteria | 2851 |
| 346 | Ga0207644_10150319 | 3300025931 | Bacteria | 1801 |
| 347 | Ga0207644_11210881 | 3300025931 | Bacteria | 635 |
| 348 | Ga0207644_11473861 | 3300025931 | Bacteria | 571 |
| 349 | Ga0207690_10006108 | 3300025932 | Bacteria | 7137 |
| 350 | Ga0207706_10005968 | 3300025933 | Bacteria | 11331 |
| 351 | Ga0207686_10837404 | 3300025934 | Bacteria | 739 |
| 352 | Ga0207709_10027163 | 3300025935 | Bacteria | 3294 |
| 353 | Ga0207709_10087047 | 3300025935 | Bacteria | 2030 |
| 354 | Ga0207670_10172990 | 3300025936 | Bacteria | 1621 |
| 355 | Ga0207669_10046156 | 3300025937 | Bacteria | 2572 |
| 356 | Ga0207669_10874645 | 3300025937 | Bacteria | 749 |
| 357 | Ga0207704_10000348 | 3300025938 | Bacteria | 21539 |
| 358 | Ga0207704_10637685 | 3300025938 | Bacteria | 876 |
| 359 | Ga0207665_10003947 | 3300025939 | Bacteria | 9929 |
| 360 | Ga0207665_10004368 | 3300025939 | Bacteria | 9387 |
| 361 | Ga0207691_10078966 | 3300025940 | Bacteria | 2962 |
| 362 | Ga0207711_10014542 | 3300025941 | Bacteria | 6542 |
| 363 | Ga0207711_10238177 | 3300025941 | Bacteria | 1668 |
| 364 | Ga0207711_10458387 | 3300025941 | Bacteria | 1187 |
| 365 | Ga0207711_10860707 | 3300025941 | Bacteria | 843 |
| 366 | Ga0207689_10002180 | 3300025942 | Bacteria | 18382 |
| 367 | Ga0207689_10027743 | 3300025942 | Bacteria | 4738 |
| 368 | Ga0207661_10863209 | 3300025944 | Bacteria | 833 |
| 369 | Ga0207651_11883594 | 3300025960 | Bacteria | 538 |
| 370 | Ga0207712_10028701 | 3300025961 | Bacteria | 3724 |
| 371 | Ga0207712_10033947 | 3300025961 | Bacteria | 3453 |
| 372 | Ga0207712_10520009 | 3300025961 | Bacteria | 1020 |
| 373 | Ga0207712_10662584 | 3300025961 | Bacteria | 908 |
| 374 | Ga0207668_10005313 | 3300025972 | Bacteria | 7580 |
| 375 | Ga0207668_10067835 | 3300025972 | Bacteria | 2534 |
| 376 | Ga0207668_10178540 | 3300025972 | Bacteria | 1672 |
| 377 | Ga0207640_10054970 | 3300025981 | Bacteria | 2605 |
| 378 | Ga0207640_10189603 | 3300025981 | Bacteria | 1549 |
| 379 | Ga0207640_10602302 | 3300025981 | Bacteria | 930 |
| 380 | Ga0207640_11393651 | 3300025981 | Bacteria | 628 |
| 381 | Ga0207658_10044332 | 3300025986 | Bacteria | 3238 |
| 382 | Ga0207658_10285037 | 3300025986 | Bacteria | 1417 |
| 383 | Ga0207658_11744179 | 3300025986 | Bacteria | 568 |
| 384 | Ga0207677_10017210 | 3300026023 | Bacteria | 4304 |
| 385 | Ga0207677_10050166 | 3300026023 | Bacteria | 2821 |
| 386 | Ga0207677_10145860 | 3300026023 | Bacteria | 1819 |
| 387 | Ga0207677_11830171 | 3300026023 | Bacteria | 564 |
| 388 | Ga0207703_10009434 | 3300026035 | Bacteria | 7665 |
| 389 | Ga0207703_10042930 | 3300026035 | Bacteria | 3627 |
| 390 | Ga0207639_10393440 | 3300026041 | Bacteria | 1247 |
| 391 | Ga0207639_10431215 | 3300026041 | Bacteria | 1194 |
| 392 | Ga0207678_10039154 | 3300026067 | Bacteria | 4115 |
| 393 | Ga0207678_10066530 | 3300026067 | Bacteria | 3095 |
| 394 | Ga0207678_10140294 | 3300026067 | Bacteria | 2062 |
| 395 | Ga0207678_10598207 | 3300026067 | Bacteria | 967 |
| 396 | Ga0207708_10000696 | 3300026075 | Bacteria | 25516 |
| 397 | Ga0207708_10010104 | 3300026075 | Bacteria | 7008 |
| 398 | Ga0207708_10631516 | 3300026075 | Bacteria | 910 |
| 399 | Ga0207641_10211917 | 3300026088 | Bacteria | 1792 |
| 400 | Ga0207641_10232667 | 3300026088 | Bacteria | 1713 |
| 401 | Ga0207648_10003748 | 3300026089 | Bacteria | 15887 |
| 402 | Ga0207676_10032203 | 3300026095 | Bacteria | 3949 |
| 403 | Ga0207676_10334926 | 3300026095 | Bacteria | 1394 |
| 404 | Ga0207675_100000897 | 3300026118 | Bacteria | 29742 |
| 405 | Ga0207675_100147585 | 3300026118 | Bacteria | 2237 |
| 406 | Ga0207675_100719120 | 3300026118 | Bacteria | 1008 |
| 407 | Ga0207683_10000413 | 3300026121 | Bacteria | 39512 |
| 408 | Ga0207683_10051058 | 3300026121 | Bacteria | 3623 |
| 409 | Ga0207698_10072441 | 3300026142 | Bacteria | 2739 |
| 410 | Ga0209813_10193277 | 3300027866 | Bacteria | 750 |
| 411 | Ga0209813_10350551 | 3300027866 | Bacteria | 584 |
| 412 | Ga0268266_10002437 | 3300028379 | Bacteria | 19971 |
| 413 | Ga0268266_10369506 | 3300028379 | Bacteria | 1351 |
| 414 | Ga0268266_10393897 | 3300028379 | Bacteria | 1308 |
| 415 | Ga0268265_10036115 | 3300028380 | Bacteria | 3617 |
| 416 | Ga0268265_10045597 | 3300028380 | Bacteria | 3272 |
| 417 | Ga0268265_12447630 | 3300028380 | Bacteria | 528 |
| 418 | Ga0268264_10001236 | 3300028381 | Bacteria | 24521 |
| 419 | Ga0268264_10469433 | 3300028381 | Bacteria | 1222 |
| 420 | Ga0268264_12311814 | 3300028381 | Bacteria | 544 |
| 421 | Ga0307408_100229271 | 3300031548 | Bacteria | 1520 |
| 422 | Ga0316578_10043613 | 3300031728 | Bacteria | 2606 |
| 423 | Ga0307413_10015428 | 3300031824 | Bacteria | 3915 |
| 424 | Ga0307410_11437538 | 3300031852 | Bacteria | 606 |
| 425 | Ga0307410_11811283 | 3300031852 | Bacteria | 542 |
| 426 | Ga0307406_10222048 | 3300031901 | Bacteria | 1405 |
| 427 | Ga0307407_10263560 | 3300031903 | Bacteria | 1186 |
| 428 | Ga0307409_100049085 | 3300031995 | Bacteria | 3216 |
| 429 | Ga0307409_100417513 | 3300031995 | Bacteria | 1286 |
| 430 | Ga0307409_100439392 | 3300031995 | Bacteria | 1256 |
| 431 | Ga0307416_100071088 | 3300032002 | Bacteria | 2889 |
| 432 | Ga0307416_102760732 | 3300032002 | Bacteria | 587 |
| 433 | Ga0307414_10485839 | 3300032004 | Bacteria | 1090 |
| 434 | Ga0307415_100312749 | 3300032126 | Bacteria | 1306 |
| 435 | Ga0373929_0133108 | 3300035085 | Bacteria | 654 |
| 436 | Ga0373952_0045350 | 3300035092 | Bacteria | 1030 |
| 437 | Ga0373932_0140981 | 3300035112 | Bacteria | 820 |
| 438 | Ga0373939_0096195 | 3300035114 | Bacteria | 1009 |
| 439 | Ga0373939_0175267 | 3300035114 | Bacteria | 796 |
| 440 | Ga0373941_0049213 | 3300035115 | Bacteria | 1334 |
| 441 | Ga0373960_0059289 | 3300035121 | Bacteria | 1157 |
| 442 | Ga0373942_0085691 | 3300035207 | Bacteria | 942 |
| 443 | Ga0373961_0049759 | 3300035241 | Bacteria | 1240 |
| 444 | Ga0373931_0205317 | 3300035691 | Bacteria | 1179 |
| 445 | Ga0373935_1128009 | 3300035692 | Bacteria | 584 |
| 446 | Ga0373947_0392007 | 3300035725 | Bacteria | 936 |
| 447 | Ga0316582_0856441 | 3300036647 | Bacteria | 622 |
| 448 | Ga0316584_0009567 | 3300036712 | Bacteria | 6735 |
| 449 | Ga0395900_1474356 | 3300037418 | Bacteria | 593 |
| 450 | Ga0436364_0325252 | 3300037853 | Bacteria | 27012 |
| 451 | Ga0436364_0374418 | 3300037853 | Bacteria | 13843 |
| 452 | Ga0436364_1461304 | 3300037853 | Bacteria | 10672 |
| 453 | Ga0436365_0203528 | 3300039437 | Bacteria | 8563 |
| 454 | Ga0436365_0787906 | 3300039437 | Bacteria | 1561 |
| 455 | Ga0436365_1001910 | 3300039437 | Bacteria | 6737 |
| 456 | Ga0436365_1017373 | 3300039437 | Bacteria | 11123 |
| 457 | Ga0436365_1462010 | 3300039437 | Bacteria | 9126 |
| 458 | Ga0436365_1621114 | 3300039437 | Bacteria | 79407 |
| 459 | Ga0436360_0656772 | 3300039438 | Bacteria | 1959 |
| 460 | Ga0436363_0761249 | 3300039450 | Bacteria | 2786 |
| 461 | Ga0436363_0978816 | 3300039450 | Bacteria | 841 |
| 462 | Ga0436362_1140811 | 3300039453 | Bacteria | 660 |
| 463 | Ga0439466_0004312 | 3300041411 | Bacteria | 5489 |
| 464 | Ga0439465_0000668 | 3300041413 | Bacteria | 10489 |
| 465 | Ga0451793_0529812 | 3300041452 | Bacteria | 835 |
| 466 | Ga0451802_1453621 | 3300041460 | Bacteria | 516 |
| 467 | Ga0451807_0326284 | 3300041486 | Bacteria | 636 |
| 468 | Ga0451849_1280191 | 3300041505 | Bacteria | 697 |
| 469 | Ga0451853_2004371 | 3300041512 | Bacteria | 968 |
| 470 | Ga0451853_2423564 | 3300041512 | Bacteria | 512 |
| 471 | Ga0439431_0038262 | 3300041997 | Bacteria | 1214 |
| 472 | Ga0439433_0168933 | 3300041999 | Bacteria | 569 |
| 473 | Ga0439445_0035264 | 3300042004 | Bacteria | 1313 |
| 474 | Ga0439448_0229730 | 3300042005 | Bacteria | 653 |
| 475 | Ga0439434_0026438 | 3300042435 | Bacteria | 1753 |
| 476 | Ga0466969_0042194 | 3300044656 | Bacteria | 2279 |
| 477 | Ga0466969_0107692 | 3300044656 | Bacteria | 1307 |
| 478 | Ga0466972_0010733 | 3300044658 | Bacteria | 4597 |
| 479 | Ga0466972_0039852 | 3300044658 | Bacteria | 2291 |
| 480 | Ga0466972_0114372 | 3300044658 | Bacteria | 1274 |
| 481 | Ga0466972_0130209 | 3300044658 | Bacteria | 1185 |
| 482 | Ga0466972_0221576 | 3300044658 | Bacteria | 885 |
| 483 | Ga0466972_0413623 | 3300044658 | Bacteria | 632 |
| 484 | Ga0466965_0050447 | 3300044683 | Bacteria | 2063 |
| 485 | Ga0466965_0077219 | 3300044683 | Bacteria | 1682 |
| 486 | Ga0466965_0133623 | 3300044683 | Bacteria | 1288 |
| 487 | Ga0466965_0269707 | 3300044683 | Bacteria | 917 |
| 488 | Ga0466966_0006273 | 3300044684 | Bacteria | 7866 |
| 489 | Ga0466966_0039209 | 3300044684 | Bacteria | 3051 |
| 490 | Ga0466966_0059717 | 3300044684 | Bacteria | 2408 |
| 491 | Ga0466966_0463830 | 3300044684 | Bacteria | 761 |
| 492 | Ga0466961_0007216 | 3300044693 | Bacteria | 7068 |
| 493 | Ga0466961_0017737 | 3300044693 | Bacteria | 4574 |
| 494 | Ga0466961_0045929 | 3300044693 | Bacteria | 2794 |
| 495 | Ga0466963_0052885 | 3300044694 | Bacteria | 2696 |
| 496 | Ga0466963_0074610 | 3300044694 | Bacteria | 2288 |
| 497 | Ga0466963_0270292 | 3300044694 | Bacteria | 1194 |
| 498 | Ga0466963_0282581 | 3300044694 | Bacteria | 1166 |
| 499 | Ga0466963_0472300 | 3300044694 | Bacteria | 885 |
| 500 | Ga0466964_0266824 | 3300044706 | Bacteria | 850 |
| 501 | Ga0466971_0008530 | 3300044719 | Bacteria | 4470 |
| 502 | Ga0466971_0141353 | 3300044719 | Bacteria | 1121 |
| 503 | Ga0466971_0691497 | 3300044719 | Bacteria | 512 |
| 504 | Ga0466968_0012169 | 3300044735 | Bacteria | 3361 |
| 505 | Ga0466968_0076810 | 3300044735 | Bacteria | 1462 |
| 506 | Ga0466968_0423255 | 3300044735 | Bacteria | 655 |
| 507 | Ga0466968_0621185 | 3300044735 | Bacteria | 547 |
| 508 | Ga0466970_0003840 | 3300044765 | Bacteria | 7357 |
| 509 | Ga0466970_0014438 | 3300044765 | Bacteria | 4056 |
| 510 | Ga0466970_0691567 | 3300044765 | Bacteria | 594 |
| 511 | Ga0466957_0009732 | 3300044842 | Bacteria | 5489 |
| 512 | Ga0466957_0035760 | 3300044842 | Bacteria | 2982 |
| 513 | Ga0466957_0293476 | 3300044842 | Bacteria | 1091 |
| 514 | Ga0466957_0606800 | 3300044842 | Bacteria | 766 |
| 515 | Ga0466960_0000372 | 3300044901 | Bacteria | 15325 |
| 516 | Ga0466960_0014871 | 3300044901 | Bacteria | 3344 |
| 517 | Ga0466960_0020752 | 3300044901 | Bacteria | 2915 |
| 518 | Ga0466960_0095270 | 3300044901 | Bacteria | 1524 |
| 519 | Ga0466960_0193779 | 3300044901 | Bacteria | 1107 |
| 520 | Ga0466960_0946408 | 3300044901 | Bacteria | 527 |
| 521 | Ga0466959_0021429 | 3300045049 | Bacteria | 4766 |
| 522 | Ga0466959_0086556 | 3300045049 | Bacteria | 2254 |
| 523 | Ga0466959_0380987 | 3300045049 | Bacteria | 960 |
| 524 | Ga0466958_0002994 | 3300045836 | Bacteria | 8658 |
| 525 | Ga0466958_0003841 | 3300045836 | Bacteria | 7852 |
| 526 | Ga0466958_0023804 | 3300045836 | Bacteria | 3599 |
| 527 | Ga0466958_0266382 | 3300045836 | Bacteria | 1097 |
| 528 | Ga0466967_0018062 | 3300045976 | Bacteria | 5625 |
| 529 | Ga0466967_0024967 | 3300045976 | Bacteria | 4921 |
| 530 | Ga0466967_0948806 | 3300045976 | Bacteria | 856 |
| 531 | Ga0466967_1127677 | 3300045976 | Bacteria | 781 |
| 532 | Ga0466967_1180029 | 3300045976 | Bacteria | 763 |
| 533 | Ga0495603_0049363 | 3300046455 | Bacteria | 2505 |
| 534 | Ga0495629_0043593 | 3300046459 | Bacteria | 3149 |
| 535 | Ga0495638_0011643 | 3300046460 | Bacteria | 6057 |
| 536 | Ga0495638_0649939 | 3300046460 | Bacteria | 513 |
| 537 | Ga0495582_0066893 | 3300046473 | Bacteria | 1985 |
| 538 | Ga0495639_0164784 | 3300046475 | Bacteria | 1074 |
| 539 | Ga0495662_0079947 | 3300046476 | Bacteria | 1590 |
| 540 | Ga0495664_0191656 | 3300046477 | Bacteria | 1239 |
| 541 | Ga0495594_0044311 | 3300046499 | Bacteria | 2440 |
| 542 | Ga0495620_0339428 | 3300046515 | Bacteria | 570 |
| 543 | Ga0495643_0313120 | 3300046522 | Bacteria | 712 |
| 544 | Ga0495666_0404572 | 3300046526 | Bacteria | 613 |
| 545 | Ga0495665_0202111 | 3300046531 | Bacteria | 1030 |
| 546 | Ga0495634_0188660 | 3300046642 | Bacteria | 1287 |
| 547 | Ga0495588_0086626 | 3300046674 | Bacteria | 1638 |
| 548 | Ga0495658_0108945 | 3300046683 | Bacteria | 1663 |
| 549 | Ga0495624_0182716 | 3300046690 | Bacteria | 1277 |
| 550 | Ga0495581_0012840 | 3300047315 | Bacteria | 4852 |
| 551 | Ga0495674_0377959 | 3300047319 | Bacteria | 1146 |
| 552 | Ga0495672_0061989 | 3300047320 | Bacteria | 2153 |
| 553 | Ga0495676_0104634 | 3300047321 | Bacteria | 2088 |
| 554 | Ga0495680_0463701 | 3300047322 | Bacteria | 865 |
| 555 | Ga0495686_0318245 | 3300047472 | Bacteria | 854 |
| 556 | Ga0495593_0015467 | 3300047673 | Bacteria | 4321 |
| 557 | Ga0495614_0294628 | 3300048089 | Bacteria | 749 |
| 558 | Ga0496100_0004372 | 3300048903 | Bacteria | 7484 |
| 559 | Ga0496100_0013521 | 3300048903 | Bacteria | 4711 |
| 560 | Ga0496100_0184369 | 3300048903 | Bacteria | 1511 |
| 561 | Ga0496100_0683833 | 3300048903 | Bacteria | 800 |
| 562 | Ga0496101_0014567 | 3300048904 | Bacteria | 5286 |
| 563 | Ga0496101_0070129 | 3300048904 | Bacteria | 2566 |
| 564 | Ga0496101_0078929 | 3300048904 | Bacteria | 2429 |
| 565 | Ga0496101_0588474 | 3300048904 | Bacteria | 880 |
| 566 | Ga0496101_1190226 | 3300048904 | Bacteria | 597 |
| 567 | Ga0496101_1331008 | 3300048904 | Bacteria | 561 |
| 568 | Ga0496102_0005139 | 3300048905 | Bacteria | 11098 |
| 569 | Ga0496102_0124596 | 3300048905 | Bacteria | 2408 |
| 570 | Ga0496102_0207986 | 3300048905 | Bacteria | 1845 |
| 571 | Ga0496102_0211477 | 3300048905 | Bacteria | 1828 |
| 572 | Ga0496102_0268435 | 3300048905 | Bacteria | 1609 |
| 573 | Ga0496102_0284382 | 3300048905 | Bacteria | 1559 |
| 574 | Ga0496102_0522728 | 3300048905 | Bacteria | 1109 |
| 575 | Ga0496102_1946997 | 3300048905 | Bacteria | 504 |
| 576 | Ga0496103_0000592 | 3300048906 | Bacteria | 28566 |
| 577 | Ga0496103_0058753 | 3300048906 | Bacteria | 2389 |
| 578 | Ga0496103_0790700 | 3300048906 | Bacteria | 599 |
| 579 | Ga0496104_0010831 | 3300048907 | Bacteria | 8156 |
| 580 | Ga0496104_0148926 | 3300048907 | Bacteria | 2247 |
| 581 | Ga0496104_1590626 | 3300048907 | Bacteria | 556 |
| 582 | Ga0496105_0107787 | 3300048908 | Bacteria | 2300 |
| 583 | Ga0496106_0003432 | 3300048909 | Bacteria | 11805 |
| 584 | Ga0496106_0331647 | 3300048909 | Bacteria | 1221 |
| 585 | Ga0496106_0785422 | 3300048909 | Bacteria | 756 |
| 586 | Ga0496107_0000802 | 3300048910 | Bacteria | 18236 |
| 587 | Ga0496107_0152444 | 3300048910 | Bacteria | 1710 |
| 588 | Ga0496108_0003955 | 3300048911 | Bacteria | 11903 |
| 589 | Ga0496108_0024669 | 3300048911 | Bacteria | 4953 |
| 590 | Ga0496108_0278538 | 3300048911 | Bacteria | 1456 |
| 591 | Ga0496109_0006471 | 3300048912 | Bacteria | 9863 |
| 592 | Ga0496109_0050253 | 3300048912 | Bacteria | 3798 |
| 593 | Ga0496109_0195510 | 3300048912 | Bacteria | 1901 |
| 594 | Ga0496109_0336463 | 3300048912 | Bacteria | 1425 |
| 595 | Ga0496109_1992538 | 3300048912 | Bacteria | 513 |
| 596 | Ga0496110_0084323 | 3300048913 | Bacteria | 2836 |
| 597 | Ga0496110_0146096 | 3300048913 | Bacteria | 2139 |
| 598 | Ga0496111_0192782 | 3300048914 | Bacteria | 1515 |
| 599 | Ga0496111_0874220 | 3300048914 | Bacteria | 648 |
| 600 | Ga0496112_0003857 | 3300048915 | Bacteria | 12524 |
| 601 | Ga0496112_0037169 | 3300048915 | Bacteria | 4753 |
| 602 | Ga0496112_0043159 | 3300048915 | Bacteria | 4414 |
| 603 | Ga0496112_0080879 | 3300048915 | Bacteria | 3213 |
| 604 | Ga0496112_0085593 | 3300048915 | Bacteria | 3119 |
| 605 | Ga0496112_0102654 | 3300048915 | Bacteria | 2830 |
| 606 | Ga0496112_1047380 | 3300048915 | Bacteria | 735 |
| 607 | Ga0496113_0033107 | 3300048916 | Bacteria | 3761 |
| 608 | Ga0496113_0035604 | 3300048916 | Bacteria | 3641 |
| 609 | Ga0496113_0132410 | 3300048916 | Bacteria | 1957 |
| 610 | Ga0496113_0617710 | 3300048916 | Bacteria | 868 |
| 611 | Ga0496113_0674819 | 3300048916 | Bacteria | 826 |
| 612 | Ga0496114_0000487 | 3300048917 | Bacteria | 29129 |
| 613 | Ga0496115_0018299 | 3300048918 | Bacteria | 5376 |
| 614 | Ga0496115_0048925 | 3300048918 | Bacteria | 3382 |
| 615 | Ga0496115_1364742 | 3300048918 | Bacteria | 525 |
| 616 | Ga0496117_0145344 | 3300048920 | Bacteria | 1413 |
| 617 | Ga0496121_0875928 | 3300048924 | Bacteria | 519 |
| 618 | Ga0496122_0030344 | 3300048925 | Bacteria | 4531 |
| 619 | Ga0496123_0039432 | 3300048926 | Bacteria | 3304 |
| 620 | Ga0496125_0233111 | 3300048928 | Bacteria | 1175 |
| 621 | Ga0496125_0401811 | 3300048928 | Bacteria | 800 |
| 622 | Ga0496126_0001976 | 3300048929 | Bacteria | 29048 |
| 623 | Ga0496126_0010527 | 3300048929 | Bacteria | 9685 |
| 624 | Ga0496126_0161474 | 3300048929 | Bacteria | 1914 |
| 625 | Ga0501032_0005028 | 3300049569 | Bacteria | 9883 |
| 626 | Ga0501032_0005216 | 3300049569 | Bacteria | 9670 |
| 627 | Ga0501033_0061936 | 3300049570 | Bacteria | 2756 |
| 628 | Ga0501033_0092261 | 3300049570 | Bacteria | 2215 |
| 629 | Ga0501033_0152624 | 3300049570 | Bacteria | 1666 |
| 630 | Ga0501033_0441147 | 3300049570 | Bacteria | 905 |
| 631 | Ga0501034_0010017 | 3300049571 | Bacteria | 9902 |
| 632 | Ga0501034_0037809 | 3300049571 | Bacteria | 4888 |
| 633 | Ga0501034_0056731 | 3300049571 | Bacteria | 3940 |
| 634 | Ga0501034_0567611 | 3300049571 | Bacteria | 1043 |
| 635 | Ga0501034_1111044 | 3300049571 | Bacteria | 671 |
| 636 | Ga0501036_0007496 | 3300049572 | Bacteria | 8899 |
| 637 | Ga0501036_0676913 | 3300049572 | Bacteria | 853 |
| 638 | Ga0501036_1748899 | 3300049572 | Bacteria | 501 |
| 639 | Ga0501037_0001645 | 3300049573 | Bacteria | 16251 |
| 640 | Ga0501037_0069065 | 3300049573 | Bacteria | 2573 |
| 641 | Ga0501038_0091240 | 3300049574 | Bacteria | 2552 |
| 642 | Ga0501039_0000415 | 3300049575 | Bacteria | 30627 |
| 643 | Ga0501039_0805579 | 3300049575 | Bacteria | 733 |
| 644 | Ga0501043_0001031 | 3300049579 | Bacteria | 24463 |
| 645 | Ga0501043_0336312 | 3300049579 | Bacteria | 1149 |
| 646 | Ga0501046_0003427 | 3300049580 | Bacteria | 14558 |
| 647 | Ga0501047_0030230 | 3300049581 | Bacteria | 5222 |
| 648 | Ga0501047_0046761 | 3300049581 | Bacteria | 4182 |
| 649 | Ga0501047_0217582 | 3300049581 | Bacteria | 1767 |
| 650 | Ga0501047_0359591 | 3300049581 | Bacteria | 1292 |
| 651 | Ga0501047_0385658 | 3300049581 | Bacteria | 1235 |
| 652 | Ga0501048_0258816 | 3300049582 | Bacteria | 1236 |
| 653 | Ga0501067_0259502 | 3300049583 | Bacteria | 967 |
| 654 | Ga0501069_0048928 | 3300049585 | Bacteria | 2349 |
| 655 | Ga0501070_0000517 | 3300049586 | Bacteria | 35418 |
| 656 | Ga0501070_0003022 | 3300049586 | Bacteria | 14642 |
| 657 | Ga0501070_0627289 | 3300049586 | Bacteria | 855 |
| 658 | Ga0501070_0764524 | 3300049586 | Bacteria | 761 |
| 659 | Ga0501073_0022631 | 3300049589 | Bacteria | 4522 |
| 660 | Ga0501077_0089915 | 3300049593 | Bacteria | 1946 |
| 661 | Ga0501080_0189438 | 3300049742 | Bacteria | 1891 |
| 662 | Ga0501080_0946515 | 3300049742 | Bacteria | 749 |
| 663 | Ga0501035_0001193 | 3300049822 | Bacteria | 27068 |
| 664 | Ga0501035_0118991 | 3300049822 | Bacteria | 2311 |
| 665 | Ga0501035_0370584 | 3300049822 | Bacteria | 1195 |
| 666 | Ga0501044_0000320 | 3300049823 | Bacteria | 60627 |
| 667 | Ga0501044_0003141 | 3300049823 | Bacteria | 18689 |
| 668 | Ga0501044_0011535 | 3300049823 | Bacteria | 9575 |
| 669 | Ga0501044_0076931 | 3300049823 | Bacteria | 3385 |
| 670 | Ga0501044_0609618 | 3300049823 | Bacteria | 984 |
| 671 | Ga0501044_0724734 | 3300049823 | Bacteria | 878 |
| 672 | nmdc:mga03683_279374_c1 | 3300050489 | Bacteria | 780 |
| 673 | nmdc:mga03683_51840_c1 | 3300050489 | Bacteria | 1714 |
| 674 | nmdc:mga03683_9067_c1 | 3300050489 | Bacteria | 3522 |
| 675 | nmdc:mga03n38_13535_c1 | 3300050490 | Bacteria | 3102 |
| 676 | nmdc:mga03n38_175726_c1 | 3300050490 | Bacteria | 1094 |
| 677 | nmdc:mga03n38_27563_c1 | 3300050490 | Bacteria | 2358 |
| 678 | nmdc:mga03n38_330086_c1 | 3300050490 | Bacteria | 826 |
| 679 | nmdc:mga03n38_4358_c1 | 3300050490 | Bacteria | 4678 |
| 680 | nmdc:mga03n38_464648_c1 | 3300050490 | Bacteria | 706 |
| 681 | nmdc:mga03n38_856493_c1 | 3300050490 | Bacteria | 532 |
| 682 | nmdc:mga00v17_155290_c1 | 3300050491 | Bacteria | 1471 |
| 683 | nmdc:mga00v17_2148_c1 | 3300050491 | Bacteria | 10132 |
| 684 | nmdc:mga00v17_217430_c1 | 3300050491 | Bacteria | 1237 |
| 685 | nmdc:mga00v17_259639_c1 | 3300050491 | Bacteria | 1127 |
| 686 | nmdc:mga00v17_348190_c1 | 3300050491 | Bacteria | 963 |
| 687 | nmdc:mga00v17_37801_c1 | 3300050491 | Bacteria | 2884 |
| 688 | nmdc:mga00v17_43343_c1 | 3300050491 | Bacteria | 2709 |
| 689 | nmdc:mga00v17_447438_c1 | 3300050491 | Bacteria | 839 |
| 690 | nmdc:mga0yw44_1008405_c1 | 3300050492 | Bacteria | 563 |
| 691 | nmdc:mga0yw44_1250162_c1 | 3300050492 | Bacteria | 501 |
| 692 | nmdc:mga0yw44_135427_c1 | 3300050492 | Bacteria | 1598 |
| 693 | nmdc:mga0yw44_194798_c1 | 3300050492 | Bacteria | 1337 |
| 694 | nmdc:mga0yw44_26172_c1 | 3300050492 | Bacteria | 3329 |
| 695 | nmdc:mga0yw44_292519_c1 | 3300050492 | Bacteria | 1090 |
| 696 | nmdc:mga0yw44_460411_c1 | 3300050492 | Bacteria | 862 |
| 697 | nmdc:mga06z11_365921_c1 | 3300050494 | Bacteria | 865 |
| 698 | nmdc:mga06z11_517283_c1 | 3300050494 | Bacteria | 723 |
| 699 | nmdc:mga04h51_13848_c1 | 3300050495 | Bacteria | 2293 |
| 700 | nmdc:mga04h51_190272_c1 | 3300050495 | Bacteria | 802 |
| 701 | nmdc:mga07m45_12350_c1 | 3300050496 | Bacteria | 4512 |
| 702 | nmdc:mga07m45_149775_c1 | 3300050496 | Bacteria | 1353 |
| 703 | nmdc:mga07m45_160768_c1 | 3300050496 | Bacteria | 1304 |
| 704 | nmdc:mga07m45_248181_c1 | 3300050496 | Bacteria | 1036 |
| 705 | nmdc:mga07m45_303117_c1 | 3300050496 | Bacteria | 929 |
| 706 | nmdc:mga07m45_75920_c1 | 3300050496 | Bacteria | 1915 |
| 707 | nmdc:mga05p37_144066_c1 | 3300050507 | Bacteria | 2918 |
| 708 | nmdc:mga0qj67_8192_c1 | 3300050509 | Bacteria | 7746 |
| 709 | nmdc:mga06r32_908187_c1 | 3300050510 | Bacteria | 837 |
| 710 | nmdc:mga08y16_1516679_c1 | 3300050511 | Bacteria | 630 |
| 711 | nmdc:mga0n895_750201_c1 | 3300050512 | Bacteria | 969 |
| 712 | nmdc:mga0sz30_1370_c2 | 3300050516 | Bacteria | 5452 |
| 713 | nmdc:mga0sz30_20867_c1 | 3300050516 | Bacteria | 2646 |
| 714 | nmdc:mga0sz30_221375_c1 | 3300050516 | Bacteria | 841 |
| 715 | nmdc:mga0sz30_244077_c1 | 3300050516 | Bacteria | 799 |
| 716 | nmdc:mga0sz30_279036_c1 | 3300050516 | Bacteria | 744 |
| 717 | nmdc:mga0sz30_32150_c1 | 3300050516 | Bacteria | 2175 |
| 718 | nmdc:mga0sz30_92030_c1 | 3300050516 | Bacteria | 1320 |
| 719 | Ga0495601_1062841 | 3300053077 | Bacteria | 507 |
| 720 | Ga0500635_0012614 | 3300053080 | Bacteria | 2432 |
| 721 | Ga0495655_0022324 | 3300053083 | Bacteria | 1444 |
| 722 | Ga0495655_0046550 | 3300053083 | Bacteria | 1131 |
| 723 | Ga0495619_0127029 | 3300053085 | Bacteria | 1751 |
| 724 | Ga0500578_0254080 | 3300053086 | Bacteria | 1058 |
| 725 | Ga0500643_008087 | 3300053087 | Bacteria | 4166 |
| 726 | Ga0500641_0275757 | 3300053096 | Bacteria | 698 |
| 727 | Ga0500650_0163551 | 3300053098 | Bacteria | 1026 |
| 728 | Ga0500642_0158899 | 3300053130 | Bacteria | 1060 |
| 729 | Ga0500652_002160 | 3300053131 | Bacteria | 5911 |
| 730 | Ga0500652_254686 | 3300053131 | Bacteria | 694 |
| 731 | Ga0500658_0565477 | 3300053134 | Bacteria | 511 |
| 732 | Ga0500559_0519899 | 3300053136 | Bacteria | 545 |
| 733 | Ga0500568_0140430 | 3300053139 | Bacteria | 896 |
| 734 | Ga0500588_0105197 | 3300053146 | Bacteria | 978 |
| 735 | Ga0500588_0153564 | 3300053146 | Bacteria | 834 |
| 736 | Ga0500627_0004036 | 3300053158 | Bacteria | 4642 |
| 737 | Ga0500645_000104 | 3300053730 | Bacteria | 67349 |
| 738 | Ga0500645_012533 | 3300053730 | Bacteria | 2738 |
| 739 | Ga0466962_0223413 | 3300061719 | Bacteria | 922 |
| 740 | Ga0466962_0623714 | 3300061719 | Bacteria | 550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100972309 | Ga0070683_1009723092 | 73 |
| 2 | 3300005345 | Ga0070692_10320456 | Ga0070692_103204563 | 73 |
| 3 | 3300005347 | Ga0070668_100524748 | Ga0070668_1005247482 | 73 |
| 4 | 3300005355 | Ga0070671_101214152 | Ga0070671_1012141521 | 73 |
| 5 | 3300005364 | Ga0070673_101597244 | Ga0070673_1015972441 | 73 |
| 6 | 3300005438 | Ga0070701_10858142 | Ga0070701_108581422 | 73 |
| 7 | 3300005441 | Ga0070700_100363251 | Ga0070700_1003632513 | 73 |
| 8 | 3300005466 | Ga0070685_11139379 | Ga0070685_111393791 | 73 |
| 9 | 3300005535 | Ga0070684_100907124 | Ga0070684_1009071241 | 73 |
| 10 | 3300005539 | Ga0068853_100710977 | Ga0068853_1007109771 | 73 |
| 11 | 3300005539 | Ga0068853_101491507 | Ga0068853_1014915071 | 73 |
| 12 | 3300005548 | Ga0070665_100199808 | Ga0070665_1001998084 | 73 |
| 13 | 3300005616 | Ga0068852_100056324 | Ga0068852_1000563244 | 73 |
| 14 | 3300005719 | Ga0068861_100378374 | Ga0068861_1003783742 | 73 |
| 15 | 3300005844 | Ga0068862_100396755 | Ga0068862_1003967552 | 73 |
| 16 | 3300006048 | Ga0075363_100008865 | Ga0075363_1000088654 | 73 |
| 17 | 3300006178 | Ga0075367_10299420 | Ga0075367_102994202 | 73 |
| 18 | 3300009098 | Ga0105245_10923804 | Ga0105245_109238042 | 73 |
| 19 | 3300009148 | Ga0105243_10401202 | Ga0105243_104012022 | 73 |
| 20 | 3300009177 | Ga0105248_10963000 | Ga0105248_109630001 | 73 |
| 21 | 3300009551 | Ga0105238_10661891 | Ga0105238_106618912 | 73 |
| 22 | 3300013307 | Ga0157372_12235023 | Ga0157372_122350231 | 73 |
| 23 | 3300014325 | Ga0163163_10656421 | Ga0163163_106564212 | 73 |
| 24 | 3300014326 | Ga0157380_10729436 | Ga0157380_107294362 | 73 |
| 25 | 3300014745 | Ga0157377_10116531 | Ga0157377_101165312 | 73 |
| 26 | 3300025899 | Ga0207642_10210124 | Ga0207642_102101242 | 73 |
| 27 | 3300025908 | Ga0207643_10312580 | Ga0207643_103125801 | 73 |
| 28 | 3300025924 | Ga0207694_10642656 | Ga0207694_106426561 | 73 |
| 29 | 3300025927 | Ga0207687_10369795 | Ga0207687_103697951 | 73 |
| 30 | 3300025931 | Ga0207644_11210881 | Ga0207644_112108811 | 73 |
| 31 | 3300025941 | Ga0207711_10860707 | Ga0207711_108607073 | 73 |
| 32 | 3300025944 | Ga0207661_10863209 | Ga0207661_108632092 | 73 |
| 33 | 3300025960 | Ga0207651_11883594 | Ga0207651_118835942 | 73 |
| 34 | 3300026023 | Ga0207677_10145860 | Ga0207677_101458602 | 73 |
| 35 | 3300026041 | Ga0207639_10431215 | Ga0207639_104312153 | 73 |
| 36 | 3300026067 | Ga0207678_10140294 | Ga0207678_101402945 | 73 |
| 37 | 3300028379 | Ga0268266_10369506 | Ga0268266_103695063 | 73 |
| 38 | 3300028380 | Ga0268265_12447630 | Ga0268265_124476301 | 73 |
| 39 | 3300041452 | Ga0451793_0529812 | Ga0451793_0529812_66_350 | 73 |
| 40 | 3300041486 | Ga0451807_0326284 | Ga0451807_0326284_315_599 | 73 |
| 41 | 3300041512 | Ga0451853_2004371 | Ga0451853_2004371_662_946 | 73 |
| 42 | 3300046460 | Ga0495638_0649939 | Ga0495638_0649939_122_406 | 73 |
| 43 | 3300046515 | Ga0495620_0339428 | Ga0495620_0339428_153_437 | 73 |
| 44 | 3300046522 | Ga0495643_0313120 | Ga0495643_0313120_20_304 | 73 |
| 45 | 3300047472 | Ga0495686_0318245 | Ga0495686_0318245_147_431 | 73 |
| 46 | 3300048904 | Ga0496101_0588474 | Ga0496101_0588474_239_523 | 73 |
| 47 | 3300048907 | Ga0496104_1590626 | Ga0496104_1590626_138_422 | 73 |
| 48 | 3300048911 | Ga0496108_0024669 | Ga0496108_0024669_1827_2111 | 73 |
| 49 | 3300048912 | Ga0496109_0336463 | Ga0496109_0336463_809_1093 | 73 |
| 50 | 3300048914 | Ga0496111_0192782 | Ga0496111_0192782_501_785 | 73 |
| 51 | 3300048915 | Ga0496112_0037169 | Ga0496112_0037169_3624_3908 | 73 |
| 52 | 3300048915 | Ga0496112_0102654 | Ga0496112_0102654_1989_2273 | 73 |
| 53 | 3300048916 | Ga0496113_0033107 | Ga0496113_0033107_130_414 | 73 |
| 54 | 3300050490 | nmdc:mga03n38_27563_c1 | nmdc:mga03n38_27563_c1_434_718 | 73 |
| 55 | 3300050494 | nmdc:mga06z11_517283_c1 | nmdc:mga06z11_517283_c1_383_667 | 73 |
| 56 | 3300050496 | nmdc:mga07m45_75920_c1 | nmdc:mga07m45_75920_c1_460_744 | 73 |
| 57 | 3300053083 | Ga0495655_0022324 | Ga0495655_0022324_492_776 | 73 |
| 58 | 3300005344 | Ga0070661_101097611 | Ga0070661_1010976112 | 75 |
| 59 | 3300006871 | Ga0075434_101084781 | Ga0075434_1010847812 | 75 |
| 60 | 3300009094 | Ga0111539_12374295 | Ga0111539_123742952 | 75 |
| 61 | 3300009098 | Ga0105245_10243309 | Ga0105245_102433093 | 75 |
| 62 | 3300009174 | Ga0105241_11491771 | Ga0105241_114917712 | 75 |
| 63 | 3300009176 | Ga0105242_13328972 | Ga0105242_133289722 | 75 |
| 64 | 3300013306 | Ga0163162_12215108 | Ga0163162_122151082 | 75 |
| 65 | 3300025911 | Ga0207654_10558975 | Ga0207654_105589752 | 75 |
| 66 | 3300025920 | Ga0207649_11015015 | Ga0207649_110150151 | 75 |
| 67 | 3300025927 | Ga0207687_10472149 | Ga0207687_104721493 | 75 |
| 68 | 3300035692 | Ga0373935_1128009 | Ga0373935_1128009_110_394 | 75 |
| 69 | 3300035725 | Ga0373947_0392007 | Ga0373947_0392007_162_446 | 75 |
| 70 | 3300044658 | Ga0466972_0413623 | Ga0466972_0413623_275_559 | 75 |
| 71 | 3300045976 | Ga0466967_1180029 | Ga0466967_1180029_112_396 | 75 |
| 72 | 3300046455 | Ga0495603_0049363 | Ga0495603_0049363_1077_1361 | 75 |
| 73 | 3300046477 | Ga0495664_0191656 | Ga0495664_0191656_264_548 | 75 |
| 74 | 3300046674 | Ga0495588_0086626 | Ga0495588_0086626_1085_1369 | 75 |
| 75 | 3300047321 | Ga0495676_0104634 | Ga0495676_0104634_763_1047 | 75 |
| 76 | 3300048089 | Ga0495614_0294628 | Ga0495614_0294628_40_324 | 75 |
| 77 | 3300048903 | Ga0496100_0184369 | Ga0496100_0184369_547_831 | 75 |
| 78 | 3300048905 | Ga0496102_0284382 | Ga0496102_0284382_945_1229 | 75 |
| 79 | 3300048906 | Ga0496103_0790700 | Ga0496103_0790700_131_415 | 75 |
| 80 | 3300048909 | Ga0496106_0785422 | Ga0496106_0785422_98_382 | 75 |
| 81 | 3300048912 | Ga0496109_0195510 | Ga0496109_0195510_623_907 | 75 |
| 82 | 3300048915 | Ga0496112_0085593 | Ga0496112_0085593_1250_1534 | 75 |
| 83 | 3300048916 | Ga0496113_0617710 | Ga0496113_0617710_193_477 | 75 |
| 84 | 3300049569 | Ga0501032_0005028 | Ga0501032_0005028_4290_4574 | 75 |
| 85 | 3300049570 | Ga0501033_0152624 | Ga0501033_0152624_738_1022 | 75 |
| 86 | 3300049571 | Ga0501034_0010017 | Ga0501034_0010017_4276_4560 | 75 |
| 87 | 3300049572 | Ga0501036_0007496 | Ga0501036_0007496_5326_5610 | 75 |
| 88 | 3300049573 | Ga0501037_0001645 | Ga0501037_0001645_3688_3972 | 75 |
| 89 | 3300049574 | Ga0501038_0091240 | Ga0501038_0091240_2034_2318 | 75 |
| 90 | 3300049575 | Ga0501039_0000415 | Ga0501039_0000415_18064_18348 | 75 |
| 91 | 3300049579 | Ga0501043_0001031 | Ga0501043_0001031_3688_3972 | 75 |
| 92 | 3300049583 | Ga0501067_0259502 | Ga0501067_0259502_664_948 | 75 |
| 93 | 3300049586 | Ga0501070_0000517 | Ga0501070_0000517_12167_12451 | 75 |
| 94 | 3300049589 | Ga0501073_0022631 | Ga0501073_0022631_1344_1628 | 75 |
| 95 | 3300049593 | Ga0501077_0089915 | Ga0501077_0089915_1535_1819 | 75 |
| 96 | 3300049823 | Ga0501044_0011535 | Ga0501044_0011535_6064_6348 | 75 |
| 97 | 3300050511 | nmdc:mga08y16_1516679_c1 | nmdc:mga08y16_1516679_c1_143_427 | 75 |
| 98 | 3300005439 | Ga0070711_100143549 | Ga0070711_1001435492 | 76 |
| 99 | 3300025916 | Ga0207663_10142833 | Ga0207663_101428332 | 76 |
| 100 | 3300046459 | Ga0495629_0043593 | Ga0495629_0043593_585_869 | 76 |
| 101 | 3300046473 | Ga0495582_0066893 | Ga0495582_0066893_471_755 | 76 |
| 102 | 3300046475 | Ga0495639_0164784 | Ga0495639_0164784_252_536 | 76 |
| 103 | 3300046476 | Ga0495662_0079947 | Ga0495662_0079947_625_909 | 76 |
| 104 | 3300046499 | Ga0495594_0044311 | Ga0495594_0044311_1258_1542 | 76 |
| 105 | 3300046526 | Ga0495666_0404572 | Ga0495666_0404572_309_593 | 76 |
| 106 | 3300046531 | Ga0495665_0202111 | Ga0495665_0202111_585_869 | 76 |
| 107 | 3300046642 | Ga0495634_0188660 | Ga0495634_0188660_221_505 | 76 |
| 108 | 3300046683 | Ga0495658_0108945 | Ga0495658_0108945_881_1165 | 76 |
| 109 | 3300046690 | Ga0495624_0182716 | Ga0495624_0182716_880_1164 | 76 |
| 110 | 3300047315 | Ga0495581_0012840 | Ga0495581_0012840_2571_2855 | 76 |
| 111 | 3300047319 | Ga0495674_0377959 | Ga0495674_0377959_492_776 | 76 |
| 112 | 3300047322 | Ga0495680_0463701 | Ga0495680_0463701_158_442 | 76 |
| 113 | 3300047673 | Ga0495593_0015467 | Ga0495593_0015467_556_840 | 76 |
| 114 | 3300048905 | Ga0496102_1946997 | Ga0496102_1946997_21_272 | 76 |
| 115 | 3300053077 | Ga0495601_1062841 | Ga0495601_1062841_211_495 | 76 |
| 116 | 3300053085 | Ga0495619_0127029 | Ga0495619_0127029_520_804 | 76 |
| 117 | 3300036647 | Ga0316582_0856441 | Ga0316582_0856441_124_366 | 77 |
| 118 | 3300050489 | nmdc:mga03683_279374_c1 | nmdc:mga03683_279374_c1_154_411 | 77 |
| 119 | 3300050490 | nmdc:mga03n38_330086_c1 | nmdc:mga03n38_330086_c1_219_476 | 77 |
| 120 | 3300050490 | nmdc:mga03n38_4358_c1 | nmdc:mga03n38_4358_c1_1889_2146 | 77 |
| 121 | 3300050490 | nmdc:mga03n38_856493_c1 | nmdc:mga03n38_856493_c1_226_483 | 77 |
| 122 | 3300050491 | nmdc:mga00v17_155290_c1 | nmdc:mga00v17_155290_c1_1062_1319 | 77 |
| 123 | 3300050491 | nmdc:mga00v17_217430_c1 | nmdc:mga00v17_217430_c1_222_479 | 77 |
| 124 | 3300050491 | nmdc:mga00v17_37801_c1 | nmdc:mga00v17_37801_c1_1812_2069 | 77 |
| 125 | 3300050492 | nmdc:mga0yw44_1250162_c1 | nmdc:mga0yw44_1250162_c1_145_402 | 77 |
| 126 | 3300050492 | nmdc:mga0yw44_135427_c1 | nmdc:mga0yw44_135427_c1_377_634 | 77 |
| 127 | 3300050492 | nmdc:mga0yw44_194798_c1 | nmdc:mga0yw44_194798_c1_20_262 | 77 |
| 128 | 3300050495 | nmdc:mga04h51_13848_c1 | nmdc:mga04h51_13848_c1_1633_1890 | 77 |
| 129 | 3300050496 | nmdc:mga07m45_248181_c1 | nmdc:mga07m45_248181_c1_50_307 | 77 |
| 130 | 3300050496 | nmdc:mga07m45_303117_c1 | nmdc:mga07m45_303117_c1_321_578 | 77 |
| 131 | 3300050516 | nmdc:mga0sz30_1370_c2 | nmdc:mga0sz30_1370_c2_2816_3058 | 77 |
| 132 | 3300050516 | nmdc:mga0sz30_221375_c1 | nmdc:mga0sz30_221375_c1_374_631 | 77 |
| 133 | 3300053096 | Ga0500641_0275757 | Ga0500641_0275757_401_685 | 77 |
| 134 | 3300041460 | Ga0451802_1453621 | Ga0451802_1453621_110_394 | 78 |
| 135 | 3300005535 | Ga0070684_100482852 | Ga0070684_1004828522 | 80 |
| 136 | 3300006048 | Ga0075363_100025211 | Ga0075363_1000252113 | 80 |
| 137 | 3300006051 | Ga0075364_10001392 | Ga0075364_1000139210 | 80 |
| 138 | 3300006178 | Ga0075367_10404859 | Ga0075367_104048592 | 80 |
| 139 | 3300006186 | Ga0075369_10011940 | Ga0075369_100119404 | 80 |
| 140 | 3300006353 | Ga0075370_10026618 | Ga0075370_100266184 | 80 |
| 141 | 3300013105 | Ga0157369_10295679 | Ga0157369_102956793 | 80 |
| 142 | 3300021384 | Ga0213876_10004134 | Ga0213876_100041343 | 80 |
| 143 | 3300025921 | Ga0207652_11210726 | Ga0207652_112107262 | 80 |
| 144 | 3300025929 | Ga0207664_10043052 | Ga0207664_100430522 | 80 |
| 145 | 3300025929 | Ga0207664_10553727 | Ga0207664_105537272 | 80 |
| 146 | 3300039437 | Ga0436365_0203528 | Ga0436365_0203528_7590_7853 | 80 |
| 147 | 3300039437 | Ga0436365_1017373 | Ga0436365_1017373_18_281 | 80 |
| 148 | 3300044694 | Ga0466963_0052885 | Ga0466963_0052885_130_393 | 80 |
| 149 | 3300044694 | Ga0466963_0282581 | Ga0466963_0282581_823_1086 | 80 |
| 150 | 3300044694 | Ga0466963_0472300 | Ga0466963_0472300_98_361 | 80 |
| 151 | 3300044842 | Ga0466957_0293476 | Ga0466957_0293476_217_480 | 80 |
| 152 | 3300045836 | Ga0466958_0266382 | Ga0466958_0266382_103_366 | 80 |
| 153 | 3300045976 | Ga0466967_0018062 | Ga0466967_0018062_2152_2415 | 80 |
| 154 | 3300045976 | Ga0466967_0024967 | Ga0466967_0024967_4023_4286 | 80 |
| 155 | 3300048915 | Ga0496112_1047380 | Ga0496112_1047380_437_700 | 80 |
| 156 | 3300048929 | Ga0496126_0010527 | Ga0496126_0010527_2970_3233 | 80 |
| 157 | 3300049569 | Ga0501032_0005216 | Ga0501032_0005216_287_550 | 80 |
| 158 | 3300049570 | Ga0501033_0441147 | Ga0501033_0441147_44_307 | 80 |
| 159 | 3300049571 | Ga0501034_0037809 | Ga0501034_0037809_4416_4679 | 80 |
| 160 | 3300049571 | Ga0501034_1111044 | Ga0501034_1111044_140_403 | 80 |
| 161 | 3300049572 | Ga0501036_1748899 | Ga0501036_1748899_228_491 | 80 |
| 162 | 3300049579 | Ga0501043_0336312 | Ga0501043_0336312_112_375 | 80 |
| 163 | 3300049580 | Ga0501046_0003427 | Ga0501046_0003427_185_448 | 80 |
| 164 | 3300049581 | Ga0501047_0217582 | Ga0501047_0217582_273_536 | 80 |
| 165 | 3300049586 | Ga0501070_0003022 | Ga0501070_0003022_13520_13783 | 80 |
| 166 | 3300049823 | Ga0501044_0003141 | Ga0501044_0003141_174_437 | 80 |
| 167 | 3300049823 | Ga0501044_0609618 | Ga0501044_0609618_170_433 | 80 |
| 168 | 3300049823 | Ga0501044_0724734 | Ga0501044_0724734_587_850 | 80 |
| 169 | 3300050491 | nmdc:mga00v17_2148_c1 | nmdc:mga00v17_2148_c1_2478_2741 | 80 |
| 170 | 3300050492 | nmdc:mga0yw44_292519_c1 | nmdc:mga0yw44_292519_c1_114_377 | 80 |
| 171 | 3300050494 | nmdc:mga06z11_365921_c1 | nmdc:mga06z11_365921_c1_161_424 | 80 |
| 172 | 3300050496 | nmdc:mga07m45_12350_c1 | nmdc:mga07m45_12350_c1_1807_2070 | 80 |
| 173 | 3300050512 | nmdc:mga0n895_750201_c1 | nmdc:mga0n895_750201_c1_169_432 | 80 |
| 174 | 3300050516 | nmdc:mga0sz30_32150_c1 | nmdc:mga0sz30_32150_c1_1195_1458 | 80 |
| 175 | 3300053086 | Ga0500578_0254080 | Ga0500578_0254080_301_564 | 80 |
| 176 | 3300049571 | Ga0501034_0567611 | Ga0501034_0567611_115_390 | 82 |
| 177 | 3300001977 | JGI24746J21847_1064679 | JGI24746J21847_10646792 | 84 |
| 178 | 3300001989 | JGI24739J22299_10105663 | JGI24739J22299_101056631 | 84 |
| 179 | 3300001990 | JGI24737J22298_10076471 | JGI24737J22298_100764712 | 84 |
| 180 | 3300001991 | JGI24743J22301_10060984 | JGI24743J22301_100609841 | 84 |
| 181 | 3300001991 | JGI24743J22301_10069475 | JGI24743J22301_100694751 | 84 |
| 182 | 3300002070 | JGI24750J21931_1024546 | JGI24750J21931_10245462 | 84 |
| 183 | 3300002070 | JGI24750J21931_1028678 | JGI24750J21931_10286782 | 84 |
| 184 | 3300002073 | JGI24745J21846_1006210 | JGI24745J21846_10062102 | 84 |
| 185 | 3300002074 | JGI24748J21848_1012428 | JGI24748J21848_10124282 | 84 |
| 186 | 3300002076 | JGI24749J21850_1041439 | JGI24749J21850_10414392 | 84 |
| 187 | 3300002239 | JGI24034J26672_10090629 | JGI24034J26672_100906292 | 84 |
| 188 | 3300002244 | JGI24742J22300_10000515 | JGI24742J22300_100005151 | 84 |
| 189 | 3300002459 | JGI24751J29686_10007367 | JGI24751J29686_100073674 | 84 |
| 190 | 3300005333 | Ga0070677_10538921 | Ga0070677_105389211 | 84 |
| 191 | 3300005335 | Ga0070666_10313295 | Ga0070666_103132952 | 84 |
| 192 | 3300005336 | Ga0070680_100132664 | Ga0070680_1001326642 | 84 |
| 193 | 3300005338 | Ga0068868_100156231 | Ga0068868_1001562313 | 84 |
| 194 | 3300005339 | Ga0070660_100309610 | Ga0070660_1003096102 | 84 |
| 195 | 3300005340 | Ga0070689_100008880 | Ga0070689_1000088804 | 84 |
| 196 | 3300005340 | Ga0070689_100190789 | Ga0070689_1001907892 | 84 |
| 197 | 3300005340 | Ga0070689_101824962 | Ga0070689_1018249621 | 84 |
| 198 | 3300005341 | Ga0070691_10003658 | Ga0070691_100036581 | 84 |
| 199 | 3300005341 | Ga0070691_10924266 | Ga0070691_109242662 | 84 |
| 200 | 3300005343 | Ga0070687_100922540 | Ga0070687_1009225401 | 84 |
| 201 | 3300005345 | Ga0070692_10045472 | Ga0070692_100454723 | 84 |
| 202 | 3300005353 | Ga0070669_100274591 | Ga0070669_1002745912 | 84 |
| 203 | 3300005354 | Ga0070675_100117867 | Ga0070675_1001178671 | 84 |
| 204 | 3300005355 | Ga0070671_100061096 | Ga0070671_1000610964 | 84 |
| 205 | 3300005355 | Ga0070671_102088947 | Ga0070671_1020889472 | 84 |
| 206 | 3300005356 | Ga0070674_100000896 | Ga0070674_10000089614 | 84 |
| 207 | 3300005364 | Ga0070673_100132002 | Ga0070673_1001320022 | 84 |
| 208 | 3300005365 | Ga0070688_100690413 | Ga0070688_1006904132 | 84 |
| 209 | 3300005366 | Ga0070659_100413746 | Ga0070659_1004137462 | 84 |
| 210 | 3300005367 | Ga0070667_100001428 | Ga0070667_10000142817 | 84 |
| 211 | 3300005367 | Ga0070667_100048517 | Ga0070667_1000485176 | 84 |
| 212 | 3300005435 | Ga0070714_100012275 | Ga0070714_1000122759 | 84 |
| 213 | 3300005437 | Ga0070710_10000757 | Ga0070710_100007577 | 84 |
| 214 | 3300005437 | Ga0070710_10265670 | Ga0070710_102656702 | 84 |
| 215 | 3300005438 | Ga0070701_10000936 | Ga0070701_1000093611 | 84 |
| 216 | 3300005439 | Ga0070711_100001244 | Ga0070711_1000012443 | 84 |
| 217 | 3300005439 | Ga0070711_100021879 | Ga0070711_1000218796 | 84 |
| 218 | 3300005440 | Ga0070705_101058414 | Ga0070705_1010584142 | 84 |
| 219 | 3300005441 | Ga0070700_100004370 | Ga0070700_1000043708 | 84 |
| 220 | 3300005444 | Ga0070694_100071853 | Ga0070694_1000718533 | 84 |
| 221 | 3300005455 | Ga0070663_100381144 | Ga0070663_1003811442 | 84 |
| 222 | 3300005456 | Ga0070678_100000686 | Ga0070678_10000068614 | 84 |
| 223 | 3300005466 | Ga0070685_10203700 | Ga0070685_102037003 | 84 |
| 224 | 3300005536 | Ga0070697_101920348 | Ga0070697_1019203482 | 84 |
| 225 | 3300005539 | Ga0068853_100011795 | Ga0068853_1000117957 | 84 |
| 226 | 3300005539 | Ga0068853_100832533 | Ga0068853_1008325332 | 84 |
| 227 | 3300005543 | Ga0070672_100128985 | Ga0070672_1001289854 | 84 |
| 228 | 3300005544 | Ga0070686_100192523 | Ga0070686_1001925232 | 84 |
| 229 | 3300005545 | Ga0070695_100038333 | Ga0070695_1000383334 | 84 |
| 230 | 3300005546 | Ga0070696_100002978 | Ga0070696_10000297810 | 84 |
| 231 | 3300005546 | Ga0070696_100170524 | Ga0070696_1001705243 | 84 |
| 232 | 3300005548 | Ga0070665_100032322 | Ga0070665_1000323221 | 84 |
| 233 | 3300005548 | Ga0070665_100120811 | Ga0070665_1001208112 | 84 |
| 234 | 3300005549 | Ga0070704_100000067 | Ga0070704_10000006720 | 84 |
| 235 | 3300005549 | Ga0070704_101087943 | Ga0070704_1010879432 | 84 |
| 236 | 3300005563 | Ga0068855_101621229 | Ga0068855_1016212292 | 84 |
| 237 | 3300005563 | Ga0068855_102389378 | Ga0068855_1023893781 | 84 |
| 238 | 3300005578 | Ga0068854_100133932 | Ga0068854_1001339323 | 84 |
| 239 | 3300005616 | Ga0068852_100067992 | Ga0068852_1000679923 | 84 |
| 240 | 3300005617 | Ga0068859_100023821 | Ga0068859_1000238214 | 84 |
| 241 | 3300005617 | Ga0068859_102069662 | Ga0068859_1020696622 | 84 |
| 242 | 3300005618 | Ga0068864_100035545 | Ga0068864_1000355455 | 84 |
| 243 | 3300005718 | Ga0068866_10001888 | Ga0068866_100018885 | 84 |
| 244 | 3300005718 | Ga0068866_10101877 | Ga0068866_101018772 | 84 |
| 245 | 3300005719 | Ga0068861_100013874 | Ga0068861_10001387410 | 84 |
| 246 | 3300005719 | Ga0068861_100384863 | Ga0068861_1003848633 | 84 |
| 247 | 3300005719 | Ga0068861_100704243 | Ga0068861_1007042432 | 84 |
| 248 | 3300005834 | Ga0068851_10060512 | Ga0068851_100605123 | 84 |
| 249 | 3300005841 | Ga0068863_100323222 | Ga0068863_1003232221 | 84 |
| 250 | 3300005841 | Ga0068863_100360867 | Ga0068863_1003608673 | 84 |
| 251 | 3300005842 | Ga0068858_100003627 | Ga0068858_10000362716 | 84 |
| 252 | 3300005843 | Ga0068860_100001873 | Ga0068860_1000018738 | 84 |
| 253 | 3300005844 | Ga0068862_100004548 | Ga0068862_1000045484 | 84 |
| 254 | 3300005844 | Ga0068862_100300989 | Ga0068862_1003009892 | 84 |
| 255 | 3300005844 | Ga0068862_101091975 | Ga0068862_1010919751 | 84 |
| 256 | 3300005983 | Ga0081540_1064746 | Ga0081540_10647462 | 84 |
| 257 | 3300006028 | Ga0070717_10516726 | Ga0070717_105167263 | 84 |
| 258 | 3300006038 | Ga0075365_10065228 | Ga0075365_100652282 | 84 |
| 259 | 3300006042 | Ga0075368_10118983 | Ga0075368_101189832 | 84 |
| 260 | 3300006048 | Ga0075363_100046656 | Ga0075363_1000466563 | 84 |
| 261 | 3300006048 | Ga0075363_100583813 | Ga0075363_1005838132 | 84 |
| 262 | 3300006048 | Ga0075363_100782378 | Ga0075363_1007823781 | 84 |
| 263 | 3300006051 | Ga0075364_10031967 | Ga0075364_100319672 | 84 |
| 264 | 3300006051 | Ga0075364_10081659 | Ga0075364_100816594 | 84 |
| 265 | 3300006163 | Ga0070715_10053684 | Ga0070715_100536843 | 84 |
| 266 | 3300006173 | Ga0070716_100038304 | Ga0070716_1000383044 | 84 |
| 267 | 3300006175 | Ga0070712_100005216 | Ga0070712_1000052164 | 84 |
| 268 | 3300006175 | Ga0070712_100006240 | Ga0070712_10000624010 | 84 |
| 269 | 3300006177 | Ga0075362_10023774 | Ga0075362_100237744 | 84 |
| 270 | 3300006186 | Ga0075369_10004855 | Ga0075369_100048556 | 84 |
| 271 | 3300006237 | Ga0097621_100146739 | Ga0097621_1001467393 | 84 |
| 272 | 3300006353 | Ga0075370_10175164 | Ga0075370_101751642 | 84 |
| 273 | 3300006358 | Ga0068871_100090028 | Ga0068871_1000900284 | 84 |
| 274 | 3300006881 | Ga0068865_100054923 | Ga0068865_1000549232 | 84 |
| 275 | 3300006931 | Ga0097620_100023820 | Ga0097620_1000238204 | 84 |
| 276 | 3300006931 | Ga0097620_102069625 | Ga0097620_1020696252 | 84 |
| 277 | 3300009092 | Ga0105250_10023063 | Ga0105250_100230633 | 84 |
| 278 | 3300009098 | Ga0105245_10002934 | Ga0105245_100029342 | 84 |
| 279 | 3300009098 | Ga0105245_10189846 | Ga0105245_101898463 | 84 |
| 280 | 3300009098 | Ga0105245_10494819 | Ga0105245_104948193 | 84 |
| 281 | 3300009101 | Ga0105247_10007322 | Ga0105247_100073223 | 84 |
| 282 | 3300009101 | Ga0105247_11057394 | Ga0105247_110573942 | 84 |
| 283 | 3300009147 | Ga0114129_10587038 | Ga0114129_105870382 | 84 |
| 284 | 3300009148 | Ga0105243_10001892 | Ga0105243_1000189210 | 84 |
| 285 | 3300009148 | Ga0105243_10123247 | Ga0105243_101232474 | 84 |
| 286 | 3300009174 | Ga0105241_10070822 | Ga0105241_100708221 | 84 |
| 287 | 3300009176 | Ga0105242_10003653 | Ga0105242_1000365314 | 84 |
| 288 | 3300009176 | Ga0105242_11287971 | Ga0105242_112879712 | 84 |
| 289 | 3300009177 | Ga0105248_10030730 | Ga0105248_100307303 | 84 |
| 290 | 3300009177 | Ga0105248_10507514 | Ga0105248_105075142 | 84 |
| 291 | 3300009545 | Ga0105237_10037561 | Ga0105237_100375614 | 84 |
| 292 | 3300009545 | Ga0105237_10846903 | Ga0105237_108469032 | 84 |
| 293 | 3300009551 | Ga0105238_10271523 | Ga0105238_102715233 | 84 |
| 294 | 3300009553 | Ga0105249_10034660 | Ga0105249_100346603 | 84 |
| 295 | 3300009553 | Ga0105249_10294841 | Ga0105249_102948413 | 84 |
| 296 | 3300009553 | Ga0105249_10737536 | Ga0105249_107375362 | 84 |
| 297 | 3300010375 | Ga0105239_10050198 | Ga0105239_100501988 | 84 |
| 298 | 3300010375 | Ga0105239_11191569 | Ga0105239_111915692 | 84 |
| 299 | 3300011119 | Ga0105246_10034395 | Ga0105246_100343952 | 84 |
| 300 | 3300013100 | Ga0157373_10502005 | Ga0157373_105020052 | 84 |
| 301 | 3300013102 | Ga0157371_10195240 | Ga0157371_101952402 | 84 |
| 302 | 3300013105 | Ga0157369_10826783 | Ga0157369_108267831 | 84 |
| 303 | 3300013105 | Ga0157369_11249968 | Ga0157369_112499682 | 84 |
| 304 | 3300013296 | Ga0157374_10085471 | Ga0157374_100854712 | 84 |
| 305 | 3300013296 | Ga0157374_10136824 | Ga0157374_101368243 | 84 |
| 306 | 3300013297 | Ga0157378_10000749 | Ga0157378_100007494 | 84 |
| 307 | 3300013297 | Ga0157378_10169887 | Ga0157378_101698873 | 84 |
| 308 | 3300013306 | Ga0163162_10006559 | Ga0163162_100065597 | 84 |
| 309 | 3300013306 | Ga0163162_10140182 | Ga0163162_101401823 | 84 |
| 310 | 3300013306 | Ga0163162_10375304 | Ga0163162_103753043 | 84 |
| 311 | 3300013306 | Ga0163162_12252913 | Ga0163162_122529131 | 84 |
| 312 | 3300013307 | Ga0157372_10093928 | Ga0157372_100939282 | 84 |
| 313 | 3300013307 | Ga0157372_10171540 | Ga0157372_101715405 | 84 |
| 314 | 3300013308 | Ga0157375_10013118 | Ga0157375_100131183 | 84 |
| 315 | 3300013308 | Ga0157375_10361649 | Ga0157375_103616493 | 84 |
| 316 | 3300014325 | Ga0163163_10124808 | Ga0163163_101248083 | 84 |
| 317 | 3300014325 | Ga0163163_11914968 | Ga0163163_119149681 | 84 |
| 318 | 3300014326 | Ga0157380_10002388 | Ga0157380_100023887 | 84 |
| 319 | 3300014326 | Ga0157380_10195347 | Ga0157380_101953473 | 84 |
| 320 | 3300014497 | Ga0182008_10499095 | Ga0182008_104990952 | 84 |
| 321 | 3300014745 | Ga0157377_10037870 | Ga0157377_100378705 | 84 |
| 322 | 3300014745 | Ga0157377_10082881 | Ga0157377_100828813 | 84 |
| 323 | 3300014968 | Ga0157379_10024948 | Ga0157379_100249482 | 84 |
| 324 | 3300014968 | Ga0157379_11195655 | Ga0157379_111956552 | 84 |
| 325 | 3300014969 | Ga0157376_10043615 | Ga0157376_100436155 | 84 |
| 326 | 3300014969 | Ga0157376_10082415 | Ga0157376_100824154 | 84 |
| 327 | 3300017792 | Ga0163161_10058377 | Ga0163161_100583774 | 84 |
| 328 | 3300017792 | Ga0163161_10284669 | Ga0163161_102846692 | 84 |
| 329 | 3300021358 | Ga0213873_10188601 | Ga0213873_101886011 | 84 |
| 330 | 3300021388 | Ga0213875_10024382 | Ga0213875_100243823 | 84 |
| 331 | 3300025321 | Ga0207656_10452744 | Ga0207656_104527442 | 84 |
| 332 | 3300025885 | Ga0207653_10071124 | Ga0207653_100711242 | 84 |
| 333 | 3300025898 | Ga0207692_10001181 | Ga0207692_100011819 | 84 |
| 334 | 3300025898 | Ga0207692_10038390 | Ga0207692_100383903 | 84 |
| 335 | 3300025898 | Ga0207692_10098595 | Ga0207692_100985952 | 84 |
| 336 | 3300025899 | Ga0207642_10000298 | Ga0207642_100002989 | 84 |
| 337 | 3300025900 | Ga0207710_10004941 | Ga0207710_100049413 | 84 |
| 338 | 3300025900 | Ga0207710_10741882 | Ga0207710_107418822 | 84 |
| 339 | 3300025901 | Ga0207688_10017752 | Ga0207688_100177525 | 84 |
| 340 | 3300025901 | Ga0207688_10027795 | Ga0207688_100277953 | 84 |
| 341 | 3300025904 | Ga0207647_10047021 | Ga0207647_100470214 | 84 |
| 342 | 3300025905 | Ga0207685_10082925 | Ga0207685_100829252 | 84 |
| 343 | 3300025906 | Ga0207699_10037229 | Ga0207699_100372293 | 84 |
| 344 | 3300025906 | Ga0207699_10052570 | Ga0207699_100525704 | 84 |
| 345 | 3300025907 | Ga0207645_10006992 | Ga0207645_100069928 | 84 |
| 346 | 3300025907 | Ga0207645_10030445 | Ga0207645_100304456 | 84 |
| 347 | 3300025911 | Ga0207654_10021736 | Ga0207654_100217365 | 84 |
| 348 | 3300025911 | Ga0207654_11357456 | Ga0207654_113574561 | 84 |
| 349 | 3300025915 | Ga0207693_10022627 | Ga0207693_100226279 | 84 |
| 350 | 3300025916 | Ga0207663_10081981 | Ga0207663_100819812 | 84 |
| 351 | 3300025917 | Ga0207660_11313937 | Ga0207660_113139371 | 84 |
| 352 | 3300025918 | Ga0207662_10135344 | Ga0207662_101353443 | 84 |
| 353 | 3300025920 | Ga0207649_11469919 | Ga0207649_114699192 | 84 |
| 354 | 3300025923 | Ga0207681_10037058 | Ga0207681_100370584 | 84 |
| 355 | 3300025923 | Ga0207681_10184399 | Ga0207681_101843993 | 84 |
| 356 | 3300025924 | Ga0207694_10119702 | Ga0207694_101197023 | 84 |
| 357 | 3300025926 | Ga0207659_11126192 | Ga0207659_111261921 | 84 |
| 358 | 3300025927 | Ga0207687_10000787 | Ga0207687_100007877 | 84 |
| 359 | 3300025927 | Ga0207687_10107299 | Ga0207687_101072994 | 84 |
| 360 | 3300025929 | Ga0207664_10035288 | Ga0207664_100352885 | 84 |
| 361 | 3300025929 | Ga0207664_11551397 | Ga0207664_115513972 | 84 |
| 362 | 3300025931 | Ga0207644_10055683 | Ga0207644_100556835 | 84 |
| 363 | 3300025931 | Ga0207644_10150319 | Ga0207644_101503193 | 84 |
| 364 | 3300025932 | Ga0207690_10006108 | Ga0207690_100061086 | 84 |
| 365 | 3300025933 | Ga0207706_10005968 | Ga0207706_1000596812 | 84 |
| 366 | 3300025935 | Ga0207709_10027163 | Ga0207709_100271635 | 84 |
| 367 | 3300025935 | Ga0207709_10087047 | Ga0207709_100870472 | 84 |
| 368 | 3300025937 | Ga0207669_10046156 | Ga0207669_100461563 | 84 |
| 369 | 3300025938 | Ga0207704_10000348 | Ga0207704_1000034819 | 84 |
| 370 | 3300025938 | Ga0207704_10637685 | Ga0207704_106376851 | 84 |
| 371 | 3300025939 | Ga0207665_10003947 | Ga0207665_100039473 | 84 |
| 372 | 3300025939 | Ga0207665_10004368 | Ga0207665_1000436811 | 84 |
| 373 | 3300025940 | Ga0207691_10078966 | Ga0207691_100789663 | 84 |
| 374 | 3300025941 | Ga0207711_10014542 | Ga0207711_100145424 | 84 |
| 375 | 3300025941 | Ga0207711_10238177 | Ga0207711_102381773 | 84 |
| 376 | 3300025941 | Ga0207711_10458387 | Ga0207711_104583871 | 84 |
| 377 | 3300025942 | Ga0207689_10002180 | Ga0207689_1000218011 | 84 |
| 378 | 3300025942 | Ga0207689_10027743 | Ga0207689_100277431 | 84 |
| 379 | 3300025961 | Ga0207712_10028701 | Ga0207712_100287013 | 84 |
| 380 | 3300025961 | Ga0207712_10520009 | Ga0207712_105200092 | 84 |
| 381 | 3300025961 | Ga0207712_10662584 | Ga0207712_106625842 | 84 |
| 382 | 3300025972 | Ga0207668_10005313 | Ga0207668_100053133 | 84 |
| 383 | 3300025972 | Ga0207668_10178540 | Ga0207668_101785403 | 84 |
| 384 | 3300025981 | Ga0207640_10054970 | Ga0207640_100549703 | 84 |
| 385 | 3300025981 | Ga0207640_10189603 | Ga0207640_101896033 | 84 |
| 386 | 3300025981 | Ga0207640_10602302 | Ga0207640_106023023 | 84 |
| 387 | 3300025986 | Ga0207658_10044332 | Ga0207658_100443323 | 84 |
| 388 | 3300025986 | Ga0207658_10285037 | Ga0207658_102850371 | 84 |
| 389 | 3300025986 | Ga0207658_11744179 | Ga0207658_117441792 | 84 |
| 390 | 3300026023 | Ga0207677_10017210 | Ga0207677_100172101 | 84 |
| 391 | 3300026023 | Ga0207677_10050166 | Ga0207677_100501664 | 84 |
| 392 | 3300026035 | Ga0207703_10009434 | Ga0207703_100094346 | 84 |
| 393 | 3300026035 | Ga0207703_10042930 | Ga0207703_100429303 | 84 |
| 394 | 3300026041 | Ga0207639_10393440 | Ga0207639_103934401 | 84 |
| 395 | 3300026067 | Ga0207678_10039154 | Ga0207678_100391542 | 84 |
| 396 | 3300026067 | Ga0207678_10066530 | Ga0207678_100665305 | 84 |
| 397 | 3300026075 | Ga0207708_10000696 | Ga0207708_1000069621 | 84 |
| 398 | 3300026075 | Ga0207708_10010104 | Ga0207708_100101048 | 84 |
| 399 | 3300026088 | Ga0207641_10211917 | Ga0207641_102119171 | 84 |
| 400 | 3300026088 | Ga0207641_10232667 | Ga0207641_102326673 | 84 |
| 401 | 3300026089 | Ga0207648_10003748 | Ga0207648_1000374810 | 84 |
| 402 | 3300026095 | Ga0207676_10032203 | Ga0207676_100322034 | 84 |
| 403 | 3300026118 | Ga0207675_100000897 | Ga0207675_10000089710 | 84 |
| 404 | 3300026118 | Ga0207675_100147585 | Ga0207675_1001475854 | 84 |
| 405 | 3300026118 | Ga0207675_100719120 | Ga0207675_1007191202 | 84 |
| 406 | 3300026121 | Ga0207683_10000413 | Ga0207683_1000041310 | 84 |
| 407 | 3300026121 | Ga0207683_10051058 | Ga0207683_100510583 | 84 |
| 408 | 3300026142 | Ga0207698_10072441 | Ga0207698_100724414 | 84 |
| 409 | 3300028379 | Ga0268266_10002437 | Ga0268266_100024375 | 84 |
| 410 | 3300028379 | Ga0268266_10393897 | Ga0268266_103938973 | 84 |
| 411 | 3300028380 | Ga0268265_10036115 | Ga0268265_100361153 | 84 |
| 412 | 3300028380 | Ga0268265_10045597 | Ga0268265_100455974 | 84 |
| 413 | 3300028381 | Ga0268264_10001236 | Ga0268264_100012369 | 84 |
| 414 | 3300028381 | Ga0268264_10469433 | Ga0268264_104694333 | 84 |
| 415 | 3300031852 | Ga0307410_11437538 | Ga0307410_114375381 | 84 |
| 416 | 3300031995 | Ga0307409_100417513 | Ga0307409_1004175132 | 84 |
| 417 | 3300032002 | Ga0307416_102760732 | Ga0307416_1027607322 | 84 |
| 418 | 3300035085 | Ga0373929_0133108 | Ga0373929_0133108_222_485 | 84 |
| 419 | 3300035092 | Ga0373952_0045350 | Ga0373952_0045350_610_873 | 84 |
| 420 | 3300035112 | Ga0373932_0140981 | Ga0373932_0140981_334_597 | 84 |
| 421 | 3300035114 | Ga0373939_0096195 | Ga0373939_0096195_197_460 | 84 |
| 422 | 3300035114 | Ga0373939_0175267 | Ga0373939_0175267_491_754 | 84 |
| 423 | 3300035115 | Ga0373941_0049213 | Ga0373941_0049213_738_1001 | 84 |
| 424 | 3300035121 | Ga0373960_0059289 | Ga0373960_0059289_585_848 | 84 |
| 425 | 3300035207 | Ga0373942_0085691 | Ga0373942_0085691_640_903 | 84 |
| 426 | 3300035241 | Ga0373961_0049759 | Ga0373961_0049759_806_1069 | 84 |
| 427 | 3300035691 | Ga0373931_0205317 | Ga0373931_0205317_119_382 | 84 |
| 428 | 3300036712 | Ga0316584_0009567 | Ga0316584_0009567_3921_4184 | 84 |
| 429 | 3300037418 | Ga0395900_1474356 | Ga0395900_1474356_223_486 | 84 |
| 430 | 3300037853 | Ga0436364_0325252 | Ga0436364_0325252_7962_8225 | 84 |
| 431 | 3300039437 | Ga0436365_1462010 | Ga0436365_1462010_2750_3013 | 84 |
| 432 | 3300039453 | Ga0436362_1140811 | Ga0436362_1140811_350_613 | 84 |
| 433 | 3300041512 | Ga0451853_2423564 | Ga0451853_2423564_146_409 | 84 |
| 434 | 3300044656 | Ga0466969_0107692 | Ga0466969_0107692_299_562 | 84 |
| 435 | 3300044658 | Ga0466972_0010733 | Ga0466972_0010733_1742_2005 | 84 |
| 436 | 3300044658 | Ga0466972_0039852 | Ga0466972_0039852_64_327 | 84 |
| 437 | 3300044658 | Ga0466972_0114372 | Ga0466972_0114372_137_400 | 84 |
| 438 | 3300044658 | Ga0466972_0221576 | Ga0466972_0221576_62_325 | 84 |
| 439 | 3300044683 | Ga0466965_0077219 | Ga0466965_0077219_242_505 | 84 |
| 440 | 3300044684 | Ga0466966_0463830 | Ga0466966_0463830_316_579 | 84 |
| 441 | 3300044693 | Ga0466961_0045929 | Ga0466961_0045929_430_693 | 84 |
| 442 | 3300044719 | Ga0466971_0008530 | Ga0466971_0008530_2596_2859 | 84 |
| 443 | 3300044735 | Ga0466968_0076810 | Ga0466968_0076810_1053_1316 | 84 |
| 444 | 3300044735 | Ga0466968_0423255 | Ga0466968_0423255_213_476 | 84 |
| 445 | 3300044765 | Ga0466970_0003840 | Ga0466970_0003840_1665_1928 | 84 |
| 446 | 3300044842 | Ga0466957_0009732 | Ga0466957_0009732_977_1240 | 84 |
| 447 | 3300044901 | Ga0466960_0014871 | Ga0466960_0014871_1137_1400 | 84 |
| 448 | 3300044901 | Ga0466960_0095270 | Ga0466960_0095270_745_1008 | 84 |
| 449 | 3300044901 | Ga0466960_0193779 | Ga0466960_0193779_671_934 | 84 |
| 450 | 3300044901 | Ga0466960_0946408 | Ga0466960_0946408_51_314 | 84 |
| 451 | 3300045049 | Ga0466959_0021429 | Ga0466959_0021429_1255_1518 | 84 |
| 452 | 3300045049 | Ga0466959_0380987 | Ga0466959_0380987_44_307 | 84 |
| 453 | 3300045836 | Ga0466958_0002994 | Ga0466958_0002994_1680_1943 | 84 |
| 454 | 3300048903 | Ga0496100_0004372 | Ga0496100_0004372_6101_6364 | 84 |
| 455 | 3300048903 | Ga0496100_0683833 | Ga0496100_0683833_392_655 | 84 |
| 456 | 3300048904 | Ga0496101_0014567 | Ga0496101_0014567_4629_4892 | 84 |
| 457 | 3300048904 | Ga0496101_0070129 | Ga0496101_0070129_35_298 | 84 |
| 458 | 3300048904 | Ga0496101_1190226 | Ga0496101_1190226_206_469 | 84 |
| 459 | 3300048905 | Ga0496102_0005139 | Ga0496102_0005139_2507_2770 | 84 |
| 460 | 3300048905 | Ga0496102_0211477 | Ga0496102_0211477_659_922 | 84 |
| 461 | 3300048905 | Ga0496102_0268435 | Ga0496102_0268435_120_383 | 84 |
| 462 | 3300048906 | Ga0496103_0000592 | Ga0496103_0000592_23988_24251 | 84 |
| 463 | 3300048906 | Ga0496103_0058753 | Ga0496103_0058753_796_1059 | 84 |
| 464 | 3300048907 | Ga0496104_0010831 | Ga0496104_0010831_1843_2106 | 84 |
| 465 | 3300048907 | Ga0496104_0148926 | Ga0496104_0148926_1032_1295 | 84 |
| 466 | 3300048908 | Ga0496105_0107787 | Ga0496105_0107787_404_667 | 84 |
| 467 | 3300048909 | Ga0496106_0003432 | Ga0496106_0003432_2920_3183 | 84 |
| 468 | 3300048909 | Ga0496106_0331647 | Ga0496106_0331647_76_339 | 84 |
| 469 | 3300048910 | Ga0496107_0000802 | Ga0496107_0000802_3447_3710 | 84 |
| 470 | 3300048910 | Ga0496107_0152444 | Ga0496107_0152444_721_984 | 84 |
| 471 | 3300048911 | Ga0496108_0003955 | Ga0496108_0003955_7409_7672 | 84 |
| 472 | 3300048911 | Ga0496108_0278538 | Ga0496108_0278538_1183_1446 | 84 |
| 473 | 3300048912 | Ga0496109_0006471 | Ga0496109_0006471_7130_7393 | 84 |
| 474 | 3300048912 | Ga0496109_0050253 | Ga0496109_0050253_2952_3215 | 84 |
| 475 | 3300048913 | Ga0496110_0084323 | Ga0496110_0084323_1556_1819 | 84 |
| 476 | 3300048913 | Ga0496110_0146096 | Ga0496110_0146096_15_278 | 84 |
| 477 | 3300048914 | Ga0496111_0874220 | Ga0496111_0874220_162_425 | 84 |
| 478 | 3300048915 | Ga0496112_0003857 | Ga0496112_0003857_8311_8574 | 84 |
| 479 | 3300048915 | Ga0496112_0043159 | Ga0496112_0043159_820_1083 | 84 |
| 480 | 3300048916 | Ga0496113_0035604 | Ga0496113_0035604_3304_3567 | 84 |
| 481 | 3300048917 | Ga0496114_0000487 | Ga0496114_0000487_19823_20086 | 84 |
| 482 | 3300048918 | Ga0496115_0018299 | Ga0496115_0018299_872_1135 | 84 |
| 483 | 3300048918 | Ga0496115_0048925 | Ga0496115_0048925_49_312 | 84 |
| 484 | 3300050489 | nmdc:mga03683_51840_c1 | nmdc:mga03683_51840_c1_449_712 | 84 |
| 485 | 3300050490 | nmdc:mga03n38_175726_c1 | nmdc:mga03n38_175726_c1_65_328 | 84 |
| 486 | 3300050490 | nmdc:mga03n38_464648_c1 | nmdc:mga03n38_464648_c1_86_349 | 84 |
| 487 | 3300050492 | nmdc:mga0yw44_26172_c1 | nmdc:mga0yw44_26172_c1_1267_1530 | 84 |
| 488 | 3300050495 | nmdc:mga04h51_190272_c1 | nmdc:mga04h51_190272_c1_106_369 | 84 |
| 489 | 3300050496 | nmdc:mga07m45_149775_c1 | nmdc:mga07m45_149775_c1_946_1209 | 84 |
| 490 | 3300050516 | nmdc:mga0sz30_20867_c1 | nmdc:mga0sz30_20867_c1_1051_1314 | 84 |
| 491 | 3300053083 | Ga0495655_0046550 | Ga0495655_0046550_91_354 | 84 |
| 492 | 3300061719 | Ga0466962_0223413 | Ga0466962_0223413_185_448 | 84 |
| 493 | 3300006048 | Ga0075363_100533877 | Ga0075363_1005338772 | 85 |
| 494 | 3300006051 | Ga0075364_10748554 | Ga0075364_107485542 | 85 |
| 495 | 3300009545 | Ga0105237_10248172 | Ga0105237_102481723 | 85 |
| 496 | 3300013105 | Ga0157369_10817910 | Ga0157369_108179102 | 85 |
| 497 | iso_pu_bacteria | 2738541274 | 2738702689 | 85 |
| 498 | iso_pu_bacteria | 2738543028 | 2739329599 | 85 |
| 499 | iso_pu_bacteria | 2902799365 | 2902803175 | 86 |
| 500 | 3300005435 | Ga0070714_101057289 | Ga0070714_1010572891 | 87 |
| 501 | 3300006028 | Ga0070717_10082371 | Ga0070717_100823712 | 87 |
| 502 | 3300021388 | Ga0213875_10079894 | Ga0213875_100798941 | 87 |
| 503 | 3300025929 | Ga0207664_11675566 | Ga0207664_116755662 | 87 |
| 504 | 3300037853 | Ga0436364_1461304 | Ga0436364_1461304_1081_1362 | 87 |
| 505 | 3300044656 | Ga0466969_0042194 | Ga0466969_0042194_1996_2268 | 87 |
| 506 | 3300044684 | Ga0466966_0039209 | Ga0466966_0039209_1093_1365 | 87 |
| 507 | 3300044693 | Ga0466961_0017737 | Ga0466961_0017737_2492_2764 | 87 |
| 508 | 3300044694 | Ga0466963_0074610 | Ga0466963_0074610_842_1114 | 87 |
| 509 | 3300044719 | Ga0466971_0141353 | Ga0466971_0141353_749_1021 | 87 |
| 510 | 3300044735 | Ga0466968_0621185 | Ga0466968_0621185_138_410 | 87 |
| 511 | 3300044765 | Ga0466970_0691567 | Ga0466970_0691567_228_500 | 87 |
| 512 | 3300044842 | Ga0466957_0035760 | Ga0466957_0035760_881_1153 | 87 |
| 513 | 3300044901 | Ga0466960_0020752 | Ga0466960_0020752_1034_1318 | 87 |
| 514 | 3300045049 | Ga0466959_0086556 | Ga0466959_0086556_1673_1945 | 87 |
| 515 | 3300045836 | Ga0466958_0003841 | Ga0466958_0003841_7112_7384 | 87 |
| 516 | 3300049570 | Ga0501033_0061936 | Ga0501033_0061936_1096_1368 | 87 |
| 517 | 3300049572 | Ga0501036_0676913 | Ga0501036_0676913_229_501 | 87 |
| 518 | 3300049573 | Ga0501037_0069065 | Ga0501037_0069065_2107_2379 | 87 |
| 519 | 3300049575 | Ga0501039_0805579 | Ga0501039_0805579_140_412 | 87 |
| 520 | 3300049581 | Ga0501047_0046761 | Ga0501047_0046761_1274_1546 | 87 |
| 521 | 3300049582 | Ga0501048_0258816 | Ga0501048_0258816_449_721 | 87 |
| 522 | 3300049585 | Ga0501069_0048928 | Ga0501069_0048928_16_288 | 87 |
| 523 | 3300049822 | Ga0501035_0001193 | Ga0501035_0001193_21660_21932 | 87 |
| 524 | 3300049823 | Ga0501044_0000320 | Ga0501044_0000320_27101_27373 | 87 |
| 525 | 3300005337 | Ga0070682_101526051 | Ga0070682_1015260512 | 88 |
| 526 | 3300005842 | Ga0068858_101335080 | Ga0068858_1013350802 | 88 |
| 527 | 3300028381 | Ga0268264_12311814 | Ga0268264_123118142 | 88 |
| 528 | 3300031728 | Ga0316578_10043613 | Ga0316578_100436133 | 88 |
| 529 | 3300044684 | Ga0466966_0006273 | Ga0466966_0006273_7235_7510 | 88 |
| 530 | 3300044684 | Ga0466966_0059717 | Ga0466966_0059717_451_726 | 88 |
| 531 | 3300044693 | Ga0466961_0007216 | Ga0466961_0007216_638_913 | 88 |
| 532 | 3300044694 | Ga0466963_0270292 | Ga0466963_0270292_668_943 | 88 |
| 533 | 3300044719 | Ga0466971_0691497 | Ga0466971_0691497_75_350 | 88 |
| 534 | 3300044735 | Ga0466968_0012169 | Ga0466968_0012169_2943_3218 | 88 |
| 535 | 3300044765 | Ga0466970_0014438 | Ga0466970_0014438_217_492 | 88 |
| 536 | 3300044842 | Ga0466957_0606800 | Ga0466957_0606800_197_472 | 88 |
| 537 | 3300045836 | Ga0466958_0023804 | Ga0466958_0023804_3086_3361 | 88 |
| 538 | 3300045976 | Ga0466967_0948806 | Ga0466967_0948806_515_790 | 88 |
| 539 | 3300048905 | Ga0496102_0207986 | Ga0496102_0207986_192_467 | 88 |
| 540 | 3300049570 | Ga0501033_0092261 | Ga0501033_0092261_291_578 | 88 |
| 541 | 3300049581 | Ga0501047_0030230 | Ga0501047_0030230_4648_4935 | 88 |
| 542 | 3300049581 | Ga0501047_0385658 | Ga0501047_0385658_526_801 | 88 |
| 543 | 3300049742 | Ga0501080_0189438 | Ga0501080_0189438_873_1160 | 88 |
| 544 | 3300049822 | Ga0501035_0118991 | Ga0501035_0118991_1483_1770 | 88 |
| 545 | 3300049822 | Ga0501035_0370584 | Ga0501035_0370584_875_1162 | 88 |
| 546 | 3300049823 | Ga0501044_0076931 | Ga0501044_0076931_2933_3220 | 88 |
| 547 | 3300061719 | Ga0466962_0623714 | Ga0466962_0623714_24_299 | 88 |
| 548 | 2010549000 | RicEn_FSXC29203_g1 | RicEn_330580 | 89 |
| 549 | 3300001990 | JGI24737J22298_10039093 | JGI24737J22298_100390931 | 89 |
| 550 | 3300002075 | JGI24738J21930_10118491 | JGI24738J21930_101184912 | 89 |
| 551 | 3300002077 | JGI24744J21845_10000637 | JGI24744J21845_100006373 | 89 |
| 552 | 3300002077 | JGI24744J21845_10001167 | JGI24744J21845_100011674 | 89 |
| 553 | 3300005328 | Ga0070676_10122740 | Ga0070676_101227404 | 89 |
| 554 | 3300005330 | Ga0070690_100010439 | Ga0070690_1000104392 | 89 |
| 555 | 3300005334 | Ga0068869_100062777 | Ga0068869_1000627772 | 89 |
| 556 | 3300005335 | Ga0070666_10003954 | Ga0070666_1000395412 | 89 |
| 557 | 3300005337 | Ga0070682_100057276 | Ga0070682_1000572764 | 89 |
| 558 | 3300005337 | Ga0070682_101891290 | Ga0070682_1018912901 | 89 |
| 559 | 3300005338 | Ga0068868_100003443 | Ga0068868_10000344314 | 89 |
| 560 | 3300005338 | Ga0068868_102368094 | Ga0068868_1023680941 | 89 |
| 561 | 3300005344 | Ga0070661_101222783 | Ga0070661_1012227832 | 89 |
| 562 | 3300005347 | Ga0070668_100008713 | Ga0070668_10000871310 | 89 |
| 563 | 3300005347 | Ga0070668_100210006 | Ga0070668_1002100063 | 89 |
| 564 | 3300005353 | Ga0070669_100037908 | Ga0070669_1000379083 | 89 |
| 565 | 3300005355 | Ga0070671_100389561 | Ga0070671_1003895611 | 89 |
| 566 | 3300005355 | Ga0070671_101635248 | Ga0070671_1016352481 | 89 |
| 567 | 3300005356 | Ga0070674_100251026 | Ga0070674_1002510262 | 89 |
| 568 | 3300005367 | Ga0070667_100284911 | Ga0070667_1002849113 | 89 |
| 569 | 3300005434 | Ga0070709_10008036 | Ga0070709_100080364 | 89 |
| 570 | 3300005440 | Ga0070705_100187850 | Ga0070705_1001878502 | 89 |
| 571 | 3300005441 | Ga0070700_100187860 | Ga0070700_1001878603 | 89 |
| 572 | 3300005444 | Ga0070694_100047718 | Ga0070694_1000477185 | 89 |
| 573 | 3300005445 | Ga0070708_100886327 | Ga0070708_1008863272 | 89 |
| 574 | 3300005455 | Ga0070663_100016744 | Ga0070663_1000167446 | 89 |
| 575 | 3300005455 | Ga0070663_100303454 | Ga0070663_1003034543 | 89 |
| 576 | 3300005455 | Ga0070663_100380009 | Ga0070663_1003800092 | 89 |
| 577 | 3300005456 | Ga0070678_100151521 | Ga0070678_1001515213 | 89 |
| 578 | 3300005459 | Ga0068867_100034236 | Ga0068867_1000342361 | 89 |
| 579 | 3300005467 | Ga0070706_100972900 | Ga0070706_1009729002 | 89 |
| 580 | 3300005548 | Ga0070665_100008810 | Ga0070665_1000088109 | 89 |
| 581 | 3300005548 | Ga0070665_101478202 | Ga0070665_1014782022 | 89 |
| 582 | 3300005577 | Ga0068857_101101273 | Ga0068857_1011012732 | 89 |
| 583 | 3300005578 | Ga0068854_100002312 | Ga0068854_1000023123 | 89 |
| 584 | 3300005578 | Ga0068854_100343085 | Ga0068854_1003430852 | 89 |
| 585 | 3300005614 | Ga0068856_101600414 | Ga0068856_1016004141 | 89 |
| 586 | 3300005615 | Ga0070702_100001268 | Ga0070702_1000012681 | 89 |
| 587 | 3300005615 | Ga0070702_100012484 | Ga0070702_1000124843 | 89 |
| 588 | 3300005616 | Ga0068852_100239638 | Ga0068852_1002396383 | 89 |
| 589 | 3300005618 | Ga0068864_100279418 | Ga0068864_1002794183 | 89 |
| 590 | 3300005843 | Ga0068860_101897932 | Ga0068860_1018979322 | 89 |
| 591 | 3300005937 | Ga0081455_10100590 | Ga0081455_101005904 | 89 |
| 592 | 3300006038 | Ga0075365_10002248 | Ga0075365_100022485 | 89 |
| 593 | 3300006038 | Ga0075365_10238274 | Ga0075365_102382742 | 89 |
| 594 | 3300006038 | Ga0075365_10679375 | Ga0075365_106793752 | 89 |
| 595 | 3300006042 | Ga0075368_10018491 | Ga0075368_100184912 | 89 |
| 596 | 3300006042 | Ga0075368_10217181 | Ga0075368_102171812 | 89 |
| 597 | 3300006042 | Ga0075368_10379182 | Ga0075368_103791822 | 89 |
| 598 | 3300006048 | Ga0075363_100005367 | Ga0075363_1000053673 | 89 |
| 599 | 3300006048 | Ga0075363_100010660 | Ga0075363_1000106603 | 89 |
| 600 | 3300006048 | Ga0075363_100057463 | Ga0075363_1000574634 | 89 |
| 601 | 3300006048 | Ga0075363_100198497 | Ga0075363_1001984972 | 89 |
| 602 | 3300006051 | Ga0075364_10004076 | Ga0075364_100040763 | 89 |
| 603 | 3300006051 | Ga0075364_10033199 | Ga0075364_100331995 | 89 |
| 604 | 3300006051 | Ga0075364_10044023 | Ga0075364_100440233 | 89 |
| 605 | 3300006051 | Ga0075364_10061163 | Ga0075364_100611634 | 89 |
| 606 | 3300006051 | Ga0075364_10146126 | Ga0075364_101461262 | 89 |
| 607 | 3300006051 | Ga0075364_10862275 | Ga0075364_108622752 | 89 |
| 608 | 3300006173 | Ga0070716_100001157 | Ga0070716_1000011572 | 89 |
| 609 | 3300006177 | Ga0075362_10721787 | Ga0075362_107217871 | 89 |
| 610 | 3300006178 | Ga0075367_10049051 | Ga0075367_100490513 | 89 |
| 611 | 3300006178 | Ga0075367_10233701 | Ga0075367_102337012 | 89 |
| 612 | 3300006186 | Ga0075369_10030555 | Ga0075369_100305551 | 89 |
| 613 | 3300006186 | Ga0075369_10076913 | Ga0075369_100769131 | 89 |
| 614 | 3300006186 | Ga0075369_10103686 | Ga0075369_101036863 | 89 |
| 615 | 3300006186 | Ga0075369_10111547 | Ga0075369_101115472 | 89 |
| 616 | 3300006186 | Ga0075369_10515401 | Ga0075369_105154012 | 89 |
| 617 | 3300006195 | Ga0075366_10591606 | Ga0075366_105916062 | 89 |
| 618 | 3300006353 | Ga0075370_10006409 | Ga0075370_100064095 | 89 |
| 619 | 3300006353 | Ga0075370_10097864 | Ga0075370_100978643 | 89 |
| 620 | 3300006353 | Ga0075370_10847523 | Ga0075370_108475232 | 89 |
| 621 | 3300006844 | Ga0075428_100009997 | Ga0075428_1000099979 | 89 |
| 622 | 3300006846 | Ga0075430_100009331 | Ga0075430_1000093319 | 89 |
| 623 | 3300006847 | Ga0075431_100211932 | Ga0075431_1002119324 | 89 |
| 624 | 3300006881 | Ga0068865_100002054 | Ga0068865_1000020542 | 89 |
| 625 | 3300009094 | Ga0111539_13538663 | Ga0111539_135386631 | 89 |
| 626 | 3300009147 | Ga0114129_10036824 | Ga0114129_100368248 | 89 |
| 627 | 3300013306 | Ga0163162_11843176 | Ga0163162_118431762 | 89 |
| 628 | 3300017792 | Ga0163161_10236801 | Ga0163161_102368013 | 89 |
| 629 | 3300021377 | Ga0213874_10040689 | Ga0213874_100406892 | 89 |
| 630 | 3300021384 | Ga0213876_10006209 | Ga0213876_100062095 | 89 |
| 631 | 3300021384 | Ga0213876_10088697 | Ga0213876_100886973 | 89 |
| 632 | 3300021384 | Ga0213876_10190833 | Ga0213876_101908332 | 89 |
| 633 | 3300025294 | Ga0209025_1116270 | Ga0209025_11162702 | 89 |
| 634 | 3300025303 | Ga0209051_1141086 | Ga0209051_11410861 | 89 |
| 635 | 3300025315 | Ga0207697_10077866 | Ga0207697_100778663 | 89 |
| 636 | 3300025899 | Ga0207642_10472026 | Ga0207642_104720262 | 89 |
| 637 | 3300025906 | Ga0207699_10458653 | Ga0207699_104586531 | 89 |
| 638 | 3300025910 | Ga0207684_10685299 | Ga0207684_106852992 | 89 |
| 639 | 3300025914 | Ga0207671_10116398 | Ga0207671_101163982 | 89 |
| 640 | 3300025915 | Ga0207693_10006231 | Ga0207693_1000623112 | 89 |
| 641 | 3300025916 | Ga0207663_10011886 | Ga0207663_100118867 | 89 |
| 642 | 3300025919 | Ga0207657_11367101 | Ga0207657_113671011 | 89 |
| 643 | 3300025921 | Ga0207652_10433294 | Ga0207652_104332942 | 89 |
| 644 | 3300025928 | Ga0207700_10551822 | Ga0207700_105518223 | 89 |
| 645 | 3300025931 | Ga0207644_11473861 | Ga0207644_114738611 | 89 |
| 646 | 3300025934 | Ga0207686_10837404 | Ga0207686_108374042 | 89 |
| 647 | 3300025936 | Ga0207670_10172990 | Ga0207670_101729903 | 89 |
| 648 | 3300025937 | Ga0207669_10874645 | Ga0207669_108746452 | 89 |
| 649 | 3300025961 | Ga0207712_10033947 | Ga0207712_100339471 | 89 |
| 650 | 3300025972 | Ga0207668_10067835 | Ga0207668_100678352 | 89 |
| 651 | 3300025981 | Ga0207640_11393651 | Ga0207640_113936512 | 89 |
| 652 | 3300026023 | Ga0207677_11830171 | Ga0207677_118301711 | 89 |
| 653 | 3300026067 | Ga0207678_10598207 | Ga0207678_105982072 | 89 |
| 654 | 3300026075 | Ga0207708_10631516 | Ga0207708_106315162 | 89 |
| 655 | 3300026095 | Ga0207676_10334926 | Ga0207676_103349263 | 89 |
| 656 | 3300027866 | Ga0209813_10193277 | Ga0209813_101932771 | 89 |
| 657 | 3300027866 | Ga0209813_10350551 | Ga0209813_103505512 | 89 |
| 658 | 3300031548 | Ga0307408_100229271 | Ga0307408_1002292713 | 89 |
| 659 | 3300031824 | Ga0307413_10015428 | Ga0307413_100154286 | 89 |
| 660 | 3300031852 | Ga0307410_11811283 | Ga0307410_118112831 | 89 |
| 661 | 3300031901 | Ga0307406_10222048 | Ga0307406_102220482 | 89 |
| 662 | 3300031903 | Ga0307407_10263560 | Ga0307407_102635603 | 89 |
| 663 | 3300031995 | Ga0307409_100049085 | Ga0307409_1000490855 | 89 |
| 664 | 3300031995 | Ga0307409_100439392 | Ga0307409_1004393923 | 89 |
| 665 | 3300032002 | Ga0307416_100071088 | Ga0307416_1000710884 | 89 |
| 666 | 3300032004 | Ga0307414_10485839 | Ga0307414_104858391 | 89 |
| 667 | 3300032126 | Ga0307415_100312749 | Ga0307415_1003127491 | 89 |
| 668 | 3300037853 | Ga0436364_0374418 | Ga0436364_0374418_8570_8872 | 89 |
| 669 | 3300039437 | Ga0436365_0787906 | Ga0436365_0787906_70_360 | 89 |
| 670 | 3300039437 | Ga0436365_1001910 | Ga0436365_1001910_1527_1805 | 89 |
| 671 | 3300039437 | Ga0436365_1621114 | Ga0436365_1621114_35869_36171 | 89 |
| 672 | 3300039438 | Ga0436360_0656772 | Ga0436360_0656772_1024_1305 | 89 |
| 673 | 3300039450 | Ga0436363_0761249 | Ga0436363_0761249_1404_1682 | 89 |
| 674 | 3300039450 | Ga0436363_0978816 | Ga0436363_0978816_44_322 | 89 |
| 675 | 3300041411 | Ga0439466_0004312 | Ga0439466_0004312_1340_1624 | 89 |
| 676 | 3300041413 | Ga0439465_0000668 | Ga0439465_0000668_4297_4581 | 89 |
| 677 | 3300041505 | Ga0451849_1280191 | Ga0451849_1280191_271_567 | 89 |
| 678 | 3300041997 | Ga0439431_0038262 | Ga0439431_0038262_504_788 | 89 |
| 679 | 3300041999 | Ga0439433_0168933 | Ga0439433_0168933_164_448 | 89 |
| 680 | 3300042004 | Ga0439445_0035264 | Ga0439445_0035264_628_912 | 89 |
| 681 | 3300042005 | Ga0439448_0229730 | Ga0439448_0229730_310_591 | 89 |
| 682 | 3300042435 | Ga0439434_0026438 | Ga0439434_0026438_1242_1526 | 89 |
| 683 | 3300044658 | Ga0466972_0130209 | Ga0466972_0130209_657_941 | 89 |
| 684 | 3300044683 | Ga0466965_0050447 | Ga0466965_0050447_1509_1793 | 89 |
| 685 | 3300044683 | Ga0466965_0133623 | Ga0466965_0133623_374_658 | 89 |
| 686 | 3300044683 | Ga0466965_0269707 | Ga0466965_0269707_333_614 | 89 |
| 687 | 3300044706 | Ga0466964_0266824 | Ga0466964_0266824_82_363 | 89 |
| 688 | 3300044901 | Ga0466960_0000372 | Ga0466960_0000372_8266_8550 | 89 |
| 689 | 3300045976 | Ga0466967_1127677 | Ga0466967_1127677_291_572 | 89 |
| 690 | 3300046460 | Ga0495638_0011643 | Ga0495638_0011643_5176_5454 | 89 |
| 691 | 3300047320 | Ga0495672_0061989 | Ga0495672_0061989_1107_1385 | 89 |
| 692 | 3300048903 | Ga0496100_0013521 | Ga0496100_0013521_1176_1457 | 89 |
| 693 | 3300048904 | Ga0496101_0078929 | Ga0496101_0078929_1891_2172 | 89 |
| 694 | 3300048904 | Ga0496101_1331008 | Ga0496101_1331008_185_463 | 89 |
| 695 | 3300048905 | Ga0496102_0124596 | Ga0496102_0124596_924_1205 | 89 |
| 696 | 3300048905 | Ga0496102_0522728 | Ga0496102_0522728_177_458 | 89 |
| 697 | 3300048912 | Ga0496109_1992538 | Ga0496109_1992538_29_307 | 89 |
| 698 | 3300048915 | Ga0496112_0080879 | Ga0496112_0080879_1823_2104 | 89 |
| 699 | 3300048916 | Ga0496113_0132410 | Ga0496113_0132410_1005_1286 | 89 |
| 700 | 3300048916 | Ga0496113_0674819 | Ga0496113_0674819_290_574 | 89 |
| 701 | 3300048918 | Ga0496115_1364742 | Ga0496115_1364742_78_356 | 89 |
| 702 | 3300048920 | Ga0496117_0145344 | Ga0496117_0145344_832_1113 | 89 |
| 703 | 3300048924 | Ga0496121_0875928 | Ga0496121_0875928_135_413 | 89 |
| 704 | 3300048925 | Ga0496122_0030344 | Ga0496122_0030344_373_654 | 89 |
| 705 | 3300048926 | Ga0496123_0039432 | Ga0496123_0039432_382_663 | 89 |
| 706 | 3300048928 | Ga0496125_0233111 | Ga0496125_0233111_230_508 | 89 |
| 707 | 3300048928 | Ga0496125_0401811 | Ga0496125_0401811_468_749 | 89 |
| 708 | 3300048929 | Ga0496126_0001976 | Ga0496126_0001976_27474_27755 | 89 |
| 709 | 3300048929 | Ga0496126_0161474 | Ga0496126_0161474_1567_1845 | 89 |
| 710 | 3300049571 | Ga0501034_0056731 | Ga0501034_0056731_3274_3555 | 89 |
| 711 | 3300049581 | Ga0501047_0359591 | Ga0501047_0359591_596_877 | 89 |
| 712 | 3300049586 | Ga0501070_0627289 | Ga0501070_0627289_507_803 | 89 |
| 713 | 3300049586 | Ga0501070_0764524 | Ga0501070_0764524_33_314 | 89 |
| 714 | 3300049742 | Ga0501080_0946515 | Ga0501080_0946515_458_739 | 89 |
| 715 | 3300050489 | nmdc:mga03683_9067_c1 | nmdc:mga03683_9067_c1_42_323 | 89 |
| 716 | 3300050490 | nmdc:mga03n38_13535_c1 | nmdc:mga03n38_13535_c1_2422_2718 | 89 |
| 717 | 3300050491 | nmdc:mga00v17_259639_c1 | nmdc:mga00v17_259639_c1_247_528 | 89 |
| 718 | 3300050491 | nmdc:mga00v17_348190_c1 | nmdc:mga00v17_348190_c1_652_933 | 89 |
| 719 | 3300050491 | nmdc:mga00v17_43343_c1 | nmdc:mga00v17_43343_c1_2071_2352 | 89 |
| 720 | 3300050491 | nmdc:mga00v17_447438_c1 | nmdc:mga00v17_447438_c1_491_787 | 89 |
| 721 | 3300050492 | nmdc:mga0yw44_1008405_c1 | nmdc:mga0yw44_1008405_c1_177_458 | 89 |
| 722 | 3300050492 | nmdc:mga0yw44_460411_c1 | nmdc:mga0yw44_460411_c1_59_340 | 89 |
| 723 | 3300050496 | nmdc:mga07m45_160768_c1 | nmdc:mga07m45_160768_c1_387_683 | 89 |
| 724 | 3300050507 | nmdc:mga05p37_144066_c1 | nmdc:mga05p37_144066_c1_442_723 | 89 |
| 725 | 3300050509 | nmdc:mga0qj67_8192_c1 | nmdc:mga0qj67_8192_c1_935_1216 | 89 |
| 726 | 3300050510 | nmdc:mga06r32_908187_c1 | nmdc:mga06r32_908187_c1_140_421 | 89 |
| 727 | 3300050516 | nmdc:mga0sz30_244077_c1 | nmdc:mga0sz30_244077_c1_450_731 | 89 |
| 728 | 3300050516 | nmdc:mga0sz30_279036_c1 | nmdc:mga0sz30_279036_c1_218_496 | 89 |
| 729 | 3300050516 | nmdc:mga0sz30_92030_c1 | nmdc:mga0sz30_92030_c1_254_538 | 89 |
| 730 | 3300053080 | Ga0500635_0012614 | Ga0500635_0012614_1425_1703 | 89 |
| 731 | 3300053087 | Ga0500643_008087 | Ga0500643_008087_3329_3607 | 89 |
| 732 | 3300053098 | Ga0500650_0163551 | Ga0500650_0163551_672_950 | 89 |
| 733 | 3300053130 | Ga0500642_0158899 | Ga0500642_0158899_588_866 | 89 |
| 734 | 3300053131 | Ga0500652_002160 | Ga0500652_002160_4274_4552 | 89 |
| 735 | 3300053131 | Ga0500652_254686 | Ga0500652_254686_181_459 | 89 |
| 736 | 3300053134 | Ga0500658_0565477 | Ga0500658_0565477_138_416 | 89 |
| 737 | 3300053136 | Ga0500559_0519899 | Ga0500559_0519899_209_487 | 89 |
| 738 | 3300053139 | Ga0500568_0140430 | Ga0500568_0140430_311_589 | 89 |
| 739 | 3300053146 | Ga0500588_0105197 | Ga0500588_0105197_58_336 | 89 |
| 740 | 3300053146 | Ga0500588_0153564 | Ga0500588_0153564_86_364 | 89 |
| 741 | 3300053158 | Ga0500627_0004036 | Ga0500627_0004036_601_879 | 89 |
| 742 | 3300053730 | Ga0500645_000104 | Ga0500645_000104_19098_19376 | 89 |
| 743 | 3300053730 | Ga0500645_012533 | Ga0500645_012533_1809_2087 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3t49-assembly1.cif.gz_A | crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom | 0.4901 | 17 | 87 |
| 2qff-assembly1.cif.gz_A | crystal structure of staphylococcal complement inhibitor | 0.4701 | 13 | 84 |
| 3t49-assembly1.cif.gz_A | crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom | 0.4683 | 17 | 87 |
| 4h6h-assembly2.cif.gz_B | crystal structure of staphylococcal complement inhibitor scin-b(4-85) | 0.4647 | 11 | 87 |
| 2qff-assembly1.cif.gz_A | crystal structure of staphylococcal complement inhibitor | 0.454 | 13 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKW1_1_86_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.9611 | 11 | 88 | 1.20.140.150 |
| af_P9WKW1_1_86_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8636 | 11 | 88 | 1.20.140.150 |
| af_P37147_6_115_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6455 | 8 | 88 | 1.10.1760.20 |
| af_Q54CS1_1_135_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6239 | 3 | 76 | 1.20.1250.20 |
| af_Q8GUM2_551_650_1.20.1270.10 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.5692 | 3 | 86 | 1.20.1270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A375YU08-F1-model_v4 | Transmembrane protein [Mycobacterium tuberculosis H37Rv] | 0.9969 | 14 | 88 |
GO:0016020
|
| AF-A4T311-F1-model_v4 | Conserved membrane protein | 0.9937 | 2 | 88 |
GO:0016020
|
| AF-A0A1A1YBK0-F1-model_v4 | deleted | 0.9886 | 2 | 88 |
|
| AF-A0A3L8NWY0-F1-model_v4 | DUF2516 family protein | 0.9875 | 9 | 88 |
GO:0016020
|
| AF-A0A7I7PEC5-F1-model_v4 | DUF2516 domain-containing protein | 0.9867 | 6 | 88 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar