F478642

General Info

Members Datasets Scaffolds Average Seq Length
742 243 1484 211

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10052572|Ga0207676_100525724
Length 218
Sequence MREEGATTTALVPTKAPPASGCLFVLAAPSGGGKTSLVAALLERETGIRLSVSYTTRGETDGVHYHFVDEPRFLALKDKGEFLEHAYVHGNWYATSATWLAAEVARGHDVLLEIDWQGAKQVRRLIPEAVHIFILPPSLQLLRERLEKRGQDSAEVIRRRLEAAQEEMRHCADFDYVIMNQDFARAVDDLSAIVRAARLTAPRQLVRHAHLLQRLLEN

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10052572 3300026095 Bacteria 3185
2 JGI24737J22298_10119837 3300001990 Bacteria 778
3 JGI24034J26672_10012409 3300002239 Bacteria 1284
4 Ga0070658_10033814 3300005327 Bacteria 4114
5 Ga0070658_10118353 3300005327 Bacteria 2200
6 Ga0070658_10237398 3300005327 Bacteria 1545
7 Ga0070676_10008451 3300005328 Bacteria 5551
8 Ga0070676_10021957 3300005328 Bacteria 3576
9 Ga0070676_10065532 3300005328 Bacteria 2169
10 Ga0070676_10111807 3300005328 Bacteria 1702
11 Ga0070676_10113331 3300005328 Bacteria 1692
12 Ga0070676_10537714 3300005328 Bacteria 835
13 Ga0070683_100028393 3300005329 Bacteria 5055
14 Ga0070683_100028844 3300005329 Bacteria 5020
15 Ga0070683_100034575 3300005329 Bacteria 4618
16 Ga0070683_100086803 3300005329 Bacteria 2934
17 Ga0070690_100012677 3300005330 Bacteria 4963
18 Ga0070690_100433689 3300005330 Bacteria 971
19 Ga0070670_100018323 3300005331 Bacteria 6007
20 Ga0070670_100026701 3300005331 Bacteria 4968
21 Ga0070670_100049764 3300005331 Bacteria 3603
22 Ga0070670_100054051 3300005331 Bacteria 3448
23 Ga0070670_100060145 3300005331 Bacteria 3261
24 Ga0070670_100188803 3300005331 Bacteria 1790
25 Ga0070670_100708121 3300005331 Bacteria 906
26 Ga0070677_10006218 3300005333 Bacteria 3964
27 Ga0068869_100000028 3300005334 Bacteria 61654
28 Ga0068869_100030668 3300005334 Bacteria 3777
29 Ga0068869_100068042 3300005334 Bacteria 2629
30 Ga0068869_100070066 3300005334 Bacteria 2594
31 Ga0070666_10001313 3300005335 Bacteria 15057
32 Ga0070666_10083445 3300005335 Bacteria 2186
33 Ga0070666_10112837 3300005335 Bacteria 1880
34 Ga0070666_10252578 3300005335 Bacteria 1249
35 Ga0070666_10258675 3300005335 Bacteria 1234
36 Ga0070680_100004529 3300005336 Bacteria 10465
37 Ga0068868_100028044 3300005338 Bacteria 4300
38 Ga0068868_100079033 3300005338 Bacteria 2634
39 Ga0068868_100115426 3300005338 Bacteria 2186
40 Ga0070660_100009534 3300005339 Bacteria 6835
41 Ga0070660_100029043 3300005339 Bacteria 4141
42 Ga0070660_100065413 3300005339 Bacteria 2830
43 Ga0070660_100066325 3300005339 Bacteria 2809
44 Ga0070660_100134099 3300005339 Bacteria 1983
45 Ga0070660_100136617 3300005339 Bacteria 1964
46 Ga0070660_100362007 3300005339 Bacteria 1196
47 Ga0070689_100011772 3300005340 Bacteria 6276
48 Ga0070689_100040630 3300005340 Bacteria 3567
49 Ga0070661_100004082 3300005344 Bacteria 10060
50 Ga0070661_100009481 3300005344 Bacteria 6743
51 Ga0070661_100017748 3300005344 Bacteria 5051
52 Ga0070661_100018962 3300005344 Bacteria 4899
53 Ga0070661_100027399 3300005344 Bacteria 4102
54 Ga0070661_100100969 3300005344 Bacteria 2146
55 Ga0070661_100113227 3300005344 Bacteria 2027
56 Ga0070661_100230012 3300005344 Bacteria 1425
57 Ga0070661_100288584 3300005344 Bacteria 1274
58 Ga0070661_100710185 3300005344 Bacteria 820
59 Ga0070692_10022789 3300005345 Bacteria 3063
60 Ga0070692_10195663 3300005345 Bacteria 1181
61 Ga0070668_100005113 3300005347 Bacteria 9719
62 Ga0070668_100007304 3300005347 Bacteria 8197
63 Ga0070668_100096150 3300005347 Bacteria 2341
64 Ga0070668_100103240 3300005347 Bacteria 2261
65 Ga0070669_100000689 3300005353 Bacteria 24772
66 Ga0070669_100012792 3300005353 Bacteria 5958
67 Ga0070669_100064261 3300005353 Bacteria 2702
68 Ga0070669_100112712 3300005353 Bacteria 2066
69 Ga0070669_100129294 3300005353 Bacteria 1936
70 Ga0070669_100331612 3300005353 Bacteria 1231
71 Ga0070669_100336688 3300005353 Bacteria 1222
72 Ga0070675_100008241 3300005354 Bacteria 8084
73 Ga0070675_100015478 3300005354 Bacteria 6031
74 Ga0070675_100102564 3300005354 Bacteria 2411
75 Ga0070675_100279545 3300005354 Bacteria 1466
76 Ga0070671_100006677 3300005355 Bacteria 9227
77 Ga0070671_100018416 3300005355 Bacteria 5672
78 Ga0070671_100037030 3300005355 Bacteria 4045
79 Ga0070671_100052985 3300005355 Bacteria 3373
80 Ga0070671_100238518 3300005355 Bacteria 1544
81 Ga0070671_100701888 3300005355 Bacteria 878
82 Ga0070674_100047528 3300005356 Bacteria 2941
83 Ga0070674_100113225 3300005356 Bacteria 1995
84 Ga0070673_100001121 3300005364 Bacteria 15374
85 Ga0070673_100012755 3300005364 Bacteria 5782
86 Ga0070673_100020304 3300005364 Bacteria 4790
87 Ga0070673_100055303 3300005364 Bacteria 3127
88 Ga0070673_100345383 3300005364 Bacteria 1319
89 Ga0070688_100069803 3300005365 Bacteria 2245
90 Ga0070688_100400255 3300005365 Bacteria 1016
91 Ga0070659_100006562 3300005366 Bacteria 8401
92 Ga0070659_100011024 3300005366 Bacteria 6676
93 Ga0070659_100086254 3300005366 Bacteria 2512
94 Ga0070659_100098208 3300005366 Bacteria 2354
95 Ga0070659_100111283 3300005366 Bacteria 2211
96 Ga0070659_100400364 3300005366 Bacteria 1159
97 Ga0070667_100000622 3300005367 Bacteria 34540
98 Ga0070667_100016050 3300005367 Bacteria 6195
99 Ga0070667_100040500 3300005367 Bacteria 3906
100 Ga0070667_100091214 3300005367 Bacteria 2620
101 Ga0070667_100102620 3300005367 Bacteria 2472
102 Ga0070667_100145924 3300005367 Bacteria 2075
103 Ga0070667_100204978 3300005367 Bacteria 1751
104 Ga0070667_100595394 3300005367 Bacteria 1018
105 Ga0070709_10090265 3300005434 Bacteria 2019
106 Ga0070714_100042802 3300005435 Bacteria 3827
107 Ga0070714_100047328 3300005435 Bacteria 3653
108 Ga0070714_100068236 3300005435 Bacteria 3067
109 Ga0070714_100899554 3300005435 Bacteria 859
110 Ga0070713_100016130 3300005436 Bacteria 5611
111 Ga0070713_100244585 3300005436 Bacteria 1634
112 Ga0070710_10010455 3300005437 Bacteria 4560
113 Ga0070701_10104787 3300005438 Bacteria 1572
114 Ga0070701_10267953 3300005438 Bacteria 1038
115 Ga0070711_100750651 3300005439 Bacteria 825
116 Ga0070705_100026930 3300005440 Bacteria 3133
117 Ga0070705_100776871 3300005440 Bacteria 760
118 Ga0070700_100019467 3300005441 Bacteria 3918
119 Ga0070694_100240755 3300005444 Bacteria 1365
120 Ga0070708_100000104 3300005445 Bacteria 56049
121 Ga0070708_100062433 3300005445 Bacteria 3332
122 Ga0070708_100063031 3300005445 Bacteria 3317
123 Ga0070663_100004467 3300005455 Bacteria 8234
124 Ga0070663_100020378 3300005455 Bacteria 4389
125 Ga0070663_100088266 3300005455 Bacteria 2293
126 Ga0070663_100136828 3300005455 Bacteria 1866
127 Ga0070663_100517754 3300005455 Bacteria 993
128 Ga0070663_100582874 3300005455 Bacteria 939
129 Ga0070678_100000126 3300005456 Bacteria 30368
130 Ga0070678_100062689 3300005456 Bacteria 2746
131 Ga0070678_100549040 3300005456 Bacteria 1025
132 Ga0070678_100586492 3300005456 Bacteria 994
133 Ga0070662_100000684 3300005457 Bacteria 20670
134 Ga0070662_100098377 3300005457 Bacteria 2209
135 Ga0070662_100451753 3300005457 Bacteria 1067
136 Ga0070681_10037612 3300005458 Bacteria 4855
137 Ga0070681_10043989 3300005458 Bacteria 4469
138 Ga0070681_10147782 3300005458 Bacteria 2278
139 Ga0070681_10223813 3300005458 Bacteria 1796
140 Ga0068867_100003002 3300005459 Bacteria 11893
141 Ga0068867_100012374 3300005459 Bacteria 6035
142 Ga0070685_10002286 3300005466 Bacteria 9886
143 Ga0070706_100019033 3300005467 Bacteria 6333
144 Ga0070706_100078386 3300005467 Bacteria 3059
145 Ga0070707_100019521 3300005468 Bacteria 6385
146 Ga0070698_100065625 3300005471 Bacteria 3654
147 Ga0070698_100113207 3300005471 Bacteria 2678
148 Ga0070699_100045752 3300005518 Bacteria 3787
149 Ga0070699_100077417 3300005518 Bacteria 2895
150 Ga0070679_100009275 3300005530 Bacteria 9303
151 Ga0070679_100059944 3300005530 Bacteria 3792
152 Ga0070679_100066561 3300005530 Bacteria 3591
153 Ga0070679_100086254 3300005530 Bacteria 3126
154 Ga0070679_100099170 3300005530 Bacteria 2900
155 Ga0070679_100344891 3300005530 Bacteria 1437
156 Ga0070679_100495405 3300005530 Bacteria 1166
157 Ga0070684_100019873 3300005535 Bacteria 5564
158 Ga0070684_100026089 3300005535 Bacteria 4918
159 Ga0070684_100061598 3300005535 Bacteria 3284
160 Ga0070684_100293681 3300005535 Bacteria 1490
161 Ga0070697_100028697 3300005536 Bacteria 4456
162 Ga0070697_100125203 3300005536 Bacteria 2152
163 Ga0068853_100011401 3300005539 Bacteria 7219
164 Ga0068853_100021386 3300005539 Bacteria 5394
165 Ga0068853_100029585 3300005539 Bacteria 4619
166 Ga0068853_100031077 3300005539 Bacteria 4515
167 Ga0068853_100070693 3300005539 Bacteria 3038
168 Ga0068853_100154403 3300005539 Bacteria 2068
169 Ga0070672_100002841 3300005543 Bacteria 11103
170 Ga0070672_100007446 3300005543 Bacteria 7428
171 Ga0070672_100059969 3300005543 Bacteria 2995
172 Ga0070672_100419115 3300005543 Bacteria 1150
173 Ga0070672_100666238 3300005543 Bacteria 910
174 Ga0070686_100028897 3300005544 Bacteria 3367
175 Ga0070695_100040682 3300005545 Bacteria 2944
176 Ga0070695_100084628 3300005545 Bacteria 2104
177 Ga0070696_100001069 3300005546 Bacteria 17701
178 Ga0070696_100019624 3300005546 Bacteria 4580
179 Ga0070693_100139602 3300005547 Bacteria 1524
180 Ga0070693_100331605 3300005547 Bacteria 1036
181 Ga0070693_100512639 3300005547 Bacteria 852
182 Ga0070665_100025522 3300005548 Bacteria 5952
183 Ga0070665_100027486 3300005548 Bacteria 5730
184 Ga0070665_100055319 3300005548 Bacteria 3980
185 Ga0070665_100672990 3300005548 Bacteria 1048
186 Ga0070665_100683423 3300005548 Bacteria 1039
187 Ga0070704_100227193 3300005549 Bacteria 1520
188 Ga0068855_100001539 3300005563 Bacteria 28980
189 Ga0068855_100009898 3300005563 Bacteria 11499
190 Ga0068855_100085944 3300005563 Bacteria 3638
191 Ga0068855_100157654 3300005563 Bacteria 2578
192 Ga0068855_100170792 3300005563 Bacteria 2463
193 Ga0068855_100297677 3300005563 Bacteria 1787
194 Ga0070664_100010057 3300005564 Bacteria 7668
195 Ga0070664_100012914 3300005564 Bacteria 6794
196 Ga0070664_100059551 3300005564 Bacteria 3249
197 Ga0070664_100074417 3300005564 Bacteria 2915
198 Ga0070664_100168934 3300005564 Bacteria 1939
199 Ga0070664_100231147 3300005564 Bacteria 1658
200 Ga0070664_100251312 3300005564 Bacteria 1589
201 Ga0070664_100259873 3300005564 Bacteria 1562
202 Ga0070664_100324579 3300005564 Bacteria 1395
203 Ga0068857_100000949 3300005577 Bacteria 22107
204 Ga0068857_100027099 3300005577 Bacteria 5055
205 Ga0068857_100027470 3300005577 Bacteria 5020
206 Ga0068857_100086366 3300005577 Bacteria 2805
207 Ga0068857_100242814 3300005577 Bacteria 1649
208 Ga0068857_100267399 3300005577 Bacteria 1571
209 Ga0068857_100524246 3300005577 Bacteria 1114
210 Ga0068854_100003306 3300005578 Bacteria 10049
211 Ga0068854_100003803 3300005578 Bacteria 9439
212 Ga0068854_100105727 3300005578 Bacteria 2116
213 Ga0068854_100213715 3300005578 Bacteria 1522
214 Ga0068856_100002893 3300005614 Bacteria 17569
215 Ga0068856_100012230 3300005614 Bacteria 8315
216 Ga0068856_100052023 3300005614 Bacteria 4038
217 Ga0068856_100471078 3300005614 Bacteria 1277
218 Ga0068852_100009487 3300005616 Bacteria 7230
219 Ga0068852_100023473 3300005616 Bacteria 4965
220 Ga0068852_100144143 3300005616 Bacteria 2207
221 Ga0068852_100178116 3300005616 Bacteria 1997
222 Ga0068852_100626100 3300005616 Bacteria 1082
223 Ga0068852_100675532 3300005616 Bacteria 1042
224 Ga0068852_101308382 3300005616 Bacteria 746
225 Ga0068859_100000096 3300005617 Bacteria 81199
226 Ga0068859_100006280 3300005617 Bacteria 12058
227 Ga0068859_100043190 3300005617 Bacteria 4530
228 Ga0068864_100000214 3300005618 Bacteria 52286
229 Ga0068864_100006619 3300005618 Bacteria 9483
230 Ga0068864_100006987 3300005618 Bacteria 9260
231 Ga0068864_100019793 3300005618 Bacteria 5628
232 Ga0068864_100047243 3300005618 Bacteria 3696
233 Ga0068864_100064356 3300005618 Bacteria 3180
234 Ga0068864_100949651 3300005618 Bacteria 851
235 Ga0068866_10001391 3300005718 Bacteria 10429
236 Ga0068861_100001660 3300005719 Bacteria 14230
237 Ga0068861_100014890 3300005719 Bacteria 5466
238 Ga0068861_100051039 3300005719 Bacteria 3139
239 Ga0068861_100170015 3300005719 Bacteria 1806
240 Ga0068861_101072209 3300005719 Bacteria 773
241 Ga0068851_10005137 3300005834 Bacteria 5935
242 Ga0068851_10008891 3300005834 Bacteria 4658
243 Ga0068851_10014386 3300005834 Bacteria 3757
244 Ga0068851_10056032 3300005834 Bacteria 2009
245 Ga0068851_10065940 3300005834 Bacteria 1865
246 Ga0068851_10088379 3300005834 Bacteria 1628
247 Ga0068851_10139500 3300005834 Bacteria 1317
248 Ga0068851_10139886 3300005834 Bacteria 1316
249 Ga0068851_10170264 3300005834 Bacteria 1201
250 Ga0068851_10184104 3300005834 Bacteria 1158
251 Ga0068870_10006284 3300005840 Bacteria 5233
252 Ga0068870_10081349 3300005840 Bacteria 1791
253 Ga0068863_100000885 3300005841 Bacteria 30127
254 Ga0068863_100064365 3300005841 Bacteria 3468
255 Ga0068863_100067216 3300005841 Bacteria 3390
256 Ga0068863_100185701 3300005841 Bacteria 1997
257 Ga0068863_100383492 3300005841 Bacteria 1373
258 Ga0068863_100422850 3300005841 Bacteria 1305
259 Ga0068858_100002939 3300005842 Bacteria 17148
260 Ga0068858_100003156 3300005842 Bacteria 16503
261 Ga0068858_100016996 3300005842 Bacteria 6831
262 Ga0068858_100032724 3300005842 Bacteria 4828
263 Ga0068858_100238649 3300005842 Bacteria 1724
264 Ga0068860_100000990 3300005843 Bacteria 31411
265 Ga0068860_100005277 3300005843 Bacteria 13113
266 Ga0068860_100034190 3300005843 Bacteria 4875
267 Ga0068860_100036983 3300005843 Bacteria 4674
268 Ga0068860_100048305 3300005843 Bacteria 4055
269 Ga0068860_100251079 3300005843 Bacteria 1723
270 Ga0068860_100409486 3300005843 Bacteria 1343
271 Ga0068860_100492057 3300005843 Bacteria 1223
272 Ga0068860_100503296 3300005843 Bacteria 1210
273 Ga0068862_100025873 3300005844 Bacteria 4929
274 Ga0068862_100061410 3300005844 Bacteria 3230
275 Ga0068862_100350457 3300005844 Bacteria 1370
276 Ga0068862_100433035 3300005844 Bacteria 1236
277 Ga0070712_100144496 3300006175 Bacteria 1819
278 Ga0097621_100012585 3300006237 Bacteria 6276
279 Ga0097621_100121179 3300006237 Bacteria 2218
280 Ga0097621_100872724 3300006237 Bacteria 837
281 Ga0068871_100004280 3300006358 Bacteria 9903
282 Ga0068871_100220882 3300006358 Bacteria 1642
283 Ga0075428_100166878 3300006844 Bacteria 2388
284 Ga0068865_100010020 3300006881 Bacteria 5892
285 Ga0068865_100021175 3300006881 Bacteria 4226
286 Ga0097620_100000096 3300006931 Bacteria 81199
287 Ga0097620_100006280 3300006931 Bacteria 12058
288 Ga0097620_100043194 3300006931 Bacteria 4530
289 Ga0105251_10060825 3300009011 Bacteria 1777
290 Ga0105240_10001001 3300009093 Bacteria 50438
291 Ga0105240_10024364 3300009093 Bacteria 7978
292 Ga0105240_10153390 3300009093 Bacteria 2742
293 Ga0105240_10209086 3300009093 Bacteria 2282
294 Ga0111539_10017317 3300009094 Bacteria 8917
295 Ga0105245_10175390 3300009098 Bacteria 2044
296 Ga0105247_10135418 3300009101 Bacteria 1609
297 Ga0105243_10152124 3300009148 Bacteria 1986
298 Ga0105241_10005193 3300009174 Bacteria 9611
299 Ga0105241_10223593 3300009174 Bacteria 1584
300 Ga0105241_10466747 3300009174 Bacteria 1119
301 Ga0105241_10502064 3300009174 Bacteria 1082
302 Ga0105242_10059204 3300009176 Bacteria 3142
303 Ga0105248_10002974 3300009177 Bacteria 18775
304 Ga0105248_10004428 3300009177 Bacteria 15547
305 Ga0105248_10036996 3300009177 Bacteria 5459
306 Ga0105248_10153563 3300009177 Bacteria 2597
307 Ga0105248_10464483 3300009177 Bacteria 1427
308 Ga0105248_11760468 3300009177 Bacteria 702
309 Ga0105237_10061564 3300009545 Bacteria 3752
310 Ga0105237_10289927 3300009545 Bacteria 1639
311 Ga0105238_10043321 3300009551 Bacteria 4554
312 Ga0105238_10146248 3300009551 Bacteria 2340
313 Ga0105238_10594735 3300009551 Bacteria 1114
314 Ga0105238_11042241 3300009551 Bacteria 840
315 Ga0105249_10020383 3300009553 Bacteria 5929
316 Ga0105249_10027041 3300009553 Bacteria 5175
317 Ga0105239_10311970 3300010375 Bacteria 1773
318 Ga0105239_10480467 3300010375 Bacteria 1411
319 Ga0105246_10827791 3300011119 Bacteria 824
320 Ga0157342_1021797 3300012507 Bacteria 750
321 Ga0157373_10024346 3300013100 Bacteria 4386
322 Ga0157373_10049411 3300013100 Bacteria 2997
323 Ga0157373_10108251 3300013100 Bacteria 1954
324 Ga0157373_10412187 3300013100 Bacteria 969
325 Ga0157371_10002555 3300013102 Bacteria 17267
326 Ga0157371_10115820 3300013102 Bacteria 1904
327 Ga0157371_10196886 3300013102 Bacteria 1444
328 Ga0157371_10239605 3300013102 Bacteria 1304
329 Ga0157370_10005091 3300013104 Bacteria 14831
330 Ga0157370_10008148 3300013104 Bacteria 11334
331 Ga0157370_10025666 3300013104 Bacteria 5830
332 Ga0157370_10044971 3300013104 Bacteria 4240
333 Ga0157370_10173535 3300013104 Bacteria 2004
334 Ga0157370_10224669 3300013104 Bacteria 1738
335 Ga0157370_10289046 3300013104 Bacteria 1514
336 Ga0157370_10307463 3300013104 Bacteria 1463
337 Ga0157370_10311080 3300013104 Bacteria 1454
338 Ga0157369_10135856 3300013105 Bacteria 2604
339 Ga0157369_10178628 3300013105 Bacteria 2234
340 Ga0157369_10266088 3300013105 Bacteria 1787
341 Ga0157369_10347030 3300013105 Bacteria 1542
342 Ga0157369_10835205 3300013105 Bacteria 946
343 Ga0157369_10955883 3300013105 Bacteria 878
344 Ga0157374_10008118 3300013296 Bacteria 8972
345 Ga0157374_10022866 3300013296 Bacteria 5582
346 Ga0157374_10324886 3300013296 Bacteria 1525
347 Ga0157378_10318309 3300013297 Bacteria 1511
348 Ga0163162_10017676 3300013306 Bacteria 6977
349 Ga0163162_10088253 3300013306 Bacteria 3181
350 Ga0163162_10268094 3300013306 Bacteria 1839
351 Ga0163162_10551281 3300013306 Bacteria 1281
352 Ga0157372_10000342 3300013307 Bacteria 51414
353 Ga0157372_10013150 3300013307 Bacteria 8830
354 Ga0157372_10017161 3300013307 Bacteria 7772
355 Ga0157372_10017981 3300013307 Bacteria 7596
356 Ga0157372_10032862 3300013307 Bacteria 5693
357 Ga0157372_10148944 3300013307 Bacteria 2700
358 Ga0157372_10187225 3300013307 Bacteria 2397
359 Ga0157372_10483772 3300013307 Bacteria 1443
360 Ga0157372_10539430 3300013307 Bacteria 1360
361 Ga0157372_10783408 3300013307 Bacteria 1108
362 Ga0157375_10043852 3300013308 Bacteria 4341
363 Ga0157375_10070245 3300013308 Bacteria 3511
364 Ga0157375_10138906 3300013308 Bacteria 2555
365 Ga0157375_10558903 3300013308 Bacteria 1305
366 Ga0157375_10695615 3300013308 Bacteria 1170
367 Ga0163163_10004530 3300014325 Bacteria 11864
368 Ga0163163_10103411 3300014325 Bacteria 2873
369 Ga0163163_10316348 3300014325 Bacteria 1614
370 Ga0163163_10329823 3300014325 Bacteria 1580
371 Ga0157380_10058796 3300014326 Bacteria 3066
372 Ga0157380_10395653 3300014326 Bacteria 1309
373 Ga0182008_10212149 3300014497 Bacteria 988
374 Ga0157377_10014470 3300014745 Bacteria 4016
375 Ga0157379_10000371 3300014968 Bacteria 36128
376 Ga0157379_10006045 3300014968 Bacteria 10426
377 Ga0157379_10029865 3300014968 Bacteria 4847
378 Ga0157379_10180886 3300014968 Bacteria 1905
379 Ga0157379_10244245 3300014968 Bacteria 1629
380 Ga0157379_10302741 3300014968 Bacteria 1457
381 Ga0157379_10305101 3300014968 Bacteria 1451
382 Ga0157376_10579035 3300014969 Bacteria 1114
383 Ga0163161_10017189 3300017792 Bacteria 5058
384 Ga0163161_10045385 3300017792 Bacteria 3169
385 Ga0206356_11808518 3300020070 Bacteria 738
386 Ga0207666_1001674 3300025271 Bacteria 2633
387 Ga0207697_10001689 3300025315 Bacteria 11898
388 Ga0207697_10003626 3300025315 Bacteria 7574
389 Ga0207656_10008900 3300025321 Bacteria 3717
390 Ga0207656_10032942 3300025321 Bacteria 2155
391 Ga0207656_10034086 3300025321 Bacteria 2124
392 Ga0207656_10118262 3300025321 Bacteria 1231
393 Ga0207682_10000068 3300025893 Bacteria 45481
394 Ga0207692_10136686 3300025898 Bacteria 1390
395 Ga0207642_10111367 3300025899 Bacteria 1394
396 Ga0207710_10293697 3300025900 Bacteria 820
397 Ga0207688_10005514 3300025901 Bacteria 6880
398 Ga0207680_10004115 3300025903 Bacteria 6879
399 Ga0207680_10004453 3300025903 Bacteria 6647
400 Ga0207680_10035895 3300025903 Bacteria 2851
401 Ga0207680_10062744 3300025903 Bacteria 2272
402 Ga0207680_10163395 3300025903 Bacteria 1495
403 Ga0207647_10363600 3300025904 Bacteria 818
404 Ga0207699_10006176 3300025906 Bacteria 5777
405 Ga0207645_10000212 3300025907 Bacteria 48068
406 Ga0207645_10001926 3300025907 Bacteria 16746
407 Ga0207645_10007516 3300025907 Bacteria 7691
408 Ga0207645_10014541 3300025907 Bacteria 5265
409 Ga0207645_10027251 3300025907 Bacteria 3691
410 Ga0207645_10161438 3300025907 Bacteria 1466
411 Ga0207643_10000298 3300025908 Bacteria 34305
412 Ga0207643_10023034 3300025908 Bacteria 3433
413 Ga0207643_10241362 3300025908 Bacteria 1111
414 Ga0207705_10039768 3300025909 Bacteria 3371
415 Ga0207705_10229754 3300025909 Bacteria 1411
416 Ga0207684_10020569 3300025910 Bacteria 5639
417 Ga0207684_10028074 3300025910 Bacteria 4794
418 Ga0207684_10124917 3300025910 Bacteria 2207
419 Ga0207654_10042253 3300025911 Bacteria 2579
420 Ga0207654_10140329 3300025911 Bacteria 1540
421 Ga0207654_10567204 3300025911 Bacteria 808
422 Ga0207707_10012059 3300025912 Bacteria 7517
423 Ga0207707_10064382 3300025912 Bacteria 3191
424 Ga0207707_10293411 3300025912 Bacteria 1407
425 Ga0207707_10459374 3300025912 Bacteria 1089
426 Ga0207695_10036403 3300025913 Bacteria 5321
427 Ga0207695_10049286 3300025913 Bacteria 4442
428 Ga0207695_10290951 3300025913 Bacteria 1526
429 Ga0207671_10548500 3300025914 Bacteria 922
430 Ga0207671_10560776 3300025914 Bacteria 911
431 Ga0207693_10054699 3300025915 Bacteria 3130
432 Ga0207663_10397207 3300025916 Bacteria 1054
433 Ga0207660_10088737 3300025917 Bacteria 2287
434 Ga0207660_10645999 3300025917 Bacteria 862
435 Ga0207657_10000738 3300025919 Bacteria 34692
436 Ga0207657_10000884 3300025919 Bacteria 31683
437 Ga0207657_10004460 3300025919 Bacteria 14814
438 Ga0207657_10013618 3300025919 Bacteria 7975
439 Ga0207657_10026357 3300025919 Bacteria 5343
440 Ga0207657_10126617 3300025919 Bacteria 2098
441 Ga0207657_10162653 3300025919 Bacteria 1812
442 Ga0207657_10285208 3300025919 Bacteria 1310
443 Ga0207649_10015874 3300025920 Bacteria 4235
444 Ga0207649_10049428 3300025920 Bacteria 2597
445 Ga0207649_10063184 3300025920 Bacteria 2337
446 Ga0207649_10074136 3300025920 Bacteria 2183
447 Ga0207649_10303328 3300025920 Bacteria 1168
448 Ga0207649_10456536 3300025920 Bacteria 965
449 Ga0207652_10030771 3300025921 Bacteria 4498
450 Ga0207652_10033588 3300025921 Bacteria 4321
451 Ga0207652_10049623 3300025921 Bacteria 3593
452 Ga0207652_10190649 3300025921 Bacteria 1844
453 Ga0207652_10611591 3300025921 Bacteria 977
454 Ga0207646_10001674 3300025922 Bacteria 27055
455 Ga0207646_10072521 3300025922 Bacteria 3076
456 Ga0207646_10619682 3300025922 Bacteria 971
457 Ga0207681_10002290 3300025923 Bacteria 12167
458 Ga0207681_10018182 3300025923 Bacteria 4426
459 Ga0207681_10050082 3300025923 Bacteria 2825
460 Ga0207681_10201607 3300025923 Bacteria 1528
461 Ga0207681_10225662 3300025923 Bacteria 1451
462 Ga0207681_10321110 3300025923 Bacteria 1231
463 Ga0207694_10009155 3300025924 Bacteria 7474
464 Ga0207694_10068337 3300025924 Bacteria 2774
465 Ga0207650_10000654 3300025925 Bacteria 27396
466 Ga0207650_10002790 3300025925 Bacteria 12065
467 Ga0207650_10015094 3300025925 Bacteria 5374
468 Ga0207650_10047035 3300025925 Bacteria 3178
469 Ga0207650_10121546 3300025925 Bacteria 2034
470 Ga0207650_10184481 3300025925 Bacteria 1664
471 Ga0207659_10001334 3300025926 Bacteria 14759
472 Ga0207659_10003849 3300025926 Bacteria 9048
473 Ga0207659_10013808 3300025926 Bacteria 5190
474 Ga0207659_10018388 3300025926 Bacteria 4582
475 Ga0207659_10063191 3300025926 Bacteria 2675
476 Ga0207687_10906154 3300025927 Bacteria 754
477 Ga0207700_10007633 3300025928 Bacteria 6635
478 Ga0207700_10252457 3300025928 Bacteria 1507
479 Ga0207664_10000327 3300025929 Bacteria 35277
480 Ga0207664_10003369 3300025929 Bacteria 10630
481 Ga0207664_10036023 3300025929 Bacteria 3822
482 Ga0207664_10055273 3300025929 Bacteria 3150
483 Ga0207644_10003980 3300025931 Bacteria 9596
484 Ga0207644_10011151 3300025931 Bacteria 5938
485 Ga0207644_10097839 3300025931 Bacteria 2198
486 Ga0207644_10144575 3300025931 Bacteria 1834
487 Ga0207644_10243228 3300025931 Bacteria 1433
488 Ga0207644_10331306 3300025931 Bacteria 1233
489 Ga0207690_10000479 3300025932 Bacteria 25747
490 Ga0207690_10063663 3300025932 Bacteria 2515
491 Ga0207690_10258926 3300025932 Bacteria 1347
492 Ga0207690_10647892 3300025932 Bacteria 865
493 Ga0207706_10000949 3300025933 Bacteria 29653
494 Ga0207706_10005293 3300025933 Bacteria 12028
495 Ga0207706_10041329 3300025933 Bacteria 4087
496 Ga0207706_10299466 3300025933 Bacteria 1401
497 Ga0207706_10373751 3300025933 Bacteria 1238
498 Ga0207709_10709515 3300025935 Bacteria 806
499 Ga0207670_10054674 3300025936 Bacteria 2695
500 Ga0207670_10126599 3300025936 Bacteria 1865
501 Ga0207669_10073694 3300025937 Bacteria 2155
502 Ga0207669_10101777 3300025937 Bacteria 1901
503 Ga0207704_10004791 3300025938 Bacteria 6211
504 Ga0207691_10000460 3300025940 Bacteria 40302
505 Ga0207691_10004666 3300025940 Bacteria 13265
506 Ga0207691_10009976 3300025940 Bacteria 9122
507 Ga0207691_10021459 3300025940 Bacteria 6097
508 Ga0207691_10037082 3300025940 Bacteria 4515
509 Ga0207691_10124011 3300025940 Bacteria 2287
510 Ga0207691_10148801 3300025940 Bacteria 2060
511 Ga0207691_10230809 3300025940 Bacteria 1603
512 Ga0207691_10567183 3300025940 Bacteria 962
513 Ga0207711_10016992 3300025941 Bacteria 6043
514 Ga0207711_10021212 3300025941 Bacteria 5425
515 Ga0207711_10027541 3300025941 Bacteria 4775
516 Ga0207711_10322718 3300025941 Bacteria 1427
517 Ga0207689_10000334 3300025942 Bacteria 43862
518 Ga0207689_10002446 3300025942 Bacteria 17304
519 Ga0207689_10073773 3300025942 Bacteria 2804
520 Ga0207661_10078708 3300025944 Bacteria 2715
521 Ga0207661_10958178 3300025944 Bacteria 788
522 Ga0207679_10002273 3300025945 Bacteria 11846
523 Ga0207679_10013302 3300025945 Bacteria 5391
524 Ga0207679_10017038 3300025945 Bacteria 4835
525 Ga0207679_10152487 3300025945 Bacteria 1883
526 Ga0207679_10209757 3300025945 Bacteria 1633
527 Ga0207679_10259442 3300025945 Bacteria 1481
528 Ga0207679_10343854 3300025945 Bacteria 1298
529 Ga0207679_10374252 3300025945 Bacteria 1247
530 Ga0207679_10378606 3300025945 Bacteria 1240
531 Ga0207667_10004336 3300025949 Bacteria 17369
532 Ga0207667_10005313 3300025949 Bacteria 15693
533 Ga0207667_10017360 3300025949 Bacteria 8101
534 Ga0207667_10071940 3300025949 Bacteria 3595
535 Ga0207667_10282151 3300025949 Bacteria 1697
536 Ga0207667_10415090 3300025949 Bacteria 1370
537 Ga0207651_10001143 3300025960 Bacteria 11850
538 Ga0207651_10016802 3300025960 Bacteria 4301
539 Ga0207651_10025546 3300025960 Bacteria 3673
540 Ga0207651_10137832 3300025960 Bacteria 1880
541 Ga0207651_10165200 3300025960 Bacteria 1739
542 Ga0207712_10116814 3300025961 Bacteria 2011
543 Ga0207668_10004304 3300025972 Bacteria 8360
544 Ga0207668_10008551 3300025972 Bacteria 6106
545 Ga0207668_10023164 3300025972 Bacteria 3986
546 Ga0207668_10091799 3300025972 Bacteria 2233
547 Ga0207668_10134802 3300025972 Bacteria 1890
548 Ga0207668_10511236 3300025972 Bacteria 1035
549 Ga0207640_10024616 3300025981 Bacteria 3634
550 Ga0207640_10054468 3300025981 Bacteria 2615
551 Ga0207640_10115310 3300025981 Bacteria 1913
552 Ga0207640_10165978 3300025981 Bacteria 1639
553 Ga0207640_10299803 3300025981 Bacteria 1271
554 Ga0207658_10001481 3300025986 Bacteria 18232
555 Ga0207658_10019866 3300025986 Bacteria 4648
556 Ga0207658_10030492 3300025986 Bacteria 3819
557 Ga0207658_10133739 3300025986 Bacteria 1996
558 Ga0207658_10145936 3300025986 Bacteria 1921
559 Ga0207677_10080854 3300026023 Bacteria 2330
560 Ga0207677_10167092 3300026023 Bacteria 1716
561 Ga0207677_10255168 3300026023 Bacteria 1426
562 Ga0207677_10258154 3300026023 Bacteria 1419
563 Ga0207703_10000206 3300026035 Bacteria 68955
564 Ga0207703_10007266 3300026035 Bacteria 8809
565 Ga0207703_10018431 3300026035 Bacteria 5451
566 Ga0207703_10075536 3300026035 Bacteria 2793
567 Ga0207703_10212922 3300026035 Bacteria 1724
568 Ga0207639_10009519 3300026041 Bacteria 6708
569 Ga0207639_10014794 3300026041 Bacteria 5495
570 Ga0207639_10126986 3300026041 Bacteria 2105
571 Ga0207639_10196320 3300026041 Bacteria 1728
572 Ga0207639_10681281 3300026041 Bacteria 953
573 Ga0207639_10740759 3300026041 Bacteria 913
574 Ga0207678_10003136 3300026067 Bacteria 14957
575 Ga0207678_10061221 3300026067 Bacteria 3237
576 Ga0207678_10167678 3300026067 Bacteria 1875
577 Ga0207678_10237276 3300026067 Bacteria 1561
578 Ga0207678_10659245 3300026067 Bacteria 920
579 Ga0207708_10002209 3300026075 Bacteria 14387
580 Ga0207702_10008488 3300026078 Bacteria 8663
581 Ga0207702_10046384 3300026078 Bacteria 3658
582 Ga0207702_10180039 3300026078 Bacteria 1946
583 Ga0207641_10015364 3300026088 Bacteria 6273
584 Ga0207641_10045654 3300026088 Bacteria 3690
585 Ga0207641_10047328 3300026088 Bacteria 3626
586 Ga0207641_10055323 3300026088 Bacteria 3369
587 Ga0207641_10058663 3300026088 Bacteria 3276
588 Ga0207641_10112919 3300026088 Bacteria 2411
589 Ga0207641_10334752 3300026088 Bacteria 1439
590 Ga0207641_10765738 3300026088 Bacteria 953
591 Ga0207648_10001217 3300026089 Bacteria 28850
592 Ga0207648_10004631 3300026089 Bacteria 14082
593 Ga0207648_10010795 3300026089 Bacteria 8630
594 Ga0207648_10044102 3300026089 Bacteria 3913
595 Ga0207648_10187909 3300026089 Bacteria 1830
596 Ga0207676_10011615 3300026095 Bacteria 6296
597 Ga0207676_10142224 3300026095 Bacteria 2055
598 Ga0207674_10000267 3300026116 Bacteria 65608
599 Ga0207674_10012883 3300026116 Bacteria 9331
600 Ga0207674_10037011 3300026116 Bacteria 5079
601 Ga0207674_10043165 3300026116 Bacteria 4651
602 Ga0207674_10074685 3300026116 Bacteria 3401
603 Ga0207674_10453985 3300026116 Bacteria 1239
604 Ga0207674_10759849 3300026116 Bacteria 936
605 Ga0207674_10888143 3300026116 Bacteria 859
606 Ga0207675_100001654 3300026118 Bacteria 22285
607 Ga0207675_100038839 3300026118 Bacteria 4442
608 Ga0207675_100055959 3300026118 Bacteria 3680
609 Ga0207675_100078682 3300026118 Bacteria 3090
610 Ga0207675_100083156 3300026118 Bacteria 3002
611 Ga0207675_100149035 3300026118 Bacteria 2226
612 Ga0207683_10000391 3300026121 Bacteria 40356
613 Ga0207683_10003032 3300026121 Bacteria 14676
614 Ga0207683_10096805 3300026121 Bacteria 2631
615 Ga0207683_10285443 3300026121 Bacteria 1509
616 Ga0207683_10331348 3300026121 Bacteria 1395
617 Ga0207683_10475365 3300026121 Bacteria 1153
618 Ga0207683_10766168 3300026121 Bacteria 895
619 Ga0207683_10778144 3300026121 Bacteria 888
620 Ga0207683_11012705 3300026121 Bacteria 771
621 Ga0207698_10006636 3300026142 Bacteria 7237
622 Ga0207698_10194363 3300026142 Bacteria 1811
623 Ga0207698_10344723 3300026142 Bacteria 1405
624 Ga0207698_10384600 3300026142 Bacteria 1336
625 Ga0207698_10544294 3300026142 Bacteria 1137
626 Ga0207698_10570005 3300026142 Bacteria 1112
627 Ga0209999_1011605 3300027543 Bacteria 1595
628 Ga0210002_1007094 3300027617 Bacteria 1697
629 Ga0209971_1002534 3300027682 Bacteria 4380
630 Ga0209998_10008029 3300027717 Bacteria 2189
631 Ga0209974_10004628 3300027876 Bacteria 4893
632 Ga0209974_10005406 3300027876 Bacteria 4495
633 Ga0268266_10097777 3300028379 Bacteria 2582
634 Ga0268266_10206666 3300028379 Bacteria 1799
635 Ga0268266_10248693 3300028379 Bacteria 1644
636 Ga0268266_10486326 3300028379 Bacteria 1177
637 Ga0268266_10879453 3300028379 Bacteria 866
638 Ga0268265_10002786 3300028380 Bacteria 12880
639 Ga0268265_10025788 3300028380 Bacteria 4176
640 Ga0268265_10030400 3300028380 Bacteria 3889
641 Ga0268265_10043205 3300028380 Bacteria 3348
642 Ga0268264_10000873 3300028381 Bacteria 31923
643 Ga0268264_10003639 3300028381 Bacteria 13258
644 Ga0268264_10006984 3300028381 Bacteria 9475
645 Ga0268264_10016720 3300028381 Bacteria 6005
646 Ga0268264_10021771 3300028381 Bacteria 5233
647 Ga0268264_10110342 3300028381 Bacteria 2408
648 Ga0268264_10685949 3300028381 Bacteria 1016
649 Ga0316576_10056256 3300031727 Bacteria 2872
650 Ga0316576_10213466 3300031727 Bacteria 1452
651 Ga0307405_10006341 3300031731 Bacteria 5811
652 Ga0307405_10217451 3300031731 Bacteria 1400
653 Ga0316577_10002290 3300031733 Bacteria 9439
654 Ga0307413_10008340 3300031824 Bacteria 4886
655 Ga0307410_10003061 3300031852 Bacteria 8276
656 Ga0307406_10014795 3300031901 Bacteria 4496
657 Ga0307407_10066884 3300031903 Bacteria 2121
658 Ga0307412_10433369 3300031911 Bacteria 1078
659 Ga0307409_100035087 3300031995 Bacteria 3672
660 Ga0307409_100187731 3300031995 Bacteria 1836
661 Ga0307416_100005347 3300032002 Bacteria 7876
662 Ga0307411_10182136 3300032005 Bacteria 1595
663 Ga0373943_0106426 3300035170 Bacteria 1474
664 Ga0373955_0256305 3300035172 Bacteria 1049
665 Ga0373962_0111998 3300035242 Bacteria 862
666 Ga0316574_0085868 3300035398 Bacteria 2002
667 Ga0316574_0123206 3300035398 Bacteria 1665
668 Ga0373927_0005307 3300035695 Bacteria 8905
669 Ga0373933_0069268 3300035724 Bacteria 2144
670 Ga0373933_0078369 3300035724 Bacteria 2022
671 Ga0373947_0055721 3300035725 Bacteria 2388
672 Ga0373947_0326944 3300035725 Bacteria 1026
673 Ga0373937_0039870 3300036401 Bacteria 4280
674 Ga0373937_0047650 3300036401 Bacteria 3922
675 Ga0373937_0878625 3300036401 Bacteria 845
676 Ga0316582_0195224 3300036647 Bacteria 1380
677 Ga0316584_0123937 3300036712 Bacteria 1930
678 Ga0395899_0194241 3300037312 Bacteria 1419
679 Ga0395900_0370875 3300037418 Bacteria 1401
680 Ga0395900_0657381 3300037418 Bacteria 984
681 Ga0395905_0086253 3300037471 Bacteria 2942
682 Ga0395901_0048371 3300038443 Bacteria 4416
683 Ga0395901_0321375 3300038443 Bacteria 1601
684 Ga0451804_0190874 3300041463 Bacteria 1327
685 Ga0451853_3231207 3300041512 Bacteria 1425
686 Ga0439448_0099803 3300042005 Bacteria 986
687 Ga0439448_0128666 3300042005 Bacteria 872
688 Ga0451577_0108545 3300042876 Bacteria 2481
689 Ga0451577_0375264 3300042876 Bacteria 1290
690 Ga0466963_0251482 3300044694 Bacteria 1240
691 Ga0453684_0463863 3300044712 Bacteria 1408
692 Ga0453684_0527873 3300044712 Bacteria 1303
693 Ga0451576_0215483 3300045051 Bacteria 2005
694 Ga0495580_0116468 3300046472 Bacteria 1856
695 Ga0495580_0350613 3300046472 Bacteria 1000
696 Ga0495664_0038574 3300046477 Bacteria 2820
697 Ga0495647_0291364 3300046681 Bacteria 734
698 Ga0495602_0070458 3300048088 Bacteria 2992
699 Ga0496100_0008050 3300048903 Bacteria 5858
700 Ga0496100_0195521 3300048903 Bacteria 1471
701 Ga0496101_0134798 3300048904 Bacteria 1878
702 Ga0496101_0356375 3300048904 Bacteria 1150
703 Ga0496102_0000940 3300048905 Bacteria 27514
704 Ga0496102_0041396 3300048905 Bacteria 4171
705 Ga0496103_0070084 3300048906 Bacteria 2193
706 Ga0496103_0243339 3300048906 Bacteria 1157
707 Ga0496106_0000293 3300048909 Bacteria 35117
708 Ga0496106_0062823 3300048909 Bacteria 2821
709 Ga0496106_0101721 3300048909 Bacteria 2229
710 Ga0496106_0117872 3300048909 Bacteria 2072
711 Ga0496106_0248693 3300048909 Bacteria 1421
712 Ga0496107_0049128 3300048910 Bacteria 3040
713 Ga0496107_0060283 3300048910 Bacteria 2746
714 Ga0496108_0009103 3300048911 Bacteria 8038
715 Ga0496109_0001844 3300048912 Bacteria 17571
716 Ga0496109_0016477 3300048912 Bacteria 6461
717 Ga0496109_0075989 3300048912 Bacteria 3089
718 Ga0496109_0522962 3300048912 Bacteria 1120
719 Ga0496110_0048663 3300048913 Bacteria 3716
720 Ga0496110_0166818 3300048913 Bacteria 1997
721 Ga0496110_0430790 3300048913 Bacteria 1202
722 Ga0496111_0624186 3300048914 Bacteria 788
723 Ga0496112_0000429 3300048915 Bacteria 27778
724 Ga0496112_0184505 3300048915 Bacteria 2050
725 Ga0496112_0435659 3300048915 Bacteria 1249
726 Ga0496113_0320723 3300048916 Bacteria 1242
727 Ga0501034_0012785 3300049571 Bacteria 8658
728 Ga0501067_0016720 3300049583 Bacteria 4053
729 Ga0501067_0195491 3300049583 Bacteria 1127
730 Ga0501070_0009333 3300049586 Bacteria 8295
731 Ga0501072_0069751 3300049588 Bacteria 2775
732 Ga0501073_0022348 3300049589 Bacteria 4556
733 Ga0501075_0328750 3300049591 Bacteria 1165
734 Ga0501080_0012503 3300049742 Bacteria 7784
735 Ga0501083_0032130 3300049744 Bacteria 3601
736 Ga0501035_0041159 3300049822 Bacteria 4173
737 nmdc:mga0n895_530735_c1 3300050512 Bacteria 1184
738 nmdc:mga0rr50_187729_c1 3300050513 Bacteria 1692
739 nmdc:mga0rr50_343623_c1 3300050513 Bacteria 1254
740 nmdc:mga0rr50_665454_c1 3300050513 Bacteria 888
741 nmdc:mga08x19_77106_c1 3300050514 Bacteria 2182
742 Ga0495612_0204603 3300053078 Bacteria 871
743 Ga0207676_10052572
744 JGI24737J22298_10119837
745 JGI24034J26672_10012409
746 Ga0070658_10033814
747 Ga0070658_10118353
748 Ga0070658_10237398
749 Ga0070676_10008451
750 Ga0070676_10021957
751 Ga0070676_10065532
752 Ga0070676_10111807
753 Ga0070676_10113331
754 Ga0070676_10537714
755 Ga0070683_100028393
756 Ga0070683_100028844
757 Ga0070683_100034575
758 Ga0070683_100086803
759 Ga0070690_100012677
760 Ga0070690_100433689
761 Ga0070670_100018323
762 Ga0070670_100026701
763 Ga0070670_100049764
764 Ga0070670_100054051
765 Ga0070670_100060145
766 Ga0070670_100188803
767 Ga0070670_100708121
768 Ga0070677_10006218
769 Ga0068869_100000028
770 Ga0068869_100030668
771 Ga0068869_100068042
772 Ga0068869_100070066
773 Ga0070666_10001313
774 Ga0070666_10083445
775 Ga0070666_10112837
776 Ga0070666_10252578
777 Ga0070666_10258675
778 Ga0070680_100004529
779 Ga0068868_100028044
780 Ga0068868_100079033
781 Ga0068868_100115426
782 Ga0070660_100009534
783 Ga0070660_100029043
784 Ga0070660_100065413
785 Ga0070660_100066325
786 Ga0070660_100134099
787 Ga0070660_100136617
788 Ga0070660_100362007
789 Ga0070689_100011772
790 Ga0070689_100040630
791 Ga0070661_100004082
792 Ga0070661_100009481
793 Ga0070661_100017748
794 Ga0070661_100018962
795 Ga0070661_100027399
796 Ga0070661_100100969
797 Ga0070661_100113227
798 Ga0070661_100230012
799 Ga0070661_100288584
800 Ga0070661_100710185
801 Ga0070692_10022789
802 Ga0070692_10195663
803 Ga0070668_100005113
804 Ga0070668_100007304
805 Ga0070668_100096150
806 Ga0070668_100103240
807 Ga0070669_100000689
808 Ga0070669_100012792
809 Ga0070669_100064261
810 Ga0070669_100112712
811 Ga0070669_100129294
812 Ga0070669_100331612
813 Ga0070669_100336688
814 Ga0070675_100008241
815 Ga0070675_100015478
816 Ga0070675_100102564
817 Ga0070675_100279545
818 Ga0070671_100006677
819 Ga0070671_100018416
820 Ga0070671_100037030
821 Ga0070671_100052985
822 Ga0070671_100238518
823 Ga0070671_100701888
824 Ga0070674_100047528
825 Ga0070674_100113225
826 Ga0070673_100001121
827 Ga0070673_100012755
828 Ga0070673_100020304
829 Ga0070673_100055303
830 Ga0070673_100345383
831 Ga0070688_100069803
832 Ga0070688_100400255
833 Ga0070659_100006562
834 Ga0070659_100011024
835 Ga0070659_100086254
836 Ga0070659_100098208
837 Ga0070659_100111283
838 Ga0070659_100400364
839 Ga0070667_100000622
840 Ga0070667_100016050
841 Ga0070667_100040500
842 Ga0070667_100091214
843 Ga0070667_100102620
844 Ga0070667_100145924
845 Ga0070667_100204978
846 Ga0070667_100595394
847 Ga0070709_10090265
848 Ga0070714_100042802
849 Ga0070714_100047328
850 Ga0070714_100068236
851 Ga0070714_100899554
852 Ga0070713_100016130
853 Ga0070713_100244585
854 Ga0070710_10010455
855 Ga0070701_10104787
856 Ga0070701_10267953
857 Ga0070711_100750651
858 Ga0070705_100026930
859 Ga0070705_100776871
860 Ga0070700_100019467
861 Ga0070694_100240755
862 Ga0070708_100000104
863 Ga0070708_100062433
864 Ga0070708_100063031
865 Ga0070663_100004467
866 Ga0070663_100020378
867 Ga0070663_100088266
868 Ga0070663_100136828
869 Ga0070663_100517754
870 Ga0070663_100582874
871 Ga0070678_100000126
872 Ga0070678_100062689
873 Ga0070678_100549040
874 Ga0070678_100586492
875 Ga0070662_100000684
876 Ga0070662_100098377
877 Ga0070662_100451753
878 Ga0070681_10037612
879 Ga0070681_10043989
880 Ga0070681_10147782
881 Ga0070681_10223813
882 Ga0068867_100003002
883 Ga0068867_100012374
884 Ga0070685_10002286
885 Ga0070706_100019033
886 Ga0070706_100078386
887 Ga0070707_100019521
888 Ga0070698_100065625
889 Ga0070698_100113207
890 Ga0070699_100045752
891 Ga0070699_100077417
892 Ga0070679_100009275
893 Ga0070679_100059944
894 Ga0070679_100066561
895 Ga0070679_100086254
896 Ga0070679_100099170
897 Ga0070679_100344891
898 Ga0070679_100495405
899 Ga0070684_100019873
900 Ga0070684_100026089
901 Ga0070684_100061598
902 Ga0070684_100293681
903 Ga0070697_100028697
904 Ga0070697_100125203
905 Ga0068853_100011401
906 Ga0068853_100021386
907 Ga0068853_100029585
908 Ga0068853_100031077
909 Ga0068853_100070693
910 Ga0068853_100154403
911 Ga0070672_100002841
912 Ga0070672_100007446
913 Ga0070672_100059969
914 Ga0070672_100419115
915 Ga0070672_100666238
916 Ga0070686_100028897
917 Ga0070695_100040682
918 Ga0070695_100084628
919 Ga0070696_100001069
920 Ga0070696_100019624
921 Ga0070693_100139602
922 Ga0070693_100331605
923 Ga0070693_100512639
924 Ga0070665_100025522
925 Ga0070665_100027486
926 Ga0070665_100055319
927 Ga0070665_100672990
928 Ga0070665_100683423
929 Ga0070704_100227193
930 Ga0068855_100001539
931 Ga0068855_100009898
932 Ga0068855_100085944
933 Ga0068855_100157654
934 Ga0068855_100170792
935 Ga0068855_100297677
936 Ga0070664_100010057
937 Ga0070664_100012914
938 Ga0070664_100059551
939 Ga0070664_100074417
940 Ga0070664_100168934
941 Ga0070664_100231147
942 Ga0070664_100251312
943 Ga0070664_100259873
944 Ga0070664_100324579
945 Ga0068857_100000949
946 Ga0068857_100027099
947 Ga0068857_100027470
948 Ga0068857_100086366
949 Ga0068857_100242814
950 Ga0068857_100267399
951 Ga0068857_100524246
952 Ga0068854_100003306
953 Ga0068854_100003803
954 Ga0068854_100105727
955 Ga0068854_100213715
956 Ga0068856_100002893
957 Ga0068856_100012230
958 Ga0068856_100052023
959 Ga0068856_100471078
960 Ga0068852_100009487
961 Ga0068852_100023473
962 Ga0068852_100144143
963 Ga0068852_100178116
964 Ga0068852_100626100
965 Ga0068852_100675532
966 Ga0068852_101308382
967 Ga0068859_100000096
968 Ga0068859_100006280
969 Ga0068859_100043190
970 Ga0068864_100000214
971 Ga0068864_100006619
972 Ga0068864_100006987
973 Ga0068864_100019793
974 Ga0068864_100047243
975 Ga0068864_100064356
976 Ga0068864_100949651
977 Ga0068866_10001391
978 Ga0068861_100001660
979 Ga0068861_100014890
980 Ga0068861_100051039
981 Ga0068861_100170015
982 Ga0068861_101072209
983 Ga0068851_10005137
984 Ga0068851_10008891
985 Ga0068851_10014386
986 Ga0068851_10056032
987 Ga0068851_10065940
988 Ga0068851_10088379
989 Ga0068851_10139500
990 Ga0068851_10139886
991 Ga0068851_10170264
992 Ga0068851_10184104
993 Ga0068870_10006284
994 Ga0068870_10081349
995 Ga0068863_100000885
996 Ga0068863_100064365
997 Ga0068863_100067216
998 Ga0068863_100185701
999 Ga0068863_100383492
1000 Ga0068863_100422850
1001 Ga0068858_100002939
1002 Ga0068858_100003156
1003 Ga0068858_100016996
1004 Ga0068858_100032724
1005 Ga0068858_100238649
1006 Ga0068860_100000990
1007 Ga0068860_100005277
1008 Ga0068860_100034190
1009 Ga0068860_100036983
1010 Ga0068860_100048305
1011 Ga0068860_100251079
1012 Ga0068860_100409486
1013 Ga0068860_100492057
1014 Ga0068860_100503296
1015 Ga0068862_100025873
1016 Ga0068862_100061410
1017 Ga0068862_100350457
1018 Ga0068862_100433035
1019 Ga0070712_100144496
1020 Ga0097621_100012585
1021 Ga0097621_100121179
1022 Ga0097621_100872724
1023 Ga0068871_100004280
1024 Ga0068871_100220882
1025 Ga0075428_100166878
1026 Ga0068865_100010020
1027 Ga0068865_100021175
1028 Ga0097620_100000096
1029 Ga0097620_100006280
1030 Ga0097620_100043194
1031 Ga0105251_10060825
1032 Ga0105240_10001001
1033 Ga0105240_10024364
1034 Ga0105240_10153390
1035 Ga0105240_10209086
1036 Ga0111539_10017317
1037 Ga0105245_10175390
1038 Ga0105247_10135418
1039 Ga0105243_10152124
1040 Ga0105241_10005193
1041 Ga0105241_10223593
1042 Ga0105241_10466747
1043 Ga0105241_10502064
1044 Ga0105242_10059204
1045 Ga0105248_10002974
1046 Ga0105248_10004428
1047 Ga0105248_10036996
1048 Ga0105248_10153563
1049 Ga0105248_10464483
1050 Ga0105248_11760468
1051 Ga0105237_10061564
1052 Ga0105237_10289927
1053 Ga0105238_10043321
1054 Ga0105238_10146248
1055 Ga0105238_10594735
1056 Ga0105238_11042241
1057 Ga0105249_10020383
1058 Ga0105249_10027041
1059 Ga0105239_10311970
1060 Ga0105239_10480467
1061 Ga0105246_10827791
1062 Ga0157342_1021797
1063 Ga0157373_10024346
1064 Ga0157373_10049411
1065 Ga0157373_10108251
1066 Ga0157373_10412187
1067 Ga0157371_10002555
1068 Ga0157371_10115820
1069 Ga0157371_10196886
1070 Ga0157371_10239605
1071 Ga0157370_10005091
1072 Ga0157370_10008148
1073 Ga0157370_10025666
1074 Ga0157370_10044971
1075 Ga0157370_10173535
1076 Ga0157370_10224669
1077 Ga0157370_10289046
1078 Ga0157370_10307463
1079 Ga0157370_10311080
1080 Ga0157369_10135856
1081 Ga0157369_10178628
1082 Ga0157369_10266088
1083 Ga0157369_10347030
1084 Ga0157369_10835205
1085 Ga0157369_10955883
1086 Ga0157374_10008118
1087 Ga0157374_10022866
1088 Ga0157374_10324886
1089 Ga0157378_10318309
1090 Ga0163162_10017676
1091 Ga0163162_10088253
1092 Ga0163162_10268094
1093 Ga0163162_10551281
1094 Ga0157372_10000342
1095 Ga0157372_10013150
1096 Ga0157372_10017161
1097 Ga0157372_10017981
1098 Ga0157372_10032862
1099 Ga0157372_10148944
1100 Ga0157372_10187225
1101 Ga0157372_10483772
1102 Ga0157372_10539430
1103 Ga0157372_10783408
1104 Ga0157375_10043852
1105 Ga0157375_10070245
1106 Ga0157375_10138906
1107 Ga0157375_10558903
1108 Ga0157375_10695615
1109 Ga0163163_10004530
1110 Ga0163163_10103411
1111 Ga0163163_10316348
1112 Ga0163163_10329823
1113 Ga0157380_10058796
1114 Ga0157380_10395653
1115 Ga0182008_10212149
1116 Ga0157377_10014470
1117 Ga0157379_10000371
1118 Ga0157379_10006045
1119 Ga0157379_10029865
1120 Ga0157379_10180886
1121 Ga0157379_10244245
1122 Ga0157379_10302741
1123 Ga0157379_10305101
1124 Ga0157376_10579035
1125 Ga0163161_10017189
1126 Ga0163161_10045385
1127 Ga0206356_11808518
1128 Ga0207666_1001674
1129 Ga0207697_10001689
1130 Ga0207697_10003626
1131 Ga0207656_10008900
1132 Ga0207656_10032942
1133 Ga0207656_10034086
1134 Ga0207656_10118262
1135 Ga0207682_10000068
1136 Ga0207692_10136686
1137 Ga0207642_10111367
1138 Ga0207710_10293697
1139 Ga0207688_10005514
1140 Ga0207680_10004115
1141 Ga0207680_10004453
1142 Ga0207680_10035895
1143 Ga0207680_10062744
1144 Ga0207680_10163395
1145 Ga0207647_10363600
1146 Ga0207699_10006176
1147 Ga0207645_10000212
1148 Ga0207645_10001926
1149 Ga0207645_10007516
1150 Ga0207645_10014541
1151 Ga0207645_10027251
1152 Ga0207645_10161438
1153 Ga0207643_10000298
1154 Ga0207643_10023034
1155 Ga0207643_10241362
1156 Ga0207705_10039768
1157 Ga0207705_10229754
1158 Ga0207684_10020569
1159 Ga0207684_10028074
1160 Ga0207684_10124917
1161 Ga0207654_10042253
1162 Ga0207654_10140329
1163 Ga0207654_10567204
1164 Ga0207707_10012059
1165 Ga0207707_10064382
1166 Ga0207707_10293411
1167 Ga0207707_10459374
1168 Ga0207695_10036403
1169 Ga0207695_10049286
1170 Ga0207695_10290951
1171 Ga0207671_10548500
1172 Ga0207671_10560776
1173 Ga0207693_10054699
1174 Ga0207663_10397207
1175 Ga0207660_10088737
1176 Ga0207660_10645999
1177 Ga0207657_10000738
1178 Ga0207657_10000884
1179 Ga0207657_10004460
1180 Ga0207657_10013618
1181 Ga0207657_10026357
1182 Ga0207657_10126617
1183 Ga0207657_10162653
1184 Ga0207657_10285208
1185 Ga0207649_10015874
1186 Ga0207649_10049428
1187 Ga0207649_10063184
1188 Ga0207649_10074136
1189 Ga0207649_10303328
1190 Ga0207649_10456536
1191 Ga0207652_10030771
1192 Ga0207652_10033588
1193 Ga0207652_10049623
1194 Ga0207652_10190649
1195 Ga0207652_10611591
1196 Ga0207646_10001674
1197 Ga0207646_10072521
1198 Ga0207646_10619682
1199 Ga0207681_10002290
1200 Ga0207681_10018182
1201 Ga0207681_10050082
1202 Ga0207681_10201607
1203 Ga0207681_10225662
1204 Ga0207681_10321110
1205 Ga0207694_10009155
1206 Ga0207694_10068337
1207 Ga0207650_10000654
1208 Ga0207650_10002790
1209 Ga0207650_10015094
1210 Ga0207650_10047035
1211 Ga0207650_10121546
1212 Ga0207650_10184481
1213 Ga0207659_10001334
1214 Ga0207659_10003849
1215 Ga0207659_10013808
1216 Ga0207659_10018388
1217 Ga0207659_10063191
1218 Ga0207687_10906154
1219 Ga0207700_10007633
1220 Ga0207700_10252457
1221 Ga0207664_10000327
1222 Ga0207664_10003369
1223 Ga0207664_10036023
1224 Ga0207664_10055273
1225 Ga0207644_10003980
1226 Ga0207644_10011151
1227 Ga0207644_10097839
1228 Ga0207644_10144575
1229 Ga0207644_10243228
1230 Ga0207644_10331306
1231 Ga0207690_10000479
1232 Ga0207690_10063663
1233 Ga0207690_10258926
1234 Ga0207690_10647892
1235 Ga0207706_10000949
1236 Ga0207706_10005293
1237 Ga0207706_10041329
1238 Ga0207706_10299466
1239 Ga0207706_10373751
1240 Ga0207709_10709515
1241 Ga0207670_10054674
1242 Ga0207670_10126599
1243 Ga0207669_10073694
1244 Ga0207669_10101777
1245 Ga0207704_10004791
1246 Ga0207691_10000460
1247 Ga0207691_10004666
1248 Ga0207691_10009976
1249 Ga0207691_10021459
1250 Ga0207691_10037082
1251 Ga0207691_10124011
1252 Ga0207691_10148801
1253 Ga0207691_10230809
1254 Ga0207691_10567183
1255 Ga0207711_10016992
1256 Ga0207711_10021212
1257 Ga0207711_10027541
1258 Ga0207711_10322718
1259 Ga0207689_10000334
1260 Ga0207689_10002446
1261 Ga0207689_10073773
1262 Ga0207661_10078708
1263 Ga0207661_10958178
1264 Ga0207679_10002273
1265 Ga0207679_10013302
1266 Ga0207679_10017038
1267 Ga0207679_10152487
1268 Ga0207679_10209757
1269 Ga0207679_10259442
1270 Ga0207679_10343854
1271 Ga0207679_10374252
1272 Ga0207679_10378606
1273 Ga0207667_10004336
1274 Ga0207667_10005313
1275 Ga0207667_10017360
1276 Ga0207667_10071940
1277 Ga0207667_10282151
1278 Ga0207667_10415090
1279 Ga0207651_10001143
1280 Ga0207651_10016802
1281 Ga0207651_10025546
1282 Ga0207651_10137832
1283 Ga0207651_10165200
1284 Ga0207712_10116814
1285 Ga0207668_10004304
1286 Ga0207668_10008551
1287 Ga0207668_10023164
1288 Ga0207668_10091799
1289 Ga0207668_10134802
1290 Ga0207668_10511236
1291 Ga0207640_10024616
1292 Ga0207640_10054468
1293 Ga0207640_10115310
1294 Ga0207640_10165978
1295 Ga0207640_10299803
1296 Ga0207658_10001481
1297 Ga0207658_10019866
1298 Ga0207658_10030492
1299 Ga0207658_10133739
1300 Ga0207658_10145936
1301 Ga0207677_10080854
1302 Ga0207677_10167092
1303 Ga0207677_10255168
1304 Ga0207677_10258154
1305 Ga0207703_10000206
1306 Ga0207703_10007266
1307 Ga0207703_10018431
1308 Ga0207703_10075536
1309 Ga0207703_10212922
1310 Ga0207639_10009519
1311 Ga0207639_10014794
1312 Ga0207639_10126986
1313 Ga0207639_10196320
1314 Ga0207639_10681281
1315 Ga0207639_10740759
1316 Ga0207678_10003136
1317 Ga0207678_10061221
1318 Ga0207678_10167678
1319 Ga0207678_10237276
1320 Ga0207678_10659245
1321 Ga0207708_10002209
1322 Ga0207702_10008488
1323 Ga0207702_10046384
1324 Ga0207702_10180039
1325 Ga0207641_10015364
1326 Ga0207641_10045654
1327 Ga0207641_10047328
1328 Ga0207641_10055323
1329 Ga0207641_10058663
1330 Ga0207641_10112919
1331 Ga0207641_10334752
1332 Ga0207641_10765738
1333 Ga0207648_10001217
1334 Ga0207648_10004631
1335 Ga0207648_10010795
1336 Ga0207648_10044102
1337 Ga0207648_10187909
1338 Ga0207676_10011615
1339 Ga0207676_10142224
1340 Ga0207674_10000267
1341 Ga0207674_10012883
1342 Ga0207674_10037011
1343 Ga0207674_10043165
1344 Ga0207674_10074685
1345 Ga0207674_10453985
1346 Ga0207674_10759849
1347 Ga0207674_10888143
1348 Ga0207675_100001654
1349 Ga0207675_100038839
1350 Ga0207675_100055959
1351 Ga0207675_100078682
1352 Ga0207675_100083156
1353 Ga0207675_100149035
1354 Ga0207683_10000391
1355 Ga0207683_10003032
1356 Ga0207683_10096805
1357 Ga0207683_10285443
1358 Ga0207683_10331348
1359 Ga0207683_10475365
1360 Ga0207683_10766168
1361 Ga0207683_10778144
1362 Ga0207683_11012705
1363 Ga0207698_10006636
1364 Ga0207698_10194363
1365 Ga0207698_10344723
1366 Ga0207698_10384600
1367 Ga0207698_10544294
1368 Ga0207698_10570005
1369 Ga0209999_1011605
1370 Ga0210002_1007094
1371 Ga0209971_1002534
1372 Ga0209998_10008029
1373 Ga0209974_10004628
1374 Ga0209974_10005406
1375 Ga0268266_10097777
1376 Ga0268266_10206666
1377 Ga0268266_10248693
1378 Ga0268266_10486326
1379 Ga0268266_10879453
1380 Ga0268265_10002786
1381 Ga0268265_10025788
1382 Ga0268265_10030400
1383 Ga0268265_10043205
1384 Ga0268264_10000873
1385 Ga0268264_10003639
1386 Ga0268264_10006984
1387 Ga0268264_10016720
1388 Ga0268264_10021771
1389 Ga0268264_10110342
1390 Ga0268264_10685949
1391 Ga0316576_10056256
1392 Ga0316576_10213466
1393 Ga0307405_10006341
1394 Ga0307405_10217451
1395 Ga0316577_10002290
1396 Ga0307413_10008340
1397 Ga0307410_10003061
1398 Ga0307406_10014795
1399 Ga0307407_10066884
1400 Ga0307412_10433369
1401 Ga0307409_100035087
1402 Ga0307409_100187731
1403 Ga0307416_100005347
1404 Ga0307411_10182136
1405 Ga0373943_0106426
1406 Ga0373955_0256305
1407 Ga0373962_0111998
1408 Ga0316574_0085868
1409 Ga0316574_0123206
1410 Ga0373927_0005307
1411 Ga0373933_0069268
1412 Ga0373933_0078369
1413 Ga0373947_0055721
1414 Ga0373947_0326944
1415 Ga0373937_0039870
1416 Ga0373937_0047650
1417 Ga0373937_0878625
1418 Ga0316582_0195224
1419 Ga0316584_0123937
1420 Ga0395899_0194241
1421 Ga0395900_0370875
1422 Ga0395900_0657381
1423 Ga0395905_0086253
1424 Ga0395901_0048371
1425 Ga0395901_0321375
1426 Ga0451804_0190874
1427 Ga0451853_3231207
1428 Ga0439448_0099803
1429 Ga0439448_0128666
1430 Ga0451577_0108545
1431 Ga0451577_0375264
1432 Ga0466963_0251482
1433 Ga0453684_0463863
1434 Ga0453684_0527873
1435 Ga0451576_0215483
1436 Ga0495580_0116468
1437 Ga0495580_0350613
1438 Ga0495664_0038574
1439 Ga0495647_0291364
1440 Ga0495602_0070458
1441 Ga0496100_0008050
1442 Ga0496100_0195521
1443 Ga0496101_0134798
1444 Ga0496101_0356375
1445 Ga0496102_0000940
1446 Ga0496102_0041396
1447 Ga0496103_0070084
1448 Ga0496103_0243339
1449 Ga0496106_0000293
1450 Ga0496106_0062823
1451 Ga0496106_0101721
1452 Ga0496106_0117872
1453 Ga0496106_0248693
1454 Ga0496107_0049128
1455 Ga0496107_0060283
1456 Ga0496108_0009103
1457 Ga0496109_0001844
1458 Ga0496109_0016477
1459 Ga0496109_0075989
1460 Ga0496109_0522962
1461 Ga0496110_0048663
1462 Ga0496110_0166818
1463 Ga0496110_0430790
1464 Ga0496111_0624186
1465 Ga0496112_0000429
1466 Ga0496112_0184505
1467 Ga0496112_0435659
1468 Ga0496113_0320723
1469 Ga0501034_0012785
1470 Ga0501067_0016720
1471 Ga0501067_0195491
1472 Ga0501070_0009333
1473 Ga0501072_0069751
1474 Ga0501073_0022348
1475 Ga0501075_0328750
1476 Ga0501080_0012503
1477 Ga0501083_0032130
1478 Ga0501035_0041159
1479 nmdc:mga0n895_530735_c1
1480 nmdc:mga0rr50_187729_c1
1481 nmdc:mga0rr50_343623_c1
1482 nmdc:mga0rr50_665454_c1
1483 nmdc:mga08x19_77106_c1
1484 Ga0495612_0204603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

20

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8egl-assembly1.cif.gz_B crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp and adp 0.9862 11 191
8egl-assembly2.cif.gz_H crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp and adp 0.9777 11 191
8egl-assembly1.cif.gz_J crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp and adp 0.9741 11 191
7s5e-assembly4.cif.gz_F crystal structure of a guanylate kinase from stenotrophomonas maltophilia k279a with heterogeneous ligand states of gmp/adp, gmp/-, gdp/-, and gmp/atpgs 0.9716 10 192
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9691 42 91
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9982 43 89 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9903 43 92 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9621 43 101 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9607 42 91 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9528 43 92 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A1H1C2L9-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.991 12 192 GO:0004385
GO:0005524
GO:0005829
AF-A0A1F9U039-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9872 11 192 GO:0004385
GO:0005524
GO:0005829
AF-A0A1W9GKP5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9847 15 192 GO:0004385
GO:0005524
GO:0005829
AF-A0A2M7DS87-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9841 10 192 GO:0004385
GO:0005524
GO:0005829
AF-A0A1G1J618-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9835 11 198 GO:0004385
GO:0005524
GO:0005829

Map