F478631

General Info

Members Datasets Scaffolds Average Seq Length
742 565 358 295

Family's Representative Sequence

Representative Sequence 3300013249|Ga0171463_1001|Ga0171463_1001291
Length 312
Sequence MNEGGFREHRFPATDGLQLYARSYGPVFAAPAVPIICLPGLTRNSRDFHELATFLASPGGGEHTVFSLDYRGRGNSQRDDDKSHYSIAIETTDIMTACTHLGIERAVFIGTSRGGLILHHLVGLAPDLIAGTVLNDIGPVIEIEGLLTIRNYLNKAAAGPISWAAVPGYLKDIHGAEFPNLGERDWQQMAKAIYRDEDGAPVPDFDVAIARQLLGLTVETSLPDLWPQYDAFSRMPLLVIRGEHSRLLSEGTMREMCKRHSRAVALTALGQGHAPLLHLDGPRQAVSAFVCAITRRRDVGTDRLHSEIDLEH

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
20 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
21 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2516143018 Ensifer sp. BR816 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
29 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
30 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
31 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
32 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
35 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
36 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
37 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
38 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
41 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
44 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
45 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
46 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
47 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
48 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
49 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
50 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
51 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
52 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
53 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
54 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
55 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
56 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
57 2643221557 Ensifer sp. Root558 Isolate Unclassified
58 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
59 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
60 2643221599 Rhizobium sp. Root708 Isolate Unclassified
61 2643221610 Ensifer sp. Root74 Isolate Unclassified
62 2643221618 Ensifer sp. Root231 Isolate Unclassified
63 2643221626 Ensifer sp. Root31 Isolate Unclassified
64 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
65 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
66 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
67 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
68 2643221655 Ensifer sp. Root1252 Isolate Unclassified
69 2643221659 Ensifer sp. Root127 Isolate Unclassified
70 2643221668 Ensifer sp. Root423 Isolate Unclassified
71 2643221675 Ensifer sp. Root1298 Isolate Unclassified
72 2643221680 Ensifer sp. Root1312 Isolate Unclassified
73 2643221698 Ensifer sp. Root142 Isolate Unclassified
74 2643221712 Ensifer sp. Root258 Isolate Unclassified
75 2643221718 Rhizobium sp. Root268 Isolate Unclassified
76 2643221719 Rhizobium sp. Root274 Isolate Unclassified
77 2643221723 Ensifer sp. Root278 Isolate Unclassified
78 2643221726 Ensifer sp. Root954 Isolate Unclassified
79 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
80 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
81 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
82 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
83 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
84 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
85 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
86 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
87 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
88 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
89 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
90 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
91 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
92 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
93 2738541293 Rhizobium sp. GV031 Isolate Unclassified
94 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
95 2738543024 Aminobacter sp. AP02 Isolate Unclassified
96 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
97 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
98 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
99 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
100 2791355261 Rhizobium sp. J15 Isolate Nodule
101 2802429633 Rhizobium anhuiense J3 Isolate Nodule
102 2802429634 Rhizobium anhuiense S10 Isolate Nodule
103 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
104 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
105 2802429637 Rhizobium anhuiense C15 Isolate Nodule
106 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
107 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
108 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
109 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
110 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
111 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
112 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
113 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
114 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
115 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
116 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
117 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
118 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
119 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
120 2844163670 Ensifer sp. 1H6 Isolate Unclassified
121 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
122 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
123 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
124 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
125 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
126 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
127 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
128 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
129 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
130 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
131 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
132 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
133 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
134 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
135 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
136 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
137 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
138 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
139 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
140 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
141 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
142 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
143 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
144 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
145 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
146 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
147 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
148 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
149 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
150 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
151 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
152 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
153 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
154 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
155 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
156 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
157 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
158 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
159 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
160 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
161 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
162 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
163 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
164 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
165 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
166 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
167 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
168 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
169 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
170 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
171 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
172 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
173 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
174 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
175 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
176 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
177 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
178 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
179 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
180 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
181 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
182 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
183 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
184 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
185 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
186 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
187 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
188 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
189 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
190 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
191 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
192 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
193 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
194 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
195 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
196 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
197 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
198 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
199 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
200 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
201 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
202 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
203 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
204 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
205 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
206 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
207 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
208 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
209 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
210 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
211 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
212 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
213 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
214 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
215 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
216 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
217 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
218 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
219 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
220 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
221 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
222 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
223 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
224 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
225 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
226 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
227 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
228 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
229 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
230 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
231 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
232 2933599457 Rhizobium phaseoli M3 Isolate Nodule
233 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
234 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
235 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
236 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
237 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
238 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
239 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
240 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
241 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
242 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
243 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
244 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
245 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
246 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
247 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
248 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
249 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
250 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
251 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
252 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
253 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
254 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
255 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
256 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
257 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
258 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
259 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
260 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
261 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
262 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
263 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
264 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
265 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
266 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
267 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
268 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
269 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
270 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
271 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
272 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
273 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
274 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
275 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
276 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
277 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
278 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
279 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
280 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
281 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
282 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
283 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
284 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
285 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
286 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
287 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
288 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
289 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
290 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
291 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
292 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
293 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
294 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
295 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
296 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
297 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
298 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
299 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
300 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
301 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
302 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
303 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
304 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
305 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
306 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
307 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
308 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
309 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
310 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
311 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
312 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
313 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
314 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
315 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
316 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
317 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
318 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
319 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
320 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
321 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
322 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
323 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
324 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
325 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
326 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
327 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
328 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
329 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
330 2996887358 Rhizobium sp. R711 Isolate Nodule
331 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
332 3004167301 Mesorhizobium loti 582 Isolate Unclassified
333 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
334 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
335 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
336 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
337 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
338 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
339 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
340 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
341 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
342 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
343 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
344 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
345 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
346 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
347 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
348 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
349 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
350 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
351 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
352 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
353 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
354 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
355 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
356 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
357 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
358 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
359 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
360 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
361 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
362 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
363 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
364 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
365 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
366 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
367 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
368 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
369 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
370 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
371 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
372 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
373 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
374 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
375 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
376 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
377 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
378 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
379 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
380 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
381 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
382 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
383 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
384 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
385 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
386 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
387 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
388 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
389 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
390 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
391 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
392 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
393 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
394 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
395 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
396 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
397 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
398 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
399 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
400 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
401 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
402 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
403 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
404 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
405 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
406 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
407 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
408 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
409 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
410 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
411 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
412 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
413 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
414 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
417 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
418 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
419 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
421 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
422 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
424 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
426 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
428 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
429 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
439 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
440 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
442 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
443 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
444 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
445 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
446 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
447 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
448 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
449 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
450 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
451 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
452 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
453 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
454 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
455 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
456 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
457 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
458 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
459 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
460 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
461 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
462 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
463 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
464 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
465 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
466 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
467 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
468 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
469 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
470 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
471 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
472 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
473 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
474 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
475 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
476 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
477 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
478 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
479 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
480 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
481 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
482 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
483 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
484 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
485 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
486 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
487 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
488 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
489 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
490 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
491 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
492 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
493 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
494 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
495 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
496 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
497 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
498 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
499 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
500 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
501 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
502 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
503 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
504 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
509 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
510 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
511 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
512 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
513 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
514 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
515 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
516 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
517 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
518 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
522 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
523 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
524 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
525 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
532 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
533 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
534 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
535 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
536 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
537 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
538 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
539 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
540 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
541 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
542 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
543 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
544 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
545 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
546 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
547 8005258706 Rhizobium sp. R693 Isolate Nodule
548 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
549 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
550 8005321885 Rhizobium sp. R72 Isolate Nodule
551 8005382845 Rhizobium sp. R634 Isolate Nodule
552 8005395548 Rhizobium sp. R339 Isolate Nodule
553 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
554 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
555 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
556 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
557 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
558 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
559 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
560 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
561 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
562 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
563 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
564 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
565 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.25
Metatranscriptomes 0
Isolates 51.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.91
Nodule 38.81
Rhizoplane 1.75
Rhizosphere 17.65
Stem 0
Stem Tuber 0
Unclassified 18.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001504 3300001979 Bacteria 10716
2 JGI25155J39150_1000783 3300002704 Bacteria 5140
3 JGI25156J39149_1000086 3300002705 Bacteria 69106
4 JGI25156J39149_1005640 3300002705 Bacteria 3564
5 JGI25162J39368_1002183 3300002737 Bacteria 8107
6 JGI25162J39368_1003329 3300002737 Bacteria 4798
7 JGI25154J39366_1002301 3300002738 Bacteria 5140
8 JGI25158J39367_1000020 3300002739 Bacteria 40034
9 JGI25157J39369_1000113 3300002741 Bacteria 69106
10 JGI25157J39369_1002576 3300002741 Bacteria 4342
11 JGI25152J39213_1000386 3300002773 Bacteria 26927
12 JGI25152J39213_1007215 3300002773 Bacteria 2906
13 JGI25152J39213_1008600 3300002773 Bacteria 2518
14 JGI25152J39213_1011904 3300002773 Bacteria 1897
15 JGI25150J39212_1000031 3300002774 Bacteria 100456
16 JGI25150J39212_1008997 3300002774 Bacteria 1925
17 JGI25159J45721_1000064 3300002987 Bacteria 51766
18 JGI25159J45721_1000366 3300002987 Bacteria 21031
19 JGI25159J45721_1000852 3300002987 Bacteria 13301
20 JGI25151J46595_10000062 3300003187 Bacteria 146687
21 JGI25151J46595_10006482 3300003187 Bacteria 5880
22 JGI25165J46597_1000028 3300003214 Bacteria 325146
23 JGI25165J46597_1001952 3300003214 Bacteria 8112
24 JGI25153J46596_10013155 3300003215 Bacteria 3517
25 JGI25153J46596_10016288 3300003215 Bacteria 2986
26 JGI25153J46596_10016851 3300003215 Bacteria 2906
27 rootH1_10047669 3300003316 Bacteria 4291
28 rootH1_10140486 3300003316 Bacteria 1492
29 rootH2_10052272 3300003320 Bacteria 1560
30 rootL2_10018429 3300003322 Bacteria 12824
31 JGI25160J50197_1000052 3300003354 Bacteria 127795
32 JGI25160J50197_1000562 3300003354 Bacteria 21031
33 JGI25160J50197_1000754 3300003354 Bacteria 17529
34 JGI25160J50197_1019106 3300003354 Bacteria 2111
35 JGI25161J50226_1000073 3300003374 Bacteria 86555
36 JGI25161J50226_1000113 3300003374 Bacteria 63092
37 JGI25161J50226_1000133 3300003374 Bacteria 52508
38 JGI25161J50226_1000436 3300003374 Bacteria 19607
39 JGI25161J50226_1002541 3300003374 Bacteria 4618
40 Ga0055542_1001866 3300003762 Bacteria 8461
41 Ga0055526_1004479 3300003771 Bacteria 8375
42 Ga0055526_1006191 3300003771 Bacteria 6579
43 Ga0055526_1006605 3300003771 Bacteria 6244
44 Ga0055526_1012450 3300003771 Bacteria 3707
45 Ga0055526_1015046 3300003771 Bacteria 3132
46 Ga0055526_1017752 3300003771 Bacteria 2698
47 Ga0055524_1003634 3300003775 Bacteria 7417
48 Ga0055524_1005715 3300003775 Bacteria 5512
49 Ga0055524_1014863 3300003775 Bacteria 2864
50 Ga0055524_1025780 3300003775 Bacteria 1833
51 Ga0055524_1029406 3300003775 Bacteria 1624
52 Ga0055536_1002650 3300003781 Bacteria 9938
53 Ga0055528_1009273 3300003790 Bacteria 4126
54 Ga0055528_1012483 3300003790 Bacteria 3290
55 Ga0055528_1014909 3300003790 Bacteria 2840
56 Ga0055528_1032741 3300003790 Bacteria 1318
57 Ga0055530_10021270 3300003791 Bacteria 1916
58 Ga0055540_1013426 3300003792 Bacteria 2501
59 Ga0055531_10002936 3300003794 Bacteria 11093
60 Ga0055543_1000035 3300004625 Bacteria 127833
61 Ga0055543_1000048 3300004625 Bacteria 109807
62 Ga0055543_1000656 3300004625 Bacteria 18294
63 Ga0055543_1003083 3300004625 Bacteria 5119
64 Ga0065165_1000253 3300005262 Bacteria 92969
65 Ga0065165_1001769 3300005262 Bacteria 21422
66 Ga0065165_1002851 3300005262 Bacteria 13416
67 Ga0065165_1021795 3300005262 Bacteria 2214
68 Ga0065165_1041868 3300005262 Bacteria 1356
69 Ga0070671_100047939 3300005355 Bacteria 3552
70 Ga0070674_100432138 3300005356 Bacteria 1083
71 Ga0070665_100075149 3300005548 Bacteria 3386
72 Ga0068855_100104707 3300005563 Bacteria 3254
73 Ga0068855_100287973 3300005563 Bacteria 1822
74 Ga0068856_100066467 3300005614 Bacteria 3562
75 Ga0068852_100157202 3300005616 Bacteria 2119
76 Ga0068864_100272324 3300005618 Bacteria 1578
77 Ga0075365_10010767 3300006038 Bacteria 5344
78 Ga0075365_10014694 3300006038 Bacteria 4715
79 Ga0075365_10024064 3300006038 Bacteria 3837
80 Ga0075365_10049094 3300006038 Bacteria 2779
81 Ga0075365_10128827 3300006038 Bacteria 1750
82 Ga0075368_10004539 3300006042 Bacteria 4718
83 Ga0075368_10141405 3300006042 Bacteria 1003
84 Ga0075363_100011877 3300006048 Bacteria 4183
85 Ga0075362_10012548 3300006177 Bacteria 3368
86 Ga0075362_10051080 3300006177 Bacteria 1850
87 Ga0075367_10029148 3300006178 Bacteria 3154
88 Ga0075367_10073067 3300006178 Bacteria 2066
89 Ga0075367_10137074 3300006178 Bacteria 1514
90 Ga0075367_10144528 3300006178 Bacteria 1474
91 Ga0075370_10001714 3300006353 Bacteria 9746
92 Ga0075370_10030460 3300006353 Bacteria 3011
93 Ga0075370_10182248 3300006353 Bacteria 1236
94 Ga0105251_10038788 3300009011 Bacteria 2331
95 Ga0105240_10000032 3300009093 Bacteria 283907
96 Ga0105240_10138698 3300009093 Bacteria 2910
97 Ga0105245_10188214 3300009098 Bacteria 1976
98 Ga0105241_10166716 3300009174 Bacteria 1816
99 Ga0105248_10301454 3300009177 Bacteria 1804
100 Ga0105237_10001967 3300009545 Bacteria 26136
101 Ga0105237_10454368 3300009545 Bacteria 1287
102 Ga0105237_10545123 3300009545 Bacteria 1167
103 Ga0105238_10156424 3300009551 Bacteria 2255
104 Ga0105238_10277042 3300009551 Bacteria 1658
105 Ga0123341_1000048 3300009765 Bacteria 50946
106 Ga0123342_1021801 3300009766 Bacteria 4444
107 Ga0105239_10005020 3300010375 Bacteria 15622
108 Ga0105239_10387576 3300010375 Bacteria 1580
109 Ga0105239_10543034 3300010375 Bacteria 1323
110 Ga0105239_10738495 3300010375 Bacteria 1126
111 Ga0157370_10021519 3300013104 Bacteria 6426
112 Ga0157369_10113223 3300013105 Bacteria 2882
113 Ga0171463_1001 3300013249 Bacteria 1406070
114 Ga0157374_10056724 3300013296 Bacteria 3657
115 Ga0163162_10136183 3300013306 Bacteria 2567
116 Ga0163163_10110128 3300014325 Bacteria 2782
117 Ga0182005_1002238 3300015265 Bacteria 7106
118 Ga0183363_1105 3300015690 Bacteria 24000
119 Ga0214542_1015605 3300021321 Bacteria 7816
120 Ga0214543_1000003 3300021327 Bacteria 692327
121 Ga0209435_100036 3300025206 Bacteria 126970
122 Ga0209436_100064 3300025208 Bacteria 56015
123 Ga0209436_101612 3300025208 Bacteria 7544
124 Ga0209437_100075 3300025233 Bacteria 297202
125 Ga0207425_1000031 3300025245 Bacteria 261181
126 Ga0207425_1007174 3300025245 Bacteria 2971
127 Ga0209646_1000132 3300025246 Bacteria 126859
128 Ga0209026_1000215 3300025250 Bacteria 80382
129 Ga0209026_1000236 3300025250 Bacteria 73740
130 Ga0209677_103446 3300025253 Bacteria 5138
131 Ga0209148_1000056 3300025254 Bacteria 363380
132 Ga0209759_1000269 3300025256 Bacteria 73740
133 Ga0209759_1000478 3300025256 Bacteria 44559
134 Ga0209129_1000053 3300025258 Bacteria 262823
135 Ga0209129_1001497 3300025258 Bacteria 12990
136 Ga0209129_1002483 3300025258 Bacteria 9004
137 Ga0209129_1003220 3300025258 Bacteria 7281
138 Ga0209129_1004442 3300025258 Bacteria 5466
139 Ga0209129_1004700 3300025258 Bacteria 5193
140 Ga0209233_1000056 3300025261 Bacteria 438104
141 Ga0209233_1000087 3300025261 Bacteria 325225
142 Ga0209233_1000209 3300025261 Bacteria 115124
143 Ga0209455_1000137 3300025272 Bacteria 142099
144 Ga0209673_1000254 3300025273 Bacteria 101508
145 Ga0209673_1000946 3300025273 Bacteria 36287
146 Ga0209673_1008306 3300025273 Bacteria 4632
147 Ga0209673_1014911 3300025273 Bacteria 2982
148 Ga0209673_1016552 3300025273 Bacteria 2751
149 Ga0209130_1000006 3300025284 Bacteria 596528
150 Ga0209130_1000007 3300025284 Bacteria 591584
151 Ga0209130_1000018 3300025284 Bacteria 388301
152 Ga0209130_1011860 3300025284 Bacteria 2310
153 Ga0209676_1000901 3300025292 Bacteria 37489
154 Ga0209025_1000087 3300025294 Bacteria 261181
155 Ga0209025_1000100 3300025294 Bacteria 229182
156 Ga0209025_1000284 3300025294 Bacteria 114754
157 Ga0209025_1019927 3300025294 Bacteria 3700
158 Ga0209025_1030374 3300025294 Bacteria 2588
159 Ga0209025_1046789 3300025294 Bacteria 1775
160 Ga0209564_1000233 3300025295 Bacteria 121692
161 Ga0209564_1000399 3300025295 Bacteria 77444
162 Ga0209564_1000846 3300025295 Bacteria 41021
163 Ga0209564_1002858 3300025295 Bacteria 12689
164 Ga0209564_1003779 3300025295 Bacteria 9853
165 Ga0209758_1000081 3300025297 Bacteria 261181
166 Ga0209758_1000420 3300025297 Bacteria 71919
167 Ga0209758_1004084 3300025297 Bacteria 12527
168 Ga0209758_1006944 3300025297 Bacteria 7892
169 Ga0209758_1007760 3300025297 Bacteria 7187
170 Ga0209758_1021891 3300025297 Bacteria 2958
171 Ga0209758_1031398 3300025297 Bacteria 2179
172 Ga0209758_1050709 3300025297 Bacteria 1452
173 Ga0209050_1011597 3300025298 Bacteria 4153
174 Ga0209256_1001151 3300025299 Bacteria 30005
175 Ga0209256_1001394 3300025299 Bacteria 25182
176 Ga0209256_1003709 3300025299 Bacteria 10370
177 Ga0209256_1005237 3300025299 Bacteria 7593
178 Ga0209256_1010196 3300025299 Bacteria 3976
179 Ga0209256_1011899 3300025299 Bacteria 3412
180 Ga0209256_1014300 3300025299 Bacteria 2866
181 Ga0209256_1016350 3300025299 Bacteria 2533
182 Ga0207426_1000044 3300025302 Bacteria 428043
183 Ga0207426_1000064 3300025302 Bacteria 358276
184 Ga0207426_1000106 3300025302 Bacteria 244368
185 Ga0207426_1000265 3300025302 Bacteria 110545
186 Ga0207426_1001649 3300025302 Bacteria 17375
187 Ga0207426_1056558 3300025302 Bacteria 1144
188 Ga0209051_1001024 3300025303 Bacteria 26621
189 Ga0209051_1004341 3300025303 Bacteria 8795
190 Ga0209051_1023343 3300025303 Bacteria 2575
191 Ga0209051_1024882 3300025303 Bacteria 2451
192 Ga0209051_1034527 3300025303 Bacteria 1894
193 Ga0209257_1001970 3300025304 Bacteria 22108
194 Ga0207647_10017567 3300025904 Bacteria 4861
195 Ga0207695_10000024 3300025913 Bacteria 632311
196 Ga0207695_10161872 3300025913 Bacteria 2169
197 Ga0207671_10000548 3300025914 Bacteria 50646
198 Ga0207671_10274449 3300025914 Bacteria 1329
199 Ga0207639_10298788 3300026041 Bacteria 1422
200 Ga0207702_10117701 3300026078 Bacteria 2373
201 Ga0207676_10374508 3300026095 Bacteria 1324
202 Ga0207698_10108767 3300026142 Bacteria 2318
203 Ga0207698_10206263 3300026142 Bacteria 1764
204 Ga0209371_1005193 3300027312 Bacteria 5288
205 Ga0209813_10004363 3300027866 Bacteria 3376
206 Ga0268266_10024031 3300028379 Bacteria 5186
207 Ga0307515_10000115 3300028794 Bacteria 193697
208 Ga0307515_10024373 3300028794 Bacteria 10546
209 Ga0268256_1001181 3300030500 Bacteria 16760
210 Ga0307513_10001304 3300031456 Bacteria 36013
211 Ga0307405_10000891 3300031731 Bacteria 11843
212 Ga0395900_0081127 3300037418 Bacteria 3333
213 Ga0395900_0093396 3300037418 Bacteria 3091
214 Ga0395900_0429166 3300037418 Bacteria 1281
215 Ga0395898_0304001 3300037466 Bacteria 1522
216 Ga0395905_0101304 3300037471 Bacteria 2704
217 Ga0395901_0221882 3300038443 Bacteria 1976
218 Ga0439465_0002776 3300041413 Bacteria 5734
219 Ga0439465_0015978 3300041413 Bacteria 2341
220 Ga0451798_1070384 3300041458 Bacteria 1485
221 Ga0451841_0200955 3300041498 Bacteria 1598
222 Ga0451855_1064790 3300041511 Bacteria 2090
223 Ga0451853_1815229 3300041512 Bacteria 1210
224 Ga0466963_0179605 3300044694 Bacteria 1477
225 Ga0466970_0019242 3300044765 Bacteria 3538
226 Ga0466960_0121661 3300044901 Bacteria 1368
227 Ga0495629_0028393 3300046459 Bacteria 3972
228 Ga0495638_0000353 3300046460 Bacteria 57451
229 Ga0495605_0003774 3300046474 Bacteria 8989
230 Ga0495585_0019942 3300046492 Bacteria 3859
231 Ga0495607_0105654 3300046501 Bacteria 1500
232 Ga0495583_0008919 3300046506 Bacteria 6060
233 Ga0495583_0031985 3300046506 Bacteria 2543
234 Ga0495606_0031650 3300046507 Bacteria 3674
235 Ga0495610_0038962 3300046512 Bacteria 2407
236 Ga0495620_0123226 3300046515 Bacteria 1020
237 Ga0495631_0001310 3300046518 Bacteria 15251
238 Ga0495632_0006839 3300046519 Bacteria 7276
239 Ga0495632_0017060 3300046519 Bacteria 4020
240 Ga0495643_0024313 3300046522 Bacteria 3438
241 Ga0495643_0065944 3300046522 Bacteria 1911
242 Ga0495643_0166634 3300046522 Bacteria 1080
243 Ga0495654_0060473 3300046530 Bacteria 1821
244 Ga0495587_0029550 3300046536 Bacteria 3327
245 Ga0495609_0041858 3300046538 Bacteria 2058
246 Ga0495668_0006786 3300046616 Bacteria 7440
247 Ga0495668_0112391 3300046616 Bacteria 1490
248 Ga0495634_0111012 3300046642 Bacteria 1763
249 Ga0495611_0007455 3300046648 Bacteria 4643
250 Ga0495625_0002820 3300046660 Bacteria 18292
251 Ga0495625_0117413 3300046660 Bacteria 1814
252 Ga0495625_0217542 3300046660 Bacteria 1253
253 Ga0495646_0192113 3300046680 Unclassified 1116
254 Ga0495658_0043521 3300046683 Bacteria 2512
255 Ga0495649_0016969 3300046694 Bacteria 4119
256 Ga0495660_0027516 3300046810 Bacteria 3217
257 Ga0495604_0076180 3300047317 Bacteria 2523
258 Ga0495687_054618 3300047443 Bacteria 1675
259 Ga0495681_0115214 3300047470 Bacteria 1159
260 Ga0495686_0003601 3300047472 Bacteria 13289
261 Ga0496100_0149605 3300048903 Bacteria 1663
262 Ga0496101_0182828 3300048904 Bacteria 1615
263 Ga0496101_0469408 3300048904 Bacteria 993
264 Ga0496102_0014203 3300048905 Bacteria 6918
265 Ga0496103_0022193 3300048906 Bacteria 3821
266 Ga0496106_0000154 3300048909 Bacteria 50775
267 Ga0496109_0607763 3300048912 Bacteria 1030
268 Ga0496110_0062655 3300048913 Bacteria 3285
269 Ga0496112_0165301 3300048915 Bacteria 2179
270 Ga0496116_0002110 3300048919 Bacteria 21206
271 Ga0496116_0027560 3300048919 Bacteria 4135
272 Ga0496116_0046777 3300048919 Bacteria 2917
273 Ga0496116_0074716 3300048919 Bacteria 2130
274 Ga0496116_0084851 3300048919 Bacteria 1949
275 Ga0496116_0216606 3300048919 Bacteria 986
276 Ga0496117_0002153 3300048920 Bacteria 25711
277 Ga0496117_0023629 3300048920 Bacteria 4891
278 Ga0496117_0027147 3300048920 Bacteria 4467
279 Ga0496118_0000695 3300048921 Bacteria 54668
280 Ga0496118_0050979 3300048921 Bacteria 3170
281 Ga0496118_0077789 3300048921 Bacteria 2351
282 Ga0496119_0011122 3300048922 Bacteria 7494
283 Ga0496119_0018267 3300048922 Bacteria 5235
284 Ga0496119_0032098 3300048922 Bacteria 3506
285 Ga0496119_0042811 3300048922 Bacteria 2868
286 Ga0496119_0061794 3300048922 Bacteria 2235
287 Ga0496120_0090688 3300048923 Bacteria 1633
288 Ga0496121_0014220 3300048924 Bacteria 8464
289 Ga0496121_0017825 3300048924 Bacteria 7212
290 Ga0496121_0035308 3300048924 Bacteria 4482
291 Ga0496121_0058965 3300048924 Bacteria 3168
292 Ga0496121_0062841 3300048924 Bacteria 3038
293 Ga0496121_0065579 3300048924 Bacteria 2953
294 Ga0496121_0121923 3300048924 Bacteria 1967
295 Ga0496121_0267984 3300048924 Bacteria 1175
296 Ga0496122_0012658 3300048925 Bacteria 8365
297 Ga0496122_0023676 3300048925 Bacteria 5400
298 Ga0496122_0023713 3300048925 Bacteria 5395
299 Ga0496122_0029390 3300048925 Bacteria 4637
300 Ga0496122_0040660 3300048925 Bacteria 3690
301 Ga0496122_0049731 3300048925 Bacteria 3205
302 Ga0496122_0100823 3300048925 Bacteria 1931
303 Ga0496122_0109158 3300048925 Bacteria 1822
304 Ga0496123_0014859 3300048926 Bacteria 6424
305 Ga0496123_0030774 3300048926 Bacteria 3921
306 Ga0496123_0056178 3300048926 Bacteria 2575
307 Ga0496123_0065668 3300048926 Bacteria 2304
308 Ga0496124_0005281 3300048927 Bacteria 14613
309 Ga0496124_0010940 3300048927 Bacteria 9126
310 Ga0496124_0028027 3300048927 Bacteria 5042
311 Ga0496124_0069002 3300048927 Bacteria 2936
312 Ga0496124_0184006 3300048927 Bacteria 1605
313 Ga0496124_0260580 3300048927 Bacteria 1276
314 Ga0496125_0063584 3300048928 Bacteria 2941
315 Ga0496125_0129257 3300048928 Bacteria 1782
316 Ga0496125_0133563 3300048928 Bacteria 1741
317 Ga0496125_0148794 3300048928 Bacteria 1613
318 Ga0496126_0024969 3300048929 Bacteria 5762
319 Ga0496126_0370808 3300048929 Bacteria 1167
320 Ga0496126_0386292 3300048929 Bacteria 1138
321 Ga0495678_007721 3300049459 Bacteria 5543
322 Ga0501032_0029263 3300049569 Bacteria 3782
323 Ga0501038_0100361 3300049574 Bacteria 2412
324 Ga0501043_0038133 3300049579 Bacteria 3779
325 Ga0501043_0101009 3300049579 Bacteria 2267
326 Ga0501046_0381048 3300049580 Bacteria 1021
327 Ga0501067_0096234 3300049583 Bacteria 1644
328 Ga0501080_0160251 3300049742 Bacteria 2078
329 Ga0501083_0061555 3300049744 Bacteria 2505
330 nmdc:mga03n38_29471_c1 3300050490 Bacteria 2297
331 nmdc:mga0yw44_203487_c1 3300050492 Bacteria 1308
332 nmdc:mga0yw44_4559_c1 3300050492 Bacteria 6005
333 nmdc:mga0yw44_5223_c1 3300050492 Bacteria 6089
334 nmdc:mga0yw44_73002_c1 3300050492 Bacteria 2134
335 nmdc:mga06z11_36603_c1 3300050494 Bacteria 2424
336 nmdc:mga06z11_58544_c1 3300050494 Bacteria 1999
337 nmdc:mga07m45_14095_c1 3300050496 Bacteria 4252
338 nmdc:mga07m45_248329_c1 3300050496 Bacteria 1035
339 nmdc:mga07m45_3888_c1 3300050496 Bacteria 7253
340 Ga0500610_0012357 3300053079 Bacteria 3931
341 Ga0500556_0095746 3300053104 Bacteria 1138
342 Ga0500569_006034 3300053109 Bacteria 2637
343 Ga0500594_0001230 3300053118 Bacteria 5534
344 Ga0500658_0037560 3300053134 Bacteria 1927
345 Ga0500658_0156143 3300053134 Bacteria 1031
346 Ga0500559_0114895 3300053136 Bacteria 1249
347 Ga0500568_0001135 3300053139 Bacteria 17879
348 Ga0500568_0002776 3300053139 Bacteria 10130
349 Ga0500604_0004231 3300053151 Bacteria 3813
350 Ga0500616_0004285 3300053153 Bacteria 10246
351 Ga0500616_0028348 3300053153 Bacteria 3086
352 Ga0500620_000239 3300053155 Bacteria 10762
353 Ga0500622_0000322 3300053156 Bacteria 48225
354 Ga0500627_0083830 3300053158 Bacteria 1422
355 Ga0500633_0000482 3300053160 Bacteria 6351
356 Ga0500636_0023901 3300053177 Bacteria 3613
357 Ga0500611_031581 3300053727 Bacteria 1101
358 Ga0501082_0044762 3300060353 Bacteria 3817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958041894 2958056478 233
2 3300006038 Ga0075365_10010767 Ga0075365_100107672 240
3 3300050490 nmdc:mga03n38_29471_c1 nmdc:mga03n38_29471_c1_997_1740 240
4 3300050492 nmdc:mga0yw44_4559_c1 nmdc:mga0yw44_4559_c1_2492_3235 240
5 3300048929 Ga0496126_0386292 Ga0496126_0386292_77_853 258
6 3300046501 Ga0495607_0105654 Ga0495607_0105654_17_814 264
7 3300053727 Ga0500611_031581 Ga0500611_031581_278_1075 264
8 iso_pu_bacteria 2885326080 2885332759 265
9 3300048919 Ga0496116_0027560 Ga0496116_0027560_1125_2018 273
10 3300048920 Ga0496117_0027147 Ga0496117_0027147_269_1162 273
11 3300048921 Ga0496118_0077789 Ga0496118_0077789_1070_1963 273
12 3300048925 Ga0496122_0023713 Ga0496122_0023713_1120_2013 273
13 3300048926 Ga0496123_0056178 Ga0496123_0056178_1124_2017 273
14 3300048927 Ga0496124_0010940 Ga0496124_0010940_4837_5730 273
15 iso_pu_bacteria 2643221653 2644296904 277
16 iso_pu_bacteria 2643221719 2644655158 277
17 3300050496 nmdc:mga07m45_248329_c1 nmdc:mga07m45_248329_c1_18_887 283
18 iso_pu_bacteria 2508501122 2509108452 284
19 iso_pu_bacteria 2558860100 2558863548 284
20 iso_pu_bacteria 2850079185 2850080413 284
21 iso_pu_bacteria 2856356410 2856358839 285
22 iso_pu_bacteria 2871488783 2871494030 285
23 iso_pu_bacteria 2878753008 2878756606 285
24 iso_pu_bacteria 2881155292 2881157547 285
25 iso_pu_bacteria 2881845957 2881847254 285
26 iso_pu_bacteria 2881861095 2881866709 285
27 iso_pu_bacteria 2882912400 2882918856 285
28 iso_pu_bacteria 2885318864 2885322608 285
29 iso_pu_bacteria 2885350715 2885355095 285
30 iso_pu_bacteria 2903492973 2903502466 285
31 iso_pu_bacteria 2924784321 2924788192 285
32 iso_pu_bacteria 2961127735 2961136745 285
33 iso_pu_bacteria 2961170736 2961172896 285
34 iso_pu_bacteria 2967996073 2967998106 285
35 iso_pu_bacteria 2968003550 2968008758 285
36 iso_pu_bacteria 2970503327 2970505490 285
37 iso_pu_bacteria 2977821940 2977825786 285
38 iso_pu_bacteria 2979808191 2979810211 285
39 iso_pu_bacteria 8004374579 8004378194 285
40 iso_pu_bacteria 2508501127 2509141553 286
41 iso_pu_bacteria 2838074704 2838076379 286
42 iso_pu_bacteria 2847686936 2847688141 286
43 iso_pu_bacteria 2869162929 2869168312 286
44 iso_pu_bacteria 2871444079 2871446851 286
45 iso_pu_bacteria 2874123672 2874127660 286
46 iso_pu_bacteria 2876392853 2876399367 286
47 iso_pu_bacteria 2878788777 2878793740 286
48 iso_pu_bacteria 2885334103 2885337556 286
49 iso_pu_bacteria 2896384573 2896386579 286
50 iso_pu_bacteria 2904659560 2904665894 286
51 iso_pu_bacteria 2906328253 2906331308 286
52 iso_pu_bacteria 2922158528 2922161575 286
53 iso_pu_bacteria 2924726620 2924726747 286
54 iso_pu_bacteria 2937836603 2937840742 286
55 iso_pu_bacteria 2937891427 2937896354 286
56 iso_pu_bacteria 2958071322 2958075121 286
57 iso_pu_bacteria 2958115193 2958116895 286
58 iso_pu_bacteria 2961114664 2961121238 286
59 iso_pu_bacteria 2968091066 2968092321 286
60 iso_pu_bacteria 2968097103 2968097631 286
61 iso_pu_bacteria 2968110612 2968117390 286
62 iso_pu_bacteria 2977858184 2977861184 286
63 iso_pu_bacteria 2979779861 2979785633 286
64 iso_pu_bacteria 2996341866 2996343141 286
65 iso_pu_bacteria 8004445564 8004451876 286
66 iso_pu_bacteria 8004633249 8004638273 286
67 iso_pu_bacteria 8004703790 8004710777 286
68 iso_pu_bacteria 8055617313 8055622791 286
69 iso_pu_bacteria 2503198000 2503203394 287
70 iso_pu_bacteria 2599185352 2600191865 287
71 iso_pu_bacteria 2643221557 2643807270 287
72 iso_pu_bacteria 2643221610 2644069463 287
73 iso_pu_bacteria 2643221668 2644380652 287
74 iso_pu_bacteria 2643221675 2644420617 287
75 iso_pu_bacteria 2643221680 2644454142 287
76 iso_pu_bacteria 2643221723 2644675719 287
77 iso_pu_bacteria 2643221726 2644689479 287
78 iso_pu_bacteria 2738543024 2739306548 287
79 iso_pu_bacteria 2856364286 2856364741 287
80 iso_pu_bacteria 2869285874 2869289810 287
81 iso_pu_bacteria 2871429161 2871431931 287
82 iso_pu_bacteria 2871435913 2871439446 287
83 iso_pu_bacteria 2874146452 2874155554 287
84 iso_pu_bacteria 2874155637 2874162411 287
85 iso_pu_bacteria 2876413966 2876420899 287
86 iso_pu_bacteria 2878745973 2878748537 287
87 iso_pu_bacteria 2881147464 2881153764 287
88 iso_pu_bacteria 2885305155 2885311700 287
89 iso_pu_bacteria 2903492973 2903506159 287
90 iso_pu_bacteria 2906308376 2906312099 287
91 iso_pu_bacteria 2906321335 2906323837 287
92 iso_pu_bacteria 2937813078 2937818077 287
93 iso_pu_bacteria 2958130278 2958134182 287
94 iso_pu_bacteria 2958179912 2958183828 287
95 iso_pu_bacteria 2961077736 2961081794 287
96 iso_pu_bacteria 2965062239 2965069939 287
97 iso_pu_bacteria 2968117919 2968118433 287
98 iso_pu_bacteria 2968128360 2968131760 287
99 iso_pu_bacteria 2970524798 2970529624 287
100 iso_pu_bacteria 2977843712 2977851175 287
101 iso_pu_bacteria 8004387939 8004391687 287
102 iso_pu_bacteria 8004640170 8004641293 287
103 iso_pu_bacteria 8004714634 8004717056 287
104 3300021321 Ga0214542_1015605 Ga0214542_10156057 288
105 3300021327 Ga0214543_1000003 Ga0214543_1000003412 288
106 iso_pu_bacteria 2508501123 2509116154 288
107 iso_pu_bacteria 2509276018 2509370118 288
108 iso_pu_bacteria 2509276022 2509397820 288
109 iso_pu_bacteria 2510065059 2510319078 288
110 iso_pu_bacteria 2512875016 2512929725 288
111 iso_pu_bacteria 2512875024 2512964493 288
112 iso_pu_bacteria 2513237164 2514033393 288
113 iso_pu_bacteria 2513237305 2514416713 288
114 iso_pu_bacteria 2588253730 2588515307 288
115 iso_pu_bacteria 2599185301 2599940313 288
116 iso_pu_bacteria 2643221551 2643774870 288
117 iso_pu_bacteria 2643221555 2643793314 288
118 iso_pu_bacteria 2643221595 2643985429 288
119 iso_pu_bacteria 2643221627 2644152125 288
120 iso_pu_bacteria 2687453392 2688600227 288
121 iso_pu_bacteria 2693429783 2694633799 288
122 iso_pu_bacteria 2693429784 2694639861 288
123 iso_pu_bacteria 2721755686 2723577505 288
124 iso_pu_bacteria 2756170246 2756673213 288
125 iso_pu_bacteria 2791355123 2792749211 288
126 iso_pu_bacteria 2844002411 2844005672 288
127 iso_pu_bacteria 2844009547 2844015542 288
128 iso_pu_bacteria 2856320880 2856324308 288
129 iso_pu_bacteria 2856328259 2856328527 288
130 iso_pu_bacteria 2856334872 2856339212 288
131 iso_pu_bacteria 2857349434 2857354984 288
132 iso_pu_bacteria 2857367948 2857375080 288
133 iso_pu_bacteria 2869169390 2869174481 288
134 iso_pu_bacteria 2869234852 2869241846 288
135 iso_pu_bacteria 2869242130 2869246569 288
136 iso_pu_bacteria 2869249662 2869250638 288
137 iso_pu_bacteria 2869256925 2869257569 288
138 iso_pu_bacteria 2869264136 2869264705 288
139 iso_pu_bacteria 2869271264 2869277670 288
140 iso_pu_bacteria 2869278585 2869281694 288
141 iso_pu_bacteria 2871451962 2871454101 288
142 iso_pu_bacteria 2871459585 2871460747 288
143 iso_pu_bacteria 2871466892 2871467971 288
144 iso_pu_bacteria 2871481445 2871483902 288
145 iso_pu_bacteria 2871495908 2871500200 288
146 iso_pu_bacteria 2874109183 2874114657 288
147 iso_pu_bacteria 2874116593 2874120145 288
148 iso_pu_bacteria 2874131515 2874138331 288
149 iso_pu_bacteria 2874139085 2874140641 288
150 iso_pu_bacteria 2874162495 2874165727 288
151 iso_pu_bacteria 2874168670 2874175354 288
152 iso_pu_bacteria 2876363079 2876366712 288
153 iso_pu_bacteria 2876386047 2876390677 288
154 iso_pu_bacteria 2876399893 2876400519 288
155 iso_pu_bacteria 2876406927 2876412361 288
156 iso_pu_bacteria 2876420981 2876427200 288
157 iso_pu_bacteria 2878730984 2878736090 288
158 iso_pu_bacteria 2878738818 2878742423 288
159 iso_pu_bacteria 2878760144 2878764311 288
160 iso_pu_bacteria 2878767105 2878771392 288
161 iso_pu_bacteria 2878774303 2878777193 288
162 iso_pu_bacteria 2878781027 2878787340 288
163 iso_pu_bacteria 2881161766 2881162914 288
164 iso_pu_bacteria 2882632389 2882634479 288
165 iso_pu_bacteria 2888337043 2888341409 288
166 iso_pu_bacteria 2888350351 2888350740 288
167 iso_pu_bacteria 2903448605 2903452888 288
168 iso_pu_bacteria 2903513507 2903520863 288
169 iso_pu_bacteria 2903521522 2903524579 288
170 iso_pu_bacteria 2903528002 2903531178 288
171 iso_pu_bacteria 2903540706 2903545013 288
172 iso_pu_bacteria 2906354277 2906361586 288
173 iso_pu_bacteria 2906363423 2906367589 288
174 iso_pu_bacteria 2906370794 2906372749 288
175 iso_pu_bacteria 2906378014 2906382828 288
176 iso_pu_bacteria 2906386501 2906391558 288
177 iso_pu_bacteria 2906401398 2906404507 288
178 iso_pu_bacteria 2906408224 2906414231 288
179 iso_pu_bacteria 2922130491 2922137917 288
180 iso_pu_bacteria 2922151315 2922157782 288
181 iso_pu_bacteria 2922172374 2922172956 288
182 iso_pu_bacteria 2922178524 2922180649 288
183 iso_pu_bacteria 2922185730 2922193806 288
184 iso_pu_bacteria 2924710171 2924714787 288
185 iso_pu_bacteria 2924718760 2924725865 288
186 iso_pu_bacteria 2924733363 2924740459 288
187 iso_pu_bacteria 2924741084 2924744511 288
188 iso_pu_bacteria 2924748358 2924751571 288
189 iso_pu_bacteria 2924754689 2924754831 288
190 iso_pu_bacteria 2924762789 2924764531 288
191 iso_pu_bacteria 2924776078 2924780223 288
192 iso_pu_bacteria 2937813078 2937813176 288
193 iso_pu_bacteria 2937822353 2937829169 288
194 iso_pu_bacteria 2937848649 2937850765 288
195 iso_pu_bacteria 2937861824 2937865727 288
196 iso_pu_bacteria 2937868953 2937874525 288
197 iso_pu_bacteria 2937877337 2937882743 288
198 iso_pu_bacteria 2937972304 2937973283 288
199 iso_pu_bacteria 2937980651 2937983673 288
200 iso_pu_bacteria 2937994558 2937998860 288
201 iso_pu_bacteria 2941499720 2941500283 288
202 iso_pu_bacteria 2958034702 2958037655 288
203 iso_pu_bacteria 2958041894 2958047366 288
204 iso_pu_bacteria 2958064165 2958066028 288
205 iso_pu_bacteria 2958084443 2958089868 288
206 iso_pu_bacteria 2958092219 2958092443 288
207 iso_pu_bacteria 2958108152 2958109212 288
208 iso_pu_bacteria 2958122699 2958125769 288
209 iso_pu_bacteria 2958137437 2958141745 288
210 iso_pu_bacteria 2958144490 2958146057 288
211 iso_pu_bacteria 2958158011 2958161885 288
212 iso_pu_bacteria 2958165035 2958169335 288
213 iso_pu_bacteria 2961136820 2961142456 288
214 iso_pu_bacteria 2961163497 2961167796 288
215 iso_pu_bacteria 2961183825 2961185400 288
216 iso_pu_bacteria 2963644680 2963649506 288
217 iso_pu_bacteria 2965018300 2965022615 288
218 iso_pu_bacteria 2965025482 2965026148 288
219 iso_pu_bacteria 2965032056 2965037454 288
220 iso_pu_bacteria 2965040258 2965043747 288
221 iso_pu_bacteria 2965047637 2965053031 288
222 iso_pu_bacteria 2965089291 2965093375 288
223 iso_pu_bacteria 2965110997 2965114917 288
224 iso_pu_bacteria 2968016561 2968019510 288
225 iso_pu_bacteria 2968083720 2968084669 288
226 iso_pu_bacteria 2968138860 2968145700 288
227 iso_pu_bacteria 2968171901 2968176196 288
228 iso_pu_bacteria 2970469710 2970472831 288
229 iso_pu_bacteria 2970510686 2970518073 288
230 iso_pu_bacteria 2970532167 2970536431 288
231 iso_pu_bacteria 2970540015 2970540105 288
232 iso_pu_bacteria 2970547951 2970548503 288
233 iso_pu_bacteria 2970554993 2970559155 288
234 iso_pu_bacteria 2970593180 2970596297 288
235 iso_pu_bacteria 2970619444 2970625817 288
236 iso_pu_bacteria 2970627176 2970633012 288
237 iso_pu_bacteria 2977851361 2977852981 288
238 iso_pu_bacteria 2977864932 2977869466 288
239 iso_pu_bacteria 2977872689 2977876186 288
240 iso_pu_bacteria 2977898635 2977905628 288
241 iso_pu_bacteria 2977907340 2977911401 288
242 iso_pu_bacteria 2977915119 2977915896 288
243 iso_pu_bacteria 2977922695 2977926320 288
244 iso_pu_bacteria 2977935797 2977941687 288
245 iso_pu_bacteria 2977942078 2977943956 288
246 iso_pu_bacteria 2977950692 2977957470 288
247 iso_pu_bacteria 2977957713 2977962640 288
248 iso_pu_bacteria 2977971508 2977977842 288
249 iso_pu_bacteria 2979742915 2979749072 288
250 iso_pu_bacteria 2979764755 2979766467 288
251 iso_pu_bacteria 2979772303 2979772439 288
252 iso_pu_bacteria 2979793036 2979795950 288
253 iso_pu_bacteria 2987636660 2987643585 288
254 iso_pu_bacteria 2987645492 2987646352 288
255 iso_pu_bacteria 2987659509 2987663805 288
256 iso_pu_bacteria 2987666974 2987667336 288
257 iso_pu_bacteria 2987673487 2987678929 288
258 iso_pu_bacteria 2996310559 2996313247 288
259 iso_pu_bacteria 2996348954 2996352050 288
260 iso_pu_bacteria 2996386984 2996392070 288
261 iso_pu_bacteria 3000135777 3000141947 288
262 iso_pu_bacteria 3004167301 3004171004 288
263 iso_pu_bacteria 3004188549 3004192861 288
264 iso_pu_bacteria 3004203850 3004207130 288
265 iso_pu_bacteria 3004211236 3004214554 288
266 iso_pu_bacteria 3004218560 3004219236 288
267 iso_pu_bacteria 3004232784 3004238794 288
268 iso_pu_bacteria 3004239961 3004245397 288
269 iso_pu_bacteria 3004248173 3004250468 288
270 iso_pu_bacteria 3004275668 3004278748 288
271 iso_pu_bacteria 3004334049 3004339304 288
272 iso_pu_bacteria 637000159 637079469 288
273 iso_pu_bacteria 649633066 649874699 288
274 iso_pu_bacteria 8004300914 8004303997 288
275 iso_pu_bacteria 8004312739 8004316497 288
276 iso_pu_bacteria 8004361976 8004364059 288
277 iso_pu_bacteria 8004395343 8004401549 288
278 iso_pu_bacteria 8004695233 8004701721 288
279 iso_pu_bacteria 8004727605 8004731496 288
280 3300002705 JGI25156J39149_1005640 JGI25156J39149_10056403 289
281 3300002741 JGI25157J39369_1002576 JGI25157J39369_10025762 289
282 3300025250 Ga0209026_1000215 Ga0209026_100021578 289
283 3300025256 Ga0209759_1000478 Ga0209759_10004783 289
284 iso_pu_bacteria 2643221637 2644206285 289
285 iso_pu_bacteria 2643221718 2644649933 289
286 iso_pu_bacteria 2899803654 2899803712 289
287 iso_pu_bacteria 2920760137 2920762935 289
288 iso_pu_bacteria 2977986579 2977990961 289
289 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028331 290
290 3300025261 Ga0209233_1000087 Ga0209233_1000087336 290
291 3300027866 Ga0209813_10004363 Ga0209813_100043632 290
292 3300037418 Ga0395900_0093396 Ga0395900_0093396_557_1450 290
293 3300048922 Ga0496119_0061794 Ga0496119_0061794_1252_2139 290
294 3300048923 Ga0496120_0090688 Ga0496120_0090688_522_1409 290
295 iso_pu_bacteria 2513237090 2513608364 290
296 iso_pu_bacteria 2513237144 2513907584 290
297 iso_pu_bacteria 2643221550 2643774025 290
298 iso_pu_bacteria 2643221564 2643838706 290
299 iso_pu_bacteria 2847670302 2847671914 290
300 iso_pu_bacteria 2856314179 2856318356 290
301 iso_pu_bacteria 2878035449 2878037692 290
302 iso_pu_bacteria 2906414383 2906418393 290
303 iso_pu_bacteria 2996887358 2996891517 290
304 iso_pu_bacteria 3005416602 3005417081 290
305 iso_pu_bacteria 8005314921 8005315142 290
306 iso_pu_bacteria 8005321885 8005326044 290
307 3300002987 JGI25159J45721_1000366 JGI25159J45721_10003661 291
308 3300003354 JGI25160J50197_1000562 JGI25160J50197_100056220 291
309 3300003374 JGI25161J50226_1000436 JGI25161J50226_100043618 291
310 3300003771 Ga0055526_1006191 Ga0055526_10061915 291
311 3300003775 Ga0055524_1003634 Ga0055524_10036347 291
312 3300003781 Ga0055536_1002650 Ga0055536_10026501 291
313 3300003791 Ga0055530_10021270 Ga0055530_100212702 291
314 3300003794 Ga0055531_10002936 Ga0055531_1000293611 291
315 3300004625 Ga0055543_1003083 Ga0055543_10030834 291
316 3300005262 Ga0065165_1001769 Ga0065165_10017692 291
317 3300009545 Ga0105237_10454368 Ga0105237_104543681 291
318 3300010375 Ga0105239_10738495 Ga0105239_107384951 291
319 3300013249 Ga0171463_1001 Ga0171463_1001291 291
320 3300015690 Ga0183363_1105 Ga0183363_110513 291
321 3300025208 Ga0209436_101612 Ga0209436_1016122 291
322 3300025284 Ga0209130_1000007 Ga0209130_10000072 291
323 3300025292 Ga0209676_1000901 Ga0209676_10009014 291
324 3300025294 Ga0209025_1000100 Ga0209025_1000100147 291
325 3300025294 Ga0209025_1046789 Ga0209025_10467892 291
326 3300025295 Ga0209564_1000846 Ga0209564_100084620 291
327 3300025297 Ga0209758_1004084 Ga0209758_100408411 291
328 3300025297 Ga0209758_1050709 Ga0209758_10507091 291
329 3300025298 Ga0209050_1011597 Ga0209050_10115974 291
330 3300025299 Ga0209256_1001394 Ga0209256_10013944 291
331 3300025299 Ga0209256_1011899 Ga0209256_10118993 291
332 3300025302 Ga0207426_1000064 Ga0207426_10000642 291
333 3300025303 Ga0209051_1001024 Ga0209051_100102426 291
334 3300025304 Ga0209257_1001970 Ga0209257_10019702 291
335 3300025904 Ga0207647_10017567 Ga0207647_100175676 291
336 3300037418 Ga0395900_0081127 Ga0395900_0081127_2446_3321 291
337 3300037418 Ga0395900_0429166 Ga0395900_0429166_215_1102 291
338 3300037466 Ga0395898_0304001 Ga0395898_0304001_461_1348 291
339 3300037471 Ga0395905_0101304 Ga0395905_0101304_582_1457 291
340 3300044901 Ga0466960_0121661 Ga0466960_0121661_40_930 291
341 3300049574 Ga0501038_0100361 Ga0501038_0100361_498_1373 291
342 3300049579 Ga0501043_0101009 Ga0501043_0101009_1223_2098 291
343 iso_pu_bacteria 2510917028 2511182798 291
344 iso_pu_bacteria 2513237088 2513596188 291
345 iso_pu_bacteria 2513237138 2513865681 291
346 iso_pu_bacteria 2524023209 2524460712 291
347 iso_pu_bacteria 2582581294 2585203018 291
348 iso_pu_bacteria 2582581867 2585400187 291
349 iso_pu_bacteria 2585427590 2585822746 291
350 iso_pu_bacteria 2791355261 2793327190 291
351 iso_pu_bacteria 2842298080 2842302516 291
352 iso_pu_bacteria 2842357229 2842360751 291
353 iso_pu_bacteria 2923556063 2923557632 291
354 iso_pu_bacteria 8002285264 8002287899 291
355 iso_pu_bacteria 8005395548 8005399409 291
356 iso_pu_bacteria 8046767195 8046767616 291
357 3300003316 rootH1_10140486 rootH1_101404862 292
358 3300005356 Ga0070674_100432138 Ga0070674_1004321381 292
359 3300005548 Ga0070665_100075149 Ga0070665_1000751492 292
360 3300005563 Ga0068855_100287973 Ga0068855_1002879731 292
361 3300006038 Ga0075365_10014694 Ga0075365_100146943 292
362 3300006038 Ga0075365_10049094 Ga0075365_100490943 292
363 3300006038 Ga0075365_10128827 Ga0075365_101288271 292
364 3300006042 Ga0075368_10004539 Ga0075368_100045393 292
365 3300006048 Ga0075363_100011877 Ga0075363_1000118773 292
366 3300006177 Ga0075362_10051080 Ga0075362_100510801 292
367 3300006178 Ga0075367_10073067 Ga0075367_100730672 292
368 3300006178 Ga0075367_10144528 Ga0075367_101445282 292
369 3300006353 Ga0075370_10030460 Ga0075370_100304602 292
370 3300006353 Ga0075370_10182248 Ga0075370_101822482 292
371 3300009093 Ga0105240_10138698 Ga0105240_101386982 292
372 3300009098 Ga0105245_10188214 Ga0105245_101882142 292
373 3300009174 Ga0105241_10166716 Ga0105241_101667161 292
374 3300009177 Ga0105248_10301454 Ga0105248_103014541 292
375 3300009545 Ga0105237_10545123 Ga0105237_105451231 292
376 3300009551 Ga0105238_10156424 Ga0105238_101564241 292
377 3300009551 Ga0105238_10277042 Ga0105238_102770422 292
378 3300010375 Ga0105239_10387576 Ga0105239_103875761 292
379 3300010375 Ga0105239_10543034 Ga0105239_105430342 292
380 3300013296 Ga0157374_10056724 Ga0157374_100567243 292
381 3300014325 Ga0163163_10110128 Ga0163163_101101282 292
382 3300025913 Ga0207695_10161872 Ga0207695_101618722 292
383 3300025914 Ga0207671_10274449 Ga0207671_102744491 292
384 3300026041 Ga0207639_10298788 Ga0207639_102987882 292
385 3300026142 Ga0207698_10206263 Ga0207698_102062632 292
386 3300038443 Ga0395901_0221882 Ga0395901_0221882_290_1186 292
387 3300041498 Ga0451841_0200955 Ga0451841_0200955_590_1489 292
388 3300046522 Ga0495643_0065944 Ga0495643_0065944_177_1076 292
389 3300046616 Ga0495668_0112391 Ga0495668_0112391_79_978 292
390 3300048912 Ga0496109_0607763 Ga0496109_0607763_91_984 292
391 3300048915 Ga0496112_0165301 Ga0496112_0165301_406_1290 292
392 3300048929 Ga0496126_0024969 Ga0496126_0024969_4762_5661 292
393 3300050492 nmdc:mga0yw44_73002_c1 nmdc:mga0yw44_73002_c1_651_1547 292
394 3300050494 nmdc:mga06z11_58544_c1 nmdc:mga06z11_58544_c1_508_1407 292
395 3300050496 nmdc:mga07m45_14095_c1 nmdc:mga07m45_14095_c1_1702_2601 292
396 3300053134 Ga0500658_0156143 Ga0500658_0156143_25_915 292
397 3300053153 Ga0500616_0028348 Ga0500616_0028348_1902_2798 292
398 3300053155 Ga0500620_000239 Ga0500620_000239_1842_2735 292
399 3300053158 Ga0500627_0083830 Ga0500627_0083830_486_1376 292
400 iso_pu_bacteria 2510917030 2511197195 292
401 iso_pu_bacteria 2582581298 2585220932 292
402 iso_pu_bacteria 2582581299 2585231555 292
403 iso_pu_bacteria 2585427529 2585549968 292
404 iso_pu_bacteria 2643221618 2644109061 292
405 iso_pu_bacteria 2643221626 2644151583 292
406 iso_pu_bacteria 2643221634 2644196454 292
407 iso_pu_bacteria 2643221655 2644311717 292
408 iso_pu_bacteria 2643221659 2644329974 292
409 iso_pu_bacteria 2643221698 2644546648 292
410 iso_pu_bacteria 2643221712 2644617516 292
411 iso_pu_bacteria 2842509118 2842509664 292
412 iso_pu_bacteria 2844163670 2844168585 292
413 iso_pu_bacteria 2919100787 2919103770 292
414 iso_pu_bacteria 3005445848 3005446700 292
415 iso_pu_bacteria 8005258706 8005261743 292
416 3300003762 Ga0055542_1001866 Ga0055542_10018663 293
417 3300025254 Ga0209148_1000056 Ga0209148_1000056136 293
418 3300025272 Ga0209455_1000137 Ga0209455_100013731 293
419 iso_pu_bacteria 2509276033 2509443136 293
420 iso_pu_bacteria 2510065019 2510132242 293
421 iso_pu_bacteria 2510917022 2511133548 293
422 iso_pu_bacteria 2515154113 2515635987 293
423 iso_pu_bacteria 2515154114 2515642639 293
424 iso_pu_bacteria 2516143018 2516208820 293
425 iso_pu_bacteria 2517093000 2517093998 293
426 iso_pu_bacteria 2517287029 2517405812 293
427 iso_pu_bacteria 2582581307 2585273318 293
428 iso_pu_bacteria 2582581308 2585278846 293
429 iso_pu_bacteria 2582581315 2585325540 293
430 iso_pu_bacteria 2582581316 2585329694 293
431 iso_pu_bacteria 2585427527 2585530644 293
432 iso_pu_bacteria 2585427528 2585541490 293
433 iso_pu_bacteria 2585427530 2585554824 293
434 iso_pu_bacteria 2585427531 2585559382 293
435 iso_pu_bacteria 2585427593 2585839377 293
436 iso_pu_bacteria 2585427594 2585847277 293
437 iso_pu_bacteria 2585427608 2585902052 293
438 iso_pu_bacteria 2585427609 2585905242 293
439 iso_pu_bacteria 2585428125 2587979643 293
440 iso_pu_bacteria 2615840626 2616305880 293
441 iso_pu_bacteria 2615840698 2616553878 293
442 iso_pu_bacteria 2617270742 2617383802 293
443 iso_pu_bacteria 2643221599 2644007863 293
444 iso_pu_bacteria 2667528174 2671115372 293
445 iso_pu_bacteria 2718218199 2720490975 293
446 iso_pu_bacteria 2718218233 2720619175 293
447 iso_pu_bacteria 2718218235 2720630577 293
448 iso_pu_bacteria 2718218269 2720774270 293
449 iso_pu_bacteria 2721755684 2723559541 293
450 iso_pu_bacteria 2721755685 2723566158 293
451 iso_pu_bacteria 2721755819 2724088877 293
452 iso_pu_bacteria 2721755822 2724103423 293
453 iso_pu_bacteria 2724679232 2725948426 293
454 iso_pu_bacteria 2738541293 2738802103 293
455 iso_pu_bacteria 2738541333 2739035838 293
456 iso_pu_bacteria 2775507266 2778177402 293
457 iso_pu_bacteria 2791355259 2793317466 293
458 iso_pu_bacteria 2802429633 2806046983 293
459 iso_pu_bacteria 2802429634 2806052566 293
460 iso_pu_bacteria 2802429635 2806058663 293
461 iso_pu_bacteria 2802429636 2806067569 293
462 iso_pu_bacteria 2802429637 2806073922 293
463 iso_pu_bacteria 2818991448 2819612271 293
464 iso_pu_bacteria 2818991453 2819639309 293
465 iso_pu_bacteria 2838029111 2838031357 293
466 iso_pu_bacteria 2838042994 2838048049 293
467 iso_pu_bacteria 2838068647 2838074088 293
468 iso_pu_bacteria 2842422224 2842427294 293
469 iso_pu_bacteria 2842475841 2842478048 293
470 iso_pu_bacteria 2842502639 2842504857 293
471 iso_pu_bacteria 2852387548 2852389007 293
472 iso_pu_bacteria 2919408235 2919409243 293
473 iso_pu_bacteria 2933599457 2933604543 293
474 iso_pu_bacteria 3005452660 3005453383 293
475 iso_pu_bacteria 8005282627 8005284843 293
476 iso_pu_bacteria 8005382845 8005386063 293
477 iso_pu_bacteria 8005484373 8005485689 293
478 iso_pu_bacteria 8005497431 8005499270 293
479 iso_pu_bacteria 8005563573 8005570379 293
480 iso_pu_bacteria 8005570704 8005572623 293
481 iso_pu_bacteria 8005626139 8005627569 293
482 iso_pu_bacteria 8005645114 8005648292 293
483 iso_pu_bacteria 8005668836 8005670686 293
484 iso_pu_bacteria 8005682033 8005684635 293
485 iso_pu_bacteria 8024486573 8024489809 293
486 iso_pu_bacteria 8054558443 8054562223 293
487 iso_pu_bacteria 8057575449 8057582263 293
488 3300005355 Ga0070671_100047939 Ga0070671_1000479391 294
489 3300005618 Ga0068864_100272324 Ga0068864_1002723241 294
490 3300025297 Ga0209758_1031398 Ga0209758_10313982 294
491 3300025299 Ga0209256_1014300 Ga0209256_10143002 294
492 3300025303 Ga0209051_1024882 Ga0209051_10248822 294
493 3300026095 Ga0207676_10374508 Ga0207676_103745082 294
494 3300028379 Ga0268266_10024031 Ga0268266_100240311 294
495 3300046460 Ga0495638_0000353 Ga0495638_0000353_47007_47894 294
496 3300046474 Ga0495605_0003774 Ga0495605_0003774_2257_3144 294
497 3300046492 Ga0495585_0019942 Ga0495585_0019942_682_1569 294
498 3300046506 Ga0495583_0031985 Ga0495583_0031985_1509_2396 294
499 3300046515 Ga0495620_0123226 Ga0495620_0123226_50_937 294
500 3300046518 Ga0495631_0001310 Ga0495631_0001310_8393_9280 294
501 3300046519 Ga0495632_0017060 Ga0495632_0017060_568_1455 294
502 3300046522 Ga0495643_0166634 Ga0495643_0166634_24_911 294
503 3300046530 Ga0495654_0060473 Ga0495654_0060473_33_920 294
504 3300046538 Ga0495609_0041858 Ga0495609_0041858_724_1611 294
505 3300046616 Ga0495668_0006786 Ga0495668_0006786_809_1696 294
506 3300046648 Ga0495611_0007455 Ga0495611_0007455_625_1512 294
507 3300046660 Ga0495625_0002820 Ga0495625_0002820_7349_8236 294
508 3300046810 Ga0495660_0027516 Ga0495660_0027516_1686_2573 294
509 3300048924 Ga0496121_0058965 Ga0496121_0058965_2071_2964 294
510 3300048924 Ga0496121_0062841 Ga0496121_0062841_1957_2844 294
511 3300048924 Ga0496121_0065579 Ga0496121_0065579_925_1818 294
512 3300048924 Ga0496121_0121923 Ga0496121_0121923_737_1630 294
513 3300048925 Ga0496122_0040660 Ga0496122_0040660_1771_2658 294
514 3300048927 Ga0496124_0260580 Ga0496124_0260580_223_1110 294
515 3300048929 Ga0496126_0370808 Ga0496126_0370808_53_946 294
516 3300049459 Ga0495678_007721 Ga0495678_007721_2479_3366 294
517 3300049583 Ga0501067_0096234 Ga0501067_0096234_136_1029 294
518 3300049742 Ga0501080_0160251 Ga0501080_0160251_1066_1986 294
519 3300050492 nmdc:mga0yw44_203487_c1 nmdc:mga0yw44_203487_c1_71_985 294
520 3300053079 Ga0500610_0012357 Ga0500610_0012357_1306_2193 294
521 3300053109 Ga0500569_006034 Ga0500569_006034_966_1853 294
522 3300053118 Ga0500594_0001230 Ga0500594_0001230_2471_3358 294
523 3300053139 Ga0500568_0001135 Ga0500568_0001135_6992_7879 294
524 3300053153 Ga0500616_0004285 Ga0500616_0004285_7413_8300 294
525 iso_pu_bacteria 2970489779 2970494848 294
526 iso_pu_bacteria 3004195979 3004200968 294
527 iso_pu_bacteria 3004268573 3004273462 294
528 3300003771 Ga0055526_1012450 Ga0055526_10124502 295
529 3300003771 Ga0055526_1015046 Ga0055526_10150462 295
530 3300003771 Ga0055526_1017752 Ga0055526_10177522 295
531 3300003775 Ga0055524_1014863 Ga0055524_10148632 295
532 3300003775 Ga0055524_1029406 Ga0055524_10294061 295
533 3300003790 Ga0055528_1012483 Ga0055528_10124832 295
534 3300003790 Ga0055528_1014909 Ga0055528_10149092 295
535 3300006178 Ga0075367_10137074 Ga0075367_101370742 295
536 3300009011 Ga0105251_10038788 Ga0105251_100387882 295
537 3300025258 Ga0209129_1001497 Ga0209129_10014972 295
538 3300025273 Ga0209673_1014911 Ga0209673_10149112 295
539 3300025273 Ga0209673_1016552 Ga0209673_10165522 295
540 3300025295 Ga0209564_1003779 Ga0209564_10037793 295
541 3300025299 Ga0209256_1003709 Ga0209256_100370916 295
542 3300025299 Ga0209256_1016350 Ga0209256_10163502 295
543 3300025302 Ga0207426_1001649 Ga0207426_100164918 295
544 3300048913 Ga0496110_0062655 Ga0496110_0062655_1033_1920 295
545 3300048922 Ga0496119_0032098 Ga0496119_0032098_1935_2822 295
546 3300048925 Ga0496122_0109158 Ga0496122_0109158_31_918 295
547 3300048928 Ga0496125_0063584 Ga0496125_0063584_1895_2782 295
548 iso_pu_bacteria 2509276019 2509374521 295
549 3300002739 JGI25158J39367_1000020 JGI25158J39367_100002040 296
550 3300002773 JGI25152J39213_1007215 JGI25152J39213_10072152 296
551 3300002773 JGI25152J39213_1008600 JGI25152J39213_10086002 296
552 3300002773 JGI25152J39213_1011904 JGI25152J39213_10119041 296
553 3300002774 JGI25150J39212_1008997 JGI25150J39212_10089972 296
554 3300002987 JGI25159J45721_1000852 JGI25159J45721_10008527 296
555 3300003215 JGI25153J46596_10013155 JGI25153J46596_100131552 296
556 3300003215 JGI25153J46596_10016288 JGI25153J46596_100162882 296
557 3300003215 JGI25153J46596_10016851 JGI25153J46596_100168512 296
558 3300003354 JGI25160J50197_1019106 JGI25160J50197_10191061 296
559 3300003374 JGI25161J50226_1000133 JGI25161J50226_100013310 296
560 3300003771 Ga0055526_1004479 Ga0055526_10044799 296
561 3300003775 Ga0055524_1025780 Ga0055524_10257802 296
562 3300003790 Ga0055528_1032741 Ga0055528_10327411 296
563 3300003792 Ga0055540_1013426 Ga0055540_10134262 296
564 3300004625 Ga0055543_1000048 Ga0055543_100004858 296
565 3300005262 Ga0065165_1021795 Ga0065165_10217952 296
566 3300005262 Ga0065165_1041868 Ga0065165_10418681 296
567 3300025208 Ga0209436_100064 Ga0209436_10006452 296
568 3300025245 Ga0207425_1007174 Ga0207425_10071742 296
569 3300025258 Ga0209129_1003220 Ga0209129_10032206 296
570 3300025258 Ga0209129_1004442 Ga0209129_10044423 296
571 3300025258 Ga0209129_1004700 Ga0209129_10047002 296
572 3300025284 Ga0209130_1000006 Ga0209130_1000006594 296
573 3300025294 Ga0209025_1019927 Ga0209025_10199275 296
574 3300025294 Ga0209025_1030374 Ga0209025_10303742 296
575 3300025295 Ga0209564_1000399 Ga0209564_100039942 296
576 3300025297 Ga0209758_1006944 Ga0209758_10069446 296
577 3300025297 Ga0209758_1007760 Ga0209758_10077607 296
578 3300025297 Ga0209758_1021891 Ga0209758_10218912 296
579 3300025299 Ga0209256_1010196 Ga0209256_10101962 296
580 3300025302 Ga0207426_1000106 Ga0207426_1000106171 296
581 3300025302 Ga0207426_1056558 Ga0207426_10565581 296
582 3300025303 Ga0209051_1004341 Ga0209051_10043417 296
583 3300025303 Ga0209051_1034527 Ga0209051_10345272 296
584 3300028794 Ga0307515_10000115 Ga0307515_10000115190 296
585 3300031456 Ga0307513_10001304 Ga0307513_1000130426 296
586 3300041413 Ga0439465_0015978 Ga0439465_0015978_1260_2153 296
587 3300046506 Ga0495583_0008919 Ga0495583_0008919_1068_1958 296
588 3300046512 Ga0495610_0038962 Ga0495610_0038962_1047_1940 296
589 3300046522 Ga0495643_0024313 Ga0495643_0024313_20_913 296
590 3300046660 Ga0495625_0117413 Ga0495625_0117413_630_1520 296
591 3300046694 Ga0495649_0016969 Ga0495649_0016969_2442_3335 296
592 3300047470 Ga0495681_0115214 Ga0495681_0115214_44_934 296
593 3300048909 Ga0496106_0000154 Ga0496106_0000154_42745_43638 296
594 3300048925 Ga0496122_0029390 Ga0496122_0029390_3412_4305 296
595 3300048927 Ga0496124_0069002 Ga0496124_0069002_1028_1918 296
596 3300048927 Ga0496124_0184006 Ga0496124_0184006_454_1347 296
597 3300049569 Ga0501032_0029263 Ga0501032_0029263_2702_3595 296
598 3300049579 Ga0501043_0038133 Ga0501043_0038133_216_1109 296
599 3300049580 Ga0501046_0381048 Ga0501046_0381048_62_955 296
600 3300049744 Ga0501083_0061555 Ga0501083_0061555_813_1706 296
601 3300053134 Ga0500658_0037560 Ga0500658_0037560_310_1203 296
602 3300053139 Ga0500568_0002776 Ga0500568_0002776_2584_3477 296
603 3300053151 Ga0500604_0004231 Ga0500604_0004231_1845_2738 296
604 3300053156 Ga0500622_0000322 Ga0500622_0000322_7596_8489 296
605 3300053160 Ga0500633_0000482 Ga0500633_0000482_3265_4158 296
606 3300060353 Ga0501082_0044762 Ga0501082_0044762_2453_3346 296
607 3300001979 JGI24740J21852_10001504 JGI24740J21852_100015045 297
608 3300002704 JGI25155J39150_1000783 JGI25155J39150_10007832 297
609 3300002705 JGI25156J39149_1000086 JGI25156J39149_10000864 297
610 3300002737 JGI25162J39368_1002183 JGI25162J39368_10021833 297
611 3300002737 JGI25162J39368_1003329 JGI25162J39368_10033294 297
612 3300002738 JGI25154J39366_1002301 JGI25154J39366_10023012 297
613 3300002741 JGI25157J39369_1000113 JGI25157J39369_10001134 297
614 3300002773 JGI25152J39213_1000386 JGI25152J39213_100038630 297
615 3300002774 JGI25150J39212_1000031 JGI25150J39212_100003160 297
616 3300002987 JGI25159J45721_1000064 JGI25159J45721_10000642 297
617 3300003187 JGI25151J46595_10000062 JGI25151J46595_1000006264 297
618 3300003187 JGI25151J46595_10006482 JGI25151J46595_100064822 297
619 3300003214 JGI25165J46597_1001952 JGI25165J46597_10019523 297
620 3300003316 rootH1_10047669 rootH1_100476692 297
621 3300003320 rootH2_10052272 rootH2_100522722 297
622 3300003322 rootL2_10018429 rootL2_100184298 297
623 3300003354 JGI25160J50197_1000052 JGI25160J50197_100005260 297
624 3300003354 JGI25160J50197_1000754 JGI25160J50197_100075412 297
625 3300003374 JGI25161J50226_1000073 JGI25161J50226_100007319 297
626 3300003374 JGI25161J50226_1000113 JGI25161J50226_10001134 297
627 3300003374 JGI25161J50226_1002541 JGI25161J50226_10025412 297
628 3300003771 Ga0055526_1006605 Ga0055526_10066054 297
629 3300003775 Ga0055524_1005715 Ga0055524_10057152 297
630 3300003790 Ga0055528_1009273 Ga0055528_10092732 297
631 3300004625 Ga0055543_1000035 Ga0055543_100003561 297
632 3300004625 Ga0055543_1000656 Ga0055543_100065612 297
633 3300005262 Ga0065165_1000253 Ga0065165_100025334 297
634 3300005262 Ga0065165_1002851 Ga0065165_10028516 297
635 3300005563 Ga0068855_100104707 Ga0068855_1001047072 297
636 3300005614 Ga0068856_100066467 Ga0068856_1000664672 297
637 3300005616 Ga0068852_100157202 Ga0068852_1001572022 297
638 3300006038 Ga0075365_10024064 Ga0075365_100240645 297
639 3300006042 Ga0075368_10141405 Ga0075368_101414051 297
640 3300006177 Ga0075362_10012548 Ga0075362_100125482 297
641 3300006178 Ga0075367_10029148 Ga0075367_100291482 297
642 3300006353 Ga0075370_10001714 Ga0075370_100017142 297
643 3300009093 Ga0105240_10000032 Ga0105240_10000032276 297
644 3300009545 Ga0105237_10001967 Ga0105237_1000196726 297
645 3300009765 Ga0123341_1000048 Ga0123341_100004841 297
646 3300009766 Ga0123342_1021801 Ga0123342_10218013 297
647 3300010375 Ga0105239_10005020 Ga0105239_1000502015 297
648 3300013104 Ga0157370_10021519 Ga0157370_100215191 297
649 3300013105 Ga0157369_10113223 Ga0157369_101132232 297
650 3300013306 Ga0163162_10136183 Ga0163162_101361832 297
651 3300015265 Ga0182005_1002238 Ga0182005_10022387 297
652 3300025206 Ga0209435_100036 Ga0209435_100036121 297
653 3300025233 Ga0209437_100075 Ga0209437_100075296 297
654 3300025245 Ga0207425_1000031 Ga0207425_1000031180 297
655 3300025246 Ga0209646_1000132 Ga0209646_1000132121 297
656 3300025250 Ga0209026_1000236 Ga0209026_100023658 297
657 3300025253 Ga0209677_103446 Ga0209677_1034463 297
658 3300025256 Ga0209759_1000269 Ga0209759_100026958 297
659 3300025258 Ga0209129_1000053 Ga0209129_1000053181 297
660 3300025258 Ga0209129_1002483 Ga0209129_10024837 297
661 3300025261 Ga0209233_1000056 Ga0209233_1000056120 297
662 3300025261 Ga0209233_1000209 Ga0209233_10002093 297
663 3300025273 Ga0209673_1000254 Ga0209673_100025454 297
664 3300025273 Ga0209673_1000946 Ga0209673_100094641 297
665 3300025273 Ga0209673_1008306 Ga0209673_10083064 297
666 3300025284 Ga0209130_1000018 Ga0209130_1000018330 297
667 3300025284 Ga0209130_1011860 Ga0209130_10118602 297
668 3300025294 Ga0209025_1000087 Ga0209025_1000087180 297
669 3300025294 Ga0209025_1000284 Ga0209025_100028467 297
670 3300025295 Ga0209564_1000233 Ga0209564_100023351 297
671 3300025295 Ga0209564_1002858 Ga0209564_100285811 297
672 3300025297 Ga0209758_1000081 Ga0209758_1000081180 297
673 3300025297 Ga0209758_1000420 Ga0209758_10004206 297
674 3300025299 Ga0209256_1001151 Ga0209256_10011519 297
675 3300025299 Ga0209256_1005237 Ga0209256_10052372 297
676 3300025302 Ga0207426_1000044 Ga0207426_100004459 297
677 3300025302 Ga0207426_1000265 Ga0207426_100026557 297
678 3300025303 Ga0209051_1023343 Ga0209051_10233432 297
679 3300025913 Ga0207695_10000024 Ga0207695_10000024277 297
680 3300025914 Ga0207671_10000548 Ga0207671_1000054852 297
681 3300026078 Ga0207702_10117701 Ga0207702_101177012 297
682 3300026142 Ga0207698_10108767 Ga0207698_101087672 297
683 3300027312 Ga0209371_1005193 Ga0209371_10051932 297
684 3300028794 Ga0307515_10024373 Ga0307515_100243738 297
685 3300030500 Ga0268256_1001181 Ga0268256_100118118 297
686 3300031731 Ga0307405_10000891 Ga0307405_1000089111 297
687 3300041413 Ga0439465_0002776 Ga0439465_0002776_4397_5290 297
688 3300041458 Ga0451798_1070384 Ga0451798_1070384_22_918 297
689 3300041511 Ga0451855_1064790 Ga0451855_1064790_1033_1929 297
690 3300041512 Ga0451853_1815229 Ga0451853_1815229_232_1128 297
691 3300044694 Ga0466963_0179605 Ga0466963_0179605_344_1249 297
692 3300044765 Ga0466970_0019242 Ga0466970_0019242_360_1265 297
693 3300046459 Ga0495629_0028393 Ga0495629_0028393_2778_3671 297
694 3300046507 Ga0495606_0031650 Ga0495606_0031650_119_1012 297
695 3300046519 Ga0495632_0006839 Ga0495632_0006839_1200_2093 297
696 3300046536 Ga0495587_0029550 Ga0495587_0029550_2130_3023 297
697 3300046642 Ga0495634_0111012 Ga0495634_0111012_538_1431 297
698 3300046660 Ga0495625_0217542 Ga0495625_0217542_105_998 297
699 3300046680 Ga0495646_0192113 Ga0495646_0192113_184_1077 297
700 3300046683 Ga0495658_0043521 Ga0495658_0043521_972_1865 297
701 3300047317 Ga0495604_0076180 Ga0495604_0076180_412_1305 297
702 3300047443 Ga0495687_054618 Ga0495687_054618_410_1303 297
703 3300047472 Ga0495686_0003601 Ga0495686_0003601_3696_4592 297
704 3300048903 Ga0496100_0149605 Ga0496100_0149605_377_1270 297
705 3300048904 Ga0496101_0182828 Ga0496101_0182828_429_1322 297
706 3300048904 Ga0496101_0469408 Ga0496101_0469408_53_946 297
707 3300048905 Ga0496102_0014203 Ga0496102_0014203_2505_3398 297
708 3300048906 Ga0496103_0022193 Ga0496103_0022193_2465_3358 297
709 3300048919 Ga0496116_0002110 Ga0496116_0002110_4482_5375 297
710 3300048919 Ga0496116_0046777 Ga0496116_0046777_1113_2006 297
711 3300048919 Ga0496116_0074716 Ga0496116_0074716_988_1881 297
712 3300048919 Ga0496116_0084851 Ga0496116_0084851_607_1500 297
713 3300048919 Ga0496116_0216606 Ga0496116_0216606_47_940 297
714 3300048920 Ga0496117_0002153 Ga0496117_0002153_2820_3713 297
715 3300048920 Ga0496117_0023629 Ga0496117_0023629_480_1373 297
716 3300048921 Ga0496118_0000695 Ga0496118_0000695_14605_15498 297
717 3300048921 Ga0496118_0050979 Ga0496118_0050979_1344_2237 297
718 3300048922 Ga0496119_0011122 Ga0496119_0011122_1062_1955 297
719 3300048922 Ga0496119_0018267 Ga0496119_0018267_1855_2748 297
720 3300048922 Ga0496119_0042811 Ga0496119_0042811_106_999 297
721 3300048924 Ga0496121_0014220 Ga0496121_0014220_5608_6501 297
722 3300048924 Ga0496121_0017825 Ga0496121_0017825_4360_5253 297
723 3300048924 Ga0496121_0035308 Ga0496121_0035308_3376_4269 297
724 3300048924 Ga0496121_0267984 Ga0496121_0267984_14_907 297
725 3300048925 Ga0496122_0012658 Ga0496122_0012658_5428_6321 297
726 3300048925 Ga0496122_0023676 Ga0496122_0023676_1122_2015 297
727 3300048925 Ga0496122_0049731 Ga0496122_0049731_2238_3146 297
728 3300048925 Ga0496122_0100823 Ga0496122_0100823_597_1490 297
729 3300048926 Ga0496123_0014859 Ga0496123_0014859_1272_2165 297
730 3300048926 Ga0496123_0030774 Ga0496123_0030774_1761_2654 297
731 3300048926 Ga0496123_0065668 Ga0496123_0065668_361_1269 297
732 3300048927 Ga0496124_0005281 Ga0496124_0005281_12599_13492 297
733 3300048927 Ga0496124_0028027 Ga0496124_0028027_1684_2577 297
734 3300048928 Ga0496125_0129257 Ga0496125_0129257_12_905 297
735 3300048928 Ga0496125_0133563 Ga0496125_0133563_452_1345 297
736 3300048928 Ga0496125_0148794 Ga0496125_0148794_266_1159 297
737 3300050492 nmdc:mga0yw44_5223_c1 nmdc:mga0yw44_5223_c1_2581_3477 297
738 3300050494 nmdc:mga06z11_36603_c1 nmdc:mga06z11_36603_c1_1036_1932 297
739 3300050496 nmdc:mga07m45_3888_c1 nmdc:mga07m45_3888_c1_3501_4397 297
740 3300053104 Ga0500556_0095746 Ga0500556_0095746_32_925 297
741 3300053136 Ga0500559_0114895 Ga0500559_0114895_235_1128 297
742 3300053177 Ga0500636_0023901 Ga0500636_0023901_426_1319 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

33

277

0.74

PF12146

Hydrolase_4

Serine aminopeptidase, S33

29

273

0.74

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

35

289

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9094 7 297
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9001 7 297
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8973 7 139
4ose-assembly1.cif.gz_A x-ray crystal structure of a putative hydrolase from rickettsia typhi 0.8904 9 297
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8861 7 139
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9169 8 107 3.40.50.12270
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9016 7 297 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9014 10 139 3.40.50.1820
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8953 7 297 3.40.50.1820
4oseB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8872 9 296 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4R0PCG5-F1-model_v4 Alpha/beta hydrolase 0.9824 9 296 GO:0016787
AF-A0A4D7BMS4-F1-model_v4 Alpha/beta hydrolase 0.9745 6 296 GO:0016787
AF-A0A258JKG7-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9687 76 281 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A2A4NPU5-F1-model_v4 Alpha/beta hydrolase 0.9639 1 296 GO:0016787
AF-A0A6I3KFP1-F1-model_v4 Alpha/beta fold hydrolase 0.9605 1 295 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.17 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map