F478630
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 224 | 742 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10088239|Ga0105241_100882394 |
| Length | 200 |
| Sequence | MKVAIQNQLIYSVALGNCFSEHFCAFIGFDRGETGPMAADNLTSGIDAFRQAALSCPLPAAVGLIGEKWAFLILRGALNGLHHFEEFQAGLGIARNILSDRLSKMVAGGILERAPDPEDGRRVIYSLTPKGEGLLPVVLALRQWGEEWGYGSMRVVLADRRDGRPVRKLCVMSHDGRELKLGDLTWVERDAAGSIRTAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 176 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 177 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 178 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 179 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 221 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 222 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 223 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 224 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.72 |
| Rhizosphere | 94.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1011682 | 3300001904 | Bacteria | 1426 |
| 2 | JGI24741J21665_1020384 | 3300001915 | Bacteria | 1043 |
| 3 | JGI24747J21853_1000204 | 3300001978 | Bacteria | 3161 |
| 4 | JGI24740J21852_10018085 | 3300001979 | Bacteria | 2509 |
| 5 | JGI24740J21852_10021715 | 3300001979 | Bacteria | 2221 |
| 6 | JGI24739J22299_10020704 | 3300001989 | Bacteria | 2348 |
| 7 | JGI24737J22298_10024619 | 3300001990 | Bacteria | 1906 |
| 8 | JGI24737J22298_10035115 | 3300001990 | Bacteria | 1552 |
| 9 | JGI24737J22298_10059820 | 3300001990 | Bacteria | 1147 |
| 10 | JGI24743J22301_10000584 | 3300001991 | Bacteria | 4399 |
| 11 | JGI24735J21928_10026522 | 3300002067 | Bacteria | 1741 |
| 12 | JGI24735J21928_10075280 | 3300002067 | Bacteria | 967 |
| 13 | JGI24738J21930_10003157 | 3300002075 | Bacteria | 4215 |
| 14 | JGI24738J21930_10005672 | 3300002075 | Bacteria | 2972 |
| 15 | JGI24738J21930_10015881 | 3300002075 | Bacteria | 1596 |
| 16 | JGI24744J21845_10000021 | 3300002077 | Bacteria | 18312 |
| 17 | JGI24035J26624_1010607 | 3300002126 | Bacteria | 918 |
| 18 | JGI24034J26672_10023874 | 3300002239 | Bacteria | 972 |
| 19 | Ga0065715_10012112 | 3300005293 | Bacteria | 2447 |
| 20 | Ga0070658_10003546 | 3300005327 | Bacteria | 12808 |
| 21 | Ga0070658_10023462 | 3300005327 | Bacteria | 4951 |
| 22 | Ga0070658_10032959 | 3300005327 | Bacteria | 4166 |
| 23 | Ga0070658_10048240 | 3300005327 | Bacteria | 3447 |
| 24 | Ga0070658_10187535 | 3300005327 | Bacteria | 1742 |
| 25 | Ga0070658_10201270 | 3300005327 | Bacteria | 1680 |
| 26 | Ga0070658_10206600 | 3300005327 | Bacteria | 1658 |
| 27 | Ga0070658_10234689 | 3300005327 | Bacteria | 1554 |
| 28 | Ga0070658_10337026 | 3300005327 | Bacteria | 1290 |
| 29 | Ga0070658_10704554 | 3300005327 | Bacteria | 876 |
| 30 | Ga0070676_10039705 | 3300005328 | Bacteria | 2723 |
| 31 | Ga0070676_10047500 | 3300005328 | Bacteria | 2507 |
| 32 | Ga0070676_10630872 | 3300005328 | Bacteria | 776 |
| 33 | Ga0070683_100004124 | 3300005329 | Bacteria | 11905 |
| 34 | Ga0070683_100004359 | 3300005329 | Bacteria | 11648 |
| 35 | Ga0070683_100043942 | 3300005329 | Bacteria | 4119 |
| 36 | Ga0070683_100292645 | 3300005329 | Bacteria | 1549 |
| 37 | Ga0070683_100852493 | 3300005329 | Bacteria | 874 |
| 38 | Ga0070690_100006269 | 3300005330 | Bacteria | 6746 |
| 39 | Ga0070690_100170949 | 3300005330 | Bacteria | 1496 |
| 40 | Ga0070670_100021087 | 3300005331 | Bacteria | 5604 |
| 41 | Ga0070670_100053337 | 3300005331 | Bacteria | 3473 |
| 42 | Ga0070670_100162227 | 3300005331 | Bacteria | 1937 |
| 43 | Ga0070670_100241516 | 3300005331 | Unclassified | 1572 |
| 44 | Ga0070670_100420200 | 3300005331 | Bacteria | 1182 |
| 45 | Ga0070670_100713541 | 3300005331 | Bacteria | 902 |
| 46 | Ga0070677_10191731 | 3300005333 | Bacteria | 980 |
| 47 | Ga0068869_100261492 | 3300005334 | Bacteria | 1385 |
| 48 | Ga0068869_100294148 | 3300005334 | Bacteria | 1309 |
| 49 | Ga0070666_10016125 | 3300005335 | Bacteria | 4774 |
| 50 | Ga0070666_10028098 | 3300005335 | Bacteria | 3689 |
| 51 | Ga0070666_10044862 | 3300005335 | Bacteria | 2963 |
| 52 | Ga0070666_10161803 | 3300005335 | Bacteria | 1565 |
| 53 | Ga0070666_10549454 | 3300005335 | Bacteria | 840 |
| 54 | Ga0070680_100002570 | 3300005336 | Bacteria | 13424 |
| 55 | Ga0070680_100003391 | 3300005336 | Bacteria | 11890 |
| 56 | Ga0070680_100064048 | 3300005336 | Bacteria | 3012 |
| 57 | Ga0070680_100142075 | 3300005336 | Bacteria | 2013 |
| 58 | Ga0070680_100264351 | 3300005336 | Unclassified | 1456 |
| 59 | Ga0070680_100562030 | 3300005336 | Bacteria | 978 |
| 60 | Ga0070682_100028197 | 3300005337 | Bacteria | 3376 |
| 61 | Ga0068868_100023182 | 3300005338 | Bacteria | 4696 |
| 62 | Ga0068868_100047460 | 3300005338 | Bacteria | 3366 |
| 63 | Ga0068868_100080502 | 3300005338 | Bacteria | 2610 |
| 64 | Ga0068868_100786408 | 3300005338 | Bacteria | 857 |
| 65 | Ga0070660_100000116 | 3300005339 | Bacteria | 49715 |
| 66 | Ga0070660_100015242 | 3300005339 | Bacteria | 5545 |
| 67 | Ga0070660_100048456 | 3300005339 | Bacteria | 3264 |
| 68 | Ga0070660_100065600 | 3300005339 | Bacteria | 2825 |
| 69 | Ga0070660_100069891 | 3300005339 | Bacteria | 2739 |
| 70 | Ga0070660_100125794 | 3300005339 | Bacteria | 2048 |
| 71 | Ga0070660_100187132 | 3300005339 | Bacteria | 1676 |
| 72 | Ga0070660_100260417 | 3300005339 | Bacteria | 1416 |
| 73 | Ga0070687_100081787 | 3300005343 | Bacteria | 1764 |
| 74 | Ga0070687_100505980 | 3300005343 | Bacteria | 814 |
| 75 | Ga0070661_100025014 | 3300005344 | Bacteria | 4287 |
| 76 | Ga0070661_100034113 | 3300005344 | Bacteria | 3690 |
| 77 | Ga0070661_100041097 | 3300005344 | Bacteria | 3374 |
| 78 | Ga0070661_100056555 | 3300005344 | Bacteria | 2875 |
| 79 | Ga0070661_100066827 | 3300005344 | Bacteria | 2641 |
| 80 | Ga0070661_100092574 | 3300005344 | Bacteria | 2240 |
| 81 | Ga0070661_100093596 | 3300005344 | Bacteria | 2227 |
| 82 | Ga0070661_100115020 | 3300005344 | Bacteria | 2011 |
| 83 | Ga0070661_100169222 | 3300005344 | Bacteria | 1659 |
| 84 | Ga0070661_100422322 | 3300005344 | Bacteria | 1057 |
| 85 | Ga0070661_100579965 | 3300005344 | Bacteria | 905 |
| 86 | Ga0070692_10051674 | 3300005345 | Bacteria | 2138 |
| 87 | Ga0070668_100117202 | 3300005347 | Bacteria | 2125 |
| 88 | Ga0070668_100461269 | 3300005347 | Bacteria | 1094 |
| 89 | Ga0070675_100067188 | 3300005354 | Bacteria | 2966 |
| 90 | Ga0070675_100442254 | 3300005354 | Bacteria | 1165 |
| 91 | Ga0070671_100004853 | 3300005355 | Bacteria | 10691 |
| 92 | Ga0070671_100010817 | 3300005355 | Bacteria | 7322 |
| 93 | Ga0070671_100021385 | 3300005355 | Bacteria | 5283 |
| 94 | Ga0070671_100071911 | 3300005355 | Bacteria | 2887 |
| 95 | Ga0070671_100072403 | 3300005355 | Bacteria | 2878 |
| 96 | Ga0070671_100089736 | 3300005355 | Bacteria | 2573 |
| 97 | Ga0070671_100277161 | 3300005355 | Bacteria | 1426 |
| 98 | Ga0070674_100001041 | 3300005356 | Bacteria | 14499 |
| 99 | Ga0070674_100069682 | 3300005356 | Bacteria | 2481 |
| 100 | Ga0070674_100085997 | 3300005356 | Bacteria | 2258 |
| 101 | Ga0070674_100712826 | 3300005356 | Bacteria | 859 |
| 102 | Ga0070673_100002158 | 3300005364 | Bacteria | 11917 |
| 103 | Ga0070673_100110096 | 3300005364 | Bacteria | 2283 |
| 104 | Ga0070673_100703920 | 3300005364 | Bacteria | 928 |
| 105 | Ga0070673_101669782 | 3300005364 | Bacteria | 602 |
| 106 | Ga0070659_100011508 | 3300005366 | Bacteria | 6545 |
| 107 | Ga0070659_100015457 | 3300005366 | Bacteria | 5717 |
| 108 | Ga0070659_100090954 | 3300005366 | Bacteria | 2446 |
| 109 | Ga0070659_100139847 | 3300005366 | Bacteria | 1971 |
| 110 | Ga0070659_100154794 | 3300005366 | Bacteria | 1871 |
| 111 | Ga0070659_100301012 | 3300005366 | Bacteria | 1337 |
| 112 | Ga0070667_100026365 | 3300005367 | Bacteria | 4834 |
| 113 | Ga0070667_100201843 | 3300005367 | Bacteria | 1765 |
| 114 | Ga0070667_100240611 | 3300005367 | Bacteria | 1616 |
| 115 | Ga0070667_100725410 | 3300005367 | Bacteria | 920 |
| 116 | Ga0070667_101151444 | 3300005367 | Bacteria | 725 |
| 117 | Ga0070709_10213133 | 3300005434 | Bacteria | 1374 |
| 118 | Ga0070714_100076452 | 3300005435 | Bacteria | 2907 |
| 119 | Ga0070714_100177177 | 3300005435 | Bacteria | 1938 |
| 120 | Ga0070714_100423488 | 3300005435 | Bacteria | 1261 |
| 121 | Ga0070714_100565118 | 3300005435 | Unclassified | 1090 |
| 122 | Ga0070713_100392399 | 3300005436 | Bacteria | 1295 |
| 123 | Ga0070705_101049364 | 3300005440 | Bacteria | 664 |
| 124 | Ga0070663_100007525 | 3300005455 | Bacteria | 6634 |
| 125 | Ga0070663_100035592 | 3300005455 | Bacteria | 3455 |
| 126 | Ga0070663_100053451 | 3300005455 | Bacteria | 2883 |
| 127 | Ga0070663_100111141 | 3300005455 | Bacteria | 2059 |
| 128 | Ga0070663_100171798 | 3300005455 | Bacteria | 1676 |
| 129 | Ga0070663_100214472 | 3300005455 | Bacteria | 1509 |
| 130 | Ga0070663_100351429 | 3300005455 | Bacteria | 1194 |
| 131 | Ga0070678_100002512 | 3300005456 | Bacteria | 10063 |
| 132 | Ga0070678_100009817 | 3300005456 | Bacteria | 5820 |
| 133 | Ga0070678_100035954 | 3300005456 | Bacteria | 3464 |
| 134 | Ga0070678_100158536 | 3300005456 | Bacteria | 1831 |
| 135 | Ga0070662_100011899 | 3300005457 | Bacteria | 5752 |
| 136 | Ga0070662_100016462 | 3300005457 | Bacteria | 4966 |
| 137 | Ga0070662_100033010 | 3300005457 | Bacteria | 3642 |
| 138 | Ga0070662_100676207 | 3300005457 | Bacteria | 872 |
| 139 | Ga0070681_10168041 | 3300005458 | Bacteria | 2115 |
| 140 | Ga0070681_10197569 | 3300005458 | Bacteria | 1930 |
| 141 | Ga0068867_100016168 | 3300005459 | Bacteria | 5300 |
| 142 | Ga0068867_100386301 | 3300005459 | Bacteria | 1177 |
| 143 | Ga0068867_100407770 | 3300005459 | Bacteria | 1148 |
| 144 | Ga0070685_10158867 | 3300005466 | Bacteria | 1439 |
| 145 | Ga0070685_10440150 | 3300005466 | Bacteria | 911 |
| 146 | Ga0070679_100001280 | 3300005530 | Bacteria | 22214 |
| 147 | Ga0070679_100051365 | 3300005530 | Bacteria | 4106 |
| 148 | Ga0070679_100114225 | 3300005530 | Bacteria | 2686 |
| 149 | Ga0070679_100180111 | 3300005530 | Bacteria | 2086 |
| 150 | Ga0070679_100383486 | 3300005530 | Bacteria | 1352 |
| 151 | Ga0070679_100411131 | 3300005530 | Bacteria | 1299 |
| 152 | Ga0070679_100419355 | 3300005530 | Bacteria | 1284 |
| 153 | Ga0070679_100849406 | 3300005530 | Bacteria | 856 |
| 154 | Ga0070684_100008040 | 3300005535 | Bacteria | 8233 |
| 155 | Ga0070684_100022154 | 3300005535 | Bacteria | 5296 |
| 156 | Ga0070684_100227627 | 3300005535 | Bacteria | 1702 |
| 157 | Ga0070684_101526187 | 3300005535 | Bacteria | 630 |
| 158 | Ga0068853_100025046 | 3300005539 | Bacteria | 5006 |
| 159 | Ga0068853_100042084 | 3300005539 | Bacteria | 3904 |
| 160 | Ga0068853_100063524 | 3300005539 | Bacteria | 3198 |
| 161 | Ga0068853_100196480 | 3300005539 | Bacteria | 1835 |
| 162 | Ga0068853_100678983 | 3300005539 | Bacteria | 981 |
| 163 | Ga0070672_100005516 | 3300005543 | Bacteria | 8392 |
| 164 | Ga0070672_100023951 | 3300005543 | Bacteria | 4503 |
| 165 | Ga0070672_100236956 | 3300005543 | Bacteria | 1534 |
| 166 | Ga0070672_100465753 | 3300005543 | Bacteria | 1090 |
| 167 | Ga0070672_100581068 | 3300005543 | Bacteria | 975 |
| 168 | Ga0070672_100731150 | 3300005543 | Bacteria | 868 |
| 169 | Ga0070693_100038234 | 3300005547 | Bacteria | 2681 |
| 170 | Ga0070665_100050275 | 3300005548 | Bacteria | 4182 |
| 171 | Ga0070665_100054124 | 3300005548 | Bacteria | 4025 |
| 172 | Ga0068855_100133670 | 3300005563 | Bacteria | 2831 |
| 173 | Ga0068855_100148314 | 3300005563 | Bacteria | 2669 |
| 174 | Ga0068855_100158273 | 3300005563 | Bacteria | 2572 |
| 175 | Ga0068855_100294100 | 3300005563 | Bacteria | 1800 |
| 176 | Ga0070664_100010115 | 3300005564 | Bacteria | 7646 |
| 177 | Ga0070664_100022314 | 3300005564 | Bacteria | 5219 |
| 178 | Ga0070664_100024085 | 3300005564 | Bacteria | 5032 |
| 179 | Ga0070664_100027876 | 3300005564 | Bacteria | 4697 |
| 180 | Ga0070664_100115233 | 3300005564 | Bacteria | 2349 |
| 181 | Ga0070664_100153259 | 3300005564 | Bacteria | 2035 |
| 182 | Ga0070664_100177887 | 3300005564 | Bacteria | 1890 |
| 183 | Ga0070664_100398754 | 3300005564 | Bacteria | 1258 |
| 184 | Ga0070664_101663490 | 3300005564 | Bacteria | 605 |
| 185 | Ga0068857_100029971 | 3300005577 | Bacteria | 4801 |
| 186 | Ga0068857_100039813 | 3300005577 | Bacteria | 4165 |
| 187 | Ga0068857_100097331 | 3300005577 | Bacteria | 2638 |
| 188 | Ga0068857_101947232 | 3300005577 | Bacteria | 576 |
| 189 | Ga0068854_100015728 | 3300005578 | Bacteria | 5023 |
| 190 | Ga0068854_100038221 | 3300005578 | Bacteria | 3374 |
| 191 | Ga0068854_100057624 | 3300005578 | Bacteria | 2802 |
| 192 | Ga0068854_100076822 | 3300005578 | Bacteria | 2455 |
| 193 | Ga0068854_100118414 | 3300005578 | Bacteria | 2006 |
| 194 | Ga0068854_100390474 | 3300005578 | Bacteria | 1149 |
| 195 | Ga0068856_100025157 | 3300005614 | Bacteria | 5801 |
| 196 | Ga0068856_100047877 | 3300005614 | Bacteria | 4213 |
| 197 | Ga0068856_100103479 | 3300005614 | Bacteria | 2841 |
| 198 | Ga0068856_100137062 | 3300005614 | Bacteria | 2453 |
| 199 | Ga0068856_100139472 | 3300005614 | Bacteria | 2431 |
| 200 | Ga0068856_100159498 | 3300005614 | Bacteria | 2266 |
| 201 | Ga0068856_100238050 | 3300005614 | Bacteria | 1836 |
| 202 | Ga0068856_100601497 | 3300005614 | Unclassified | 1121 |
| 203 | Ga0070702_100125677 | 3300005615 | Bacteria | 1612 |
| 204 | Ga0068852_100001974 | 3300005616 | Bacteria | 13985 |
| 205 | Ga0068852_100008915 | 3300005616 | Bacteria | 7420 |
| 206 | Ga0068852_100032300 | 3300005616 | Bacteria | 4333 |
| 207 | Ga0068852_100045286 | 3300005616 | Bacteria | 3741 |
| 208 | Ga0068852_100084192 | 3300005616 | Bacteria | 2829 |
| 209 | Ga0068852_100155966 | 3300005616 | Bacteria | 2127 |
| 210 | Ga0068852_100169832 | 3300005616 | Bacteria | 2043 |
| 211 | Ga0068852_100225645 | 3300005616 | Bacteria | 1783 |
| 212 | Ga0068852_100350399 | 3300005616 | Bacteria | 1442 |
| 213 | Ga0068852_100464934 | 3300005616 | Bacteria | 1255 |
| 214 | Ga0068852_100502087 | 3300005616 | Bacteria | 1208 |
| 215 | Ga0068852_100577573 | 3300005616 | Bacteria | 1126 |
| 216 | Ga0068852_100654747 | 3300005616 | Bacteria | 1058 |
| 217 | Ga0068852_100677444 | 3300005616 | Unclassified | 1040 |
| 218 | Ga0068852_100684457 | 3300005616 | Bacteria | 1035 |
| 219 | Ga0068859_100036982 | 3300005617 | Bacteria | 4900 |
| 220 | Ga0068864_100001341 | 3300005618 | Bacteria | 20455 |
| 221 | Ga0068864_100010881 | 3300005618 | Bacteria | 7520 |
| 222 | Ga0068864_100062317 | 3300005618 | Bacteria | 3231 |
| 223 | Ga0068866_10003689 | 3300005718 | Bacteria | 6272 |
| 224 | Ga0068866_10033669 | 3300005718 | Bacteria | 2488 |
| 225 | Ga0068851_10015861 | 3300005834 | Bacteria | 3596 |
| 226 | Ga0068851_10090165 | 3300005834 | Bacteria | 1613 |
| 227 | Ga0068851_10091637 | 3300005834 | Bacteria | 1601 |
| 228 | Ga0068851_10179492 | 3300005834 | Bacteria | 1172 |
| 229 | Ga0068851_10247609 | 3300005834 | Bacteria | 1010 |
| 230 | Ga0068870_10075085 | 3300005840 | Bacteria | 1854 |
| 231 | Ga0068863_100041199 | 3300005841 | Bacteria | 4391 |
| 232 | Ga0068863_100047372 | 3300005841 | Bacteria | 4077 |
| 233 | Ga0068858_100016001 | 3300005842 | Bacteria | 7044 |
| 234 | Ga0068858_100273596 | 3300005842 | Bacteria | 1607 |
| 235 | Ga0068860_100037810 | 3300005843 | Bacteria | 4619 |
| 236 | Ga0081539_10021906 | 3300005985 | Bacteria | 4248 |
| 237 | Ga0070717_10459431 | 3300006028 | Bacteria | 1148 |
| 238 | Ga0070717_11154419 | 3300006028 | Bacteria | 705 |
| 239 | Ga0097621_100053648 | 3300006237 | Bacteria | 3286 |
| 240 | Ga0097621_100239918 | 3300006237 | Bacteria | 1584 |
| 241 | Ga0097621_100252407 | 3300006237 | Bacteria | 1545 |
| 242 | Ga0097621_100499432 | 3300006237 | Bacteria | 1102 |
| 243 | Ga0068871_100054541 | 3300006358 | Bacteria | 3243 |
| 244 | Ga0068871_100061949 | 3300006358 | Bacteria | 3056 |
| 245 | Ga0068865_100026594 | 3300006881 | Bacteria | 3816 |
| 246 | Ga0068865_100245800 | 3300006881 | Bacteria | 1410 |
| 247 | Ga0097620_100036980 | 3300006931 | Bacteria | 4900 |
| 248 | Ga0105240_10074545 | 3300009093 | Bacteria | 4188 |
| 249 | Ga0105240_10087384 | 3300009093 | Bacteria | 3818 |
| 250 | Ga0105245_10008134 | 3300009098 | Bacteria | 9169 |
| 251 | Ga0105245_10020473 | 3300009098 | Bacteria | 5802 |
| 252 | Ga0105245_10173471 | 3300009098 | Bacteria | 2055 |
| 253 | Ga0105243_10035860 | 3300009148 | Bacteria | 3846 |
| 254 | Ga0105243_10049487 | 3300009148 | Bacteria | 3316 |
| 255 | Ga0105241_10069833 | 3300009174 | Bacteria | 2724 |
| 256 | Ga0105241_10088239 | 3300009174 | Bacteria | 2442 |
| 257 | Ga0105241_10730713 | 3300009174 | Bacteria | 906 |
| 258 | Ga0105242_10030214 | 3300009176 | Bacteria | 4326 |
| 259 | Ga0105242_10566524 | 3300009176 | Bacteria | 1092 |
| 260 | Ga0105248_10000660 | 3300009177 | Bacteria | 39185 |
| 261 | Ga0105248_10001775 | 3300009177 | Bacteria | 24009 |
| 262 | Ga0105248_10046994 | 3300009177 | Bacteria | 4840 |
| 263 | Ga0105248_10113704 | 3300009177 | Bacteria | 3053 |
| 264 | Ga0105248_10263227 | 3300009177 | Bacteria | 1941 |
| 265 | Ga0105248_10500364 | 3300009177 | Bacteria | 1370 |
| 266 | Ga0105248_10592599 | 3300009177 | Bacteria | 1251 |
| 267 | Ga0105248_11467141 | 3300009177 | Bacteria | 772 |
| 268 | Ga0105238_10065300 | 3300009551 | Bacteria | 3640 |
| 269 | Ga0105238_10153328 | 3300009551 | Bacteria | 2279 |
| 270 | Ga0105238_10181866 | 3300009551 | Bacteria | 2079 |
| 271 | Ga0105238_10348604 | 3300009551 | Bacteria | 1470 |
| 272 | Ga0105238_11531707 | 3300009551 | Bacteria | 696 |
| 273 | Ga0105239_10649910 | 3300010375 | Bacteria | 1204 |
| 274 | Ga0105239_12511807 | 3300010375 | Bacteria | 600 |
| 275 | Ga0105246_10068729 | 3300011119 | Bacteria | 2485 |
| 276 | Ga0157373_10019690 | 3300013100 | Bacteria | 4909 |
| 277 | Ga0157373_10163904 | 3300013100 | Bacteria | 1564 |
| 278 | Ga0157373_10177479 | 3300013100 | Bacteria | 1500 |
| 279 | Ga0157373_10200912 | 3300013100 | Bacteria | 1405 |
| 280 | Ga0157373_10376326 | 3300013100 | Bacteria | 1015 |
| 281 | Ga0157373_10431701 | 3300013100 | Bacteria | 946 |
| 282 | Ga0157371_10033846 | 3300013102 | Bacteria | 3669 |
| 283 | Ga0157371_10038689 | 3300013102 | Bacteria | 3412 |
| 284 | Ga0157371_10039806 | 3300013102 | Bacteria | 3361 |
| 285 | Ga0157371_10052929 | 3300013102 | Bacteria | 2883 |
| 286 | Ga0157371_10096234 | 3300013102 | Bacteria | 2098 |
| 287 | Ga0157371_10124358 | 3300013102 | Bacteria | 1834 |
| 288 | Ga0157371_10160181 | 3300013102 | Bacteria | 1607 |
| 289 | Ga0157371_11000886 | 3300013102 | Bacteria | 638 |
| 290 | Ga0157370_10000497 | 3300013104 | Bacteria | 48916 |
| 291 | Ga0157370_10010410 | 3300013104 | Bacteria | 9802 |
| 292 | Ga0157370_10066402 | 3300013104 | Bacteria | 3412 |
| 293 | Ga0157370_10116210 | 3300013104 | Bacteria | 2499 |
| 294 | Ga0157370_10377737 | 3300013104 | Bacteria | 1305 |
| 295 | Ga0157370_10395737 | 3300013104 | Bacteria | 1272 |
| 296 | Ga0157370_10896778 | 3300013104 | Bacteria | 805 |
| 297 | Ga0157369_10003764 | 3300013105 | Bacteria | 18028 |
| 298 | Ga0157369_10013100 | 3300013105 | Bacteria | 9385 |
| 299 | Ga0157369_10055446 | 3300013105 | Bacteria | 4278 |
| 300 | Ga0157369_10200612 | 3300013105 | Bacteria | 2094 |
| 301 | Ga0157369_10210792 | 3300013105 | Bacteria | 2036 |
| 302 | Ga0157369_10284876 | 3300013105 | Bacteria | 1721 |
| 303 | Ga0157369_10297134 | 3300013105 | Bacteria | 1680 |
| 304 | Ga0157369_10475397 | 3300013105 | Bacteria | 1293 |
| 305 | Ga0157369_10555183 | 3300013105 | Bacteria | 1187 |
| 306 | Ga0157369_10927493 | 3300013105 | Bacteria | 893 |
| 307 | Ga0157374_10053398 | 3300013296 | Bacteria | 3767 |
| 308 | Ga0157374_10063506 | 3300013296 | Bacteria | 3463 |
| 309 | Ga0157374_10138127 | 3300013296 | Bacteria | 2364 |
| 310 | Ga0157374_10822399 | 3300013296 | Bacteria | 945 |
| 311 | Ga0157374_11670802 | 3300013296 | Bacteria | 661 |
| 312 | Ga0157378_10078794 | 3300013297 | Bacteria | 2973 |
| 313 | Ga0157378_10291845 | 3300013297 | Bacteria | 1575 |
| 314 | Ga0163162_10081661 | 3300013306 | Bacteria | 3303 |
| 315 | Ga0163162_10364719 | 3300013306 | Bacteria | 1577 |
| 316 | Ga0163162_10640486 | 3300013306 | Bacteria | 1187 |
| 317 | Ga0163162_10753145 | 3300013306 | Bacteria | 1093 |
| 318 | Ga0157372_10026426 | 3300013307 | Bacteria | 6317 |
| 319 | Ga0157372_10218786 | 3300013307 | Bacteria | 2208 |
| 320 | Ga0157372_10257274 | 3300013307 | Bacteria | 2027 |
| 321 | Ga0157372_10319279 | 3300013307 | Bacteria | 1808 |
| 322 | Ga0157372_10768190 | 3300013307 | Bacteria | 1120 |
| 323 | Ga0157372_11070025 | 3300013307 | Bacteria | 933 |
| 324 | Ga0157372_11821417 | 3300013307 | Bacteria | 700 |
| 325 | Ga0157375_10119529 | 3300013308 | Bacteria | 2743 |
| 326 | Ga0157375_10489511 | 3300013308 | Bacteria | 1394 |
| 327 | Ga0182008_10208012 | 3300014497 | Bacteria | 997 |
| 328 | Ga0157377_10035557 | 3300014745 | Bacteria | 2733 |
| 329 | Ga0157379_10373300 | 3300014968 | Bacteria | 1308 |
| 330 | Ga0157376_10063327 | 3300014969 | Bacteria | 3115 |
| 331 | Ga0163161_10061919 | 3300017792 | Bacteria | 2725 |
| 332 | Ga0163161_10374395 | 3300017792 | Bacteria | 1137 |
| 333 | Ga0207697_10013257 | 3300025315 | Bacteria | 3441 |
| 334 | Ga0207697_10040300 | 3300025315 | Bacteria | 1918 |
| 335 | Ga0207697_10085278 | 3300025315 | Bacteria | 1334 |
| 336 | Ga0207656_10046355 | 3300025321 | Bacteria | 1864 |
| 337 | Ga0207656_10101231 | 3300025321 | Bacteria | 1321 |
| 338 | Ga0207656_10130923 | 3300025321 | Bacteria | 1175 |
| 339 | Ga0207656_10179386 | 3300025321 | Bacteria | 1016 |
| 340 | Ga0207682_10047157 | 3300025893 | Bacteria | 1773 |
| 341 | Ga0207682_10194039 | 3300025893 | Bacteria | 932 |
| 342 | Ga0207642_10002131 | 3300025899 | Bacteria | 6126 |
| 343 | Ga0207642_10008168 | 3300025899 | Bacteria | 3578 |
| 344 | Ga0207688_10021461 | 3300025901 | Bacteria | 3528 |
| 345 | Ga0207680_10000328 | 3300025903 | Bacteria | 22845 |
| 346 | Ga0207680_10062756 | 3300025903 | Bacteria | 2271 |
| 347 | Ga0207680_10259622 | 3300025903 | Bacteria | 1202 |
| 348 | Ga0207647_10008311 | 3300025904 | Bacteria | 7444 |
| 349 | Ga0207647_10015640 | 3300025904 | Bacteria | 5195 |
| 350 | Ga0207647_10076374 | 3300025904 | Bacteria | 2015 |
| 351 | Ga0207647_10097855 | 3300025904 | Bacteria | 1744 |
| 352 | Ga0207647_10099897 | 3300025904 | Bacteria | 1723 |
| 353 | Ga0207645_10044601 | 3300025907 | Bacteria | 2837 |
| 354 | Ga0207645_10052507 | 3300025907 | Bacteria | 2604 |
| 355 | Ga0207645_10082460 | 3300025907 | Bacteria | 2061 |
| 356 | Ga0207643_10223166 | 3300025908 | Bacteria | 1154 |
| 357 | Ga0207705_10000123 | 3300025909 | Bacteria | 85382 |
| 358 | Ga0207705_10003236 | 3300025909 | Bacteria | 12402 |
| 359 | Ga0207705_10003465 | 3300025909 | Bacteria | 11997 |
| 360 | Ga0207705_10004136 | 3300025909 | Bacteria | 11003 |
| 361 | Ga0207705_10004850 | 3300025909 | Bacteria | 10106 |
| 362 | Ga0207705_10009612 | 3300025909 | Bacteria | 7032 |
| 363 | Ga0207705_10015028 | 3300025909 | Bacteria | 5565 |
| 364 | Ga0207705_10027408 | 3300025909 | Bacteria | 4063 |
| 365 | Ga0207705_10049597 | 3300025909 | Bacteria | 3021 |
| 366 | Ga0207705_10063830 | 3300025909 | Bacteria | 2661 |
| 367 | Ga0207705_10092079 | 3300025909 | Bacteria | 2221 |
| 368 | Ga0207705_10173743 | 3300025909 | Bacteria | 1623 |
| 369 | Ga0207707_10100523 | 3300025912 | Bacteria | 2527 |
| 370 | Ga0207707_10354541 | 3300025912 | Bacteria | 1264 |
| 371 | Ga0207707_10437660 | 3300025912 | Bacteria | 1119 |
| 372 | Ga0207707_10945419 | 3300025912 | Bacteria | 710 |
| 373 | Ga0207695_10300747 | 3300025913 | Bacteria | 1496 |
| 374 | Ga0207660_10000052 | 3300025917 | Bacteria | 59348 |
| 375 | Ga0207660_10001036 | 3300025917 | Bacteria | 18381 |
| 376 | Ga0207660_10108985 | 3300025917 | Bacteria | 2081 |
| 377 | Ga0207662_10008372 | 3300025918 | Bacteria | 5661 |
| 378 | Ga0207662_10112586 | 3300025918 | Bacteria | 1698 |
| 379 | Ga0207657_10000650 | 3300025919 | Bacteria | 36973 |
| 380 | Ga0207657_10004176 | 3300025919 | Bacteria | 15303 |
| 381 | Ga0207657_10014127 | 3300025919 | Bacteria | 7812 |
| 382 | Ga0207657_10018661 | 3300025919 | Bacteria | 6612 |
| 383 | Ga0207657_10026691 | 3300025919 | Bacteria | 5301 |
| 384 | Ga0207657_10040902 | 3300025919 | Bacteria | 4103 |
| 385 | Ga0207657_10060097 | 3300025919 | Bacteria | 3262 |
| 386 | Ga0207657_10167958 | 3300025919 | Bacteria | 1779 |
| 387 | Ga0207657_10262585 | 3300025919 | Unclassified | 1374 |
| 388 | Ga0207657_10371085 | 3300025919 | Unclassified | 1127 |
| 389 | Ga0207649_10023389 | 3300025920 | Bacteria | 3578 |
| 390 | Ga0207649_10024391 | 3300025920 | Bacteria | 3515 |
| 391 | Ga0207649_10031257 | 3300025920 | Bacteria | 3163 |
| 392 | Ga0207649_10035609 | 3300025920 | Bacteria | 2992 |
| 393 | Ga0207649_10036486 | 3300025920 | Bacteria | 2961 |
| 394 | Ga0207649_10061403 | 3300025920 | Bacteria | 2366 |
| 395 | Ga0207649_10091115 | 3300025920 | Bacteria | 1996 |
| 396 | Ga0207649_10101013 | 3300025920 | Bacteria | 1909 |
| 397 | Ga0207649_10188709 | 3300025920 | Bacteria | 1448 |
| 398 | Ga0207649_10263185 | 3300025920 | Bacteria | 1247 |
| 399 | Ga0207649_10372703 | 3300025920 | Bacteria | 1062 |
| 400 | Ga0207649_10725108 | 3300025920 | Bacteria | 772 |
| 401 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 402 | Ga0207652_10133879 | 3300025921 | Bacteria | 2212 |
| 403 | Ga0207652_10138846 | 3300025921 | Bacteria | 2172 |
| 404 | Ga0207652_10362730 | 3300025921 | Bacteria | 1308 |
| 405 | Ga0207652_10929361 | 3300025921 | Bacteria | 767 |
| 406 | Ga0207681_10117399 | 3300025923 | Bacteria | 1946 |
| 407 | Ga0207694_10505937 | 3300025924 | Bacteria | 1012 |
| 408 | Ga0207694_10966583 | 3300025924 | Unclassified | 720 |
| 409 | Ga0207694_11371767 | 3300025924 | Bacteria | 597 |
| 410 | Ga0207650_10038474 | 3300025925 | Bacteria | 3493 |
| 411 | Ga0207650_10091632 | 3300025925 | Bacteria | 2323 |
| 412 | Ga0207650_10142283 | 3300025925 | Bacteria | 1887 |
| 413 | Ga0207650_10426663 | 3300025925 | Bacteria | 1101 |
| 414 | Ga0207650_11307864 | 3300025925 | Bacteria | 617 |
| 415 | Ga0207659_10255537 | 3300025926 | Bacteria | 1423 |
| 416 | Ga0207659_10523077 | 3300025926 | Bacteria | 1006 |
| 417 | Ga0207687_10013791 | 3300025927 | Bacteria | 5279 |
| 418 | Ga0207687_10023383 | 3300025927 | Bacteria | 4118 |
| 419 | Ga0207687_10025638 | 3300025927 | Bacteria | 3945 |
| 420 | Ga0207687_10819389 | 3300025927 | Bacteria | 794 |
| 421 | Ga0207700_10339840 | 3300025928 | Bacteria | 1305 |
| 422 | Ga0207664_10008734 | 3300025929 | Bacteria | 7083 |
| 423 | Ga0207664_10069171 | 3300025929 | Bacteria | 2838 |
| 424 | Ga0207664_10457049 | 3300025929 | Bacteria | 1140 |
| 425 | Ga0207664_10638540 | 3300025929 | Unclassified | 957 |
| 426 | Ga0207644_10000358 | 3300025931 | Bacteria | 29705 |
| 427 | Ga0207644_10000807 | 3300025931 | Bacteria | 19872 |
| 428 | Ga0207644_10024565 | 3300025931 | Bacteria | 4138 |
| 429 | Ga0207644_10031115 | 3300025931 | Bacteria | 3716 |
| 430 | Ga0207644_10032830 | 3300025931 | Bacteria | 3624 |
| 431 | Ga0207644_10057593 | 3300025931 | Bacteria | 2806 |
| 432 | Ga0207644_10074202 | 3300025931 | Bacteria | 2496 |
| 433 | Ga0207644_10085255 | 3300025931 | Bacteria | 2343 |
| 434 | Ga0207644_10091900 | 3300025931 | Bacteria | 2263 |
| 435 | Ga0207690_10011299 | 3300025932 | Bacteria | 5336 |
| 436 | Ga0207690_10038358 | 3300025932 | Bacteria | 3117 |
| 437 | Ga0207690_10063463 | 3300025932 | Bacteria | 2519 |
| 438 | Ga0207690_10110944 | 3300025932 | Bacteria | 1975 |
| 439 | Ga0207690_10202273 | 3300025932 | Bacteria | 1509 |
| 440 | Ga0207690_10215168 | 3300025932 | Bacteria | 1467 |
| 441 | Ga0207690_10337598 | 3300025932 | Bacteria | 1188 |
| 442 | Ga0207690_10394337 | 3300025932 | Bacteria | 1103 |
| 443 | Ga0207690_10458401 | 3300025932 | Bacteria | 1026 |
| 444 | Ga0207706_10003800 | 3300025933 | Bacteria | 14394 |
| 445 | Ga0207706_10019926 | 3300025933 | Bacteria | 6028 |
| 446 | Ga0207706_10071990 | 3300025933 | Bacteria | 3041 |
| 447 | Ga0207706_10077257 | 3300025933 | Bacteria | 2928 |
| 448 | Ga0207706_10103934 | 3300025933 | Bacteria | 2499 |
| 449 | Ga0207706_10106354 | 3300025933 | Bacteria | 2469 |
| 450 | Ga0207706_10299259 | 3300025933 | Bacteria | 1402 |
| 451 | Ga0207686_10419651 | 3300025934 | Bacteria | 1023 |
| 452 | Ga0207709_10037346 | 3300025935 | Bacteria | 2886 |
| 453 | Ga0207709_10049888 | 3300025935 | Bacteria | 2557 |
| 454 | Ga0207669_10002786 | 3300025937 | Bacteria | 7496 |
| 455 | Ga0207669_10116825 | 3300025937 | Bacteria | 1801 |
| 456 | Ga0207669_10164538 | 3300025937 | Bacteria | 1571 |
| 457 | Ga0207669_10589777 | 3300025937 | Bacteria | 902 |
| 458 | Ga0207704_10056717 | 3300025938 | Bacteria | 2402 |
| 459 | Ga0207704_10074511 | 3300025938 | Bacteria | 2166 |
| 460 | Ga0207704_10188562 | 3300025938 | Bacteria | 1498 |
| 461 | Ga0207704_10278045 | 3300025938 | Bacteria | 1271 |
| 462 | Ga0207691_10005229 | 3300025940 | Bacteria | 12521 |
| 463 | Ga0207691_10044268 | 3300025940 | Bacteria | 4098 |
| 464 | Ga0207691_10084421 | 3300025940 | Bacteria | 2851 |
| 465 | Ga0207691_10167262 | 3300025940 | Bacteria | 1927 |
| 466 | Ga0207691_10230701 | 3300025940 | Bacteria | 1603 |
| 467 | Ga0207691_10409559 | 3300025940 | Bacteria | 1156 |
| 468 | Ga0207691_10656417 | 3300025940 | Unclassified | 886 |
| 469 | Ga0207691_10821838 | 3300025940 | Bacteria | 780 |
| 470 | Ga0207711_10007226 | 3300025941 | Bacteria | 9308 |
| 471 | Ga0207711_10007812 | 3300025941 | Bacteria | 8940 |
| 472 | Ga0207711_10045222 | 3300025941 | Bacteria | 3762 |
| 473 | Ga0207711_10235124 | 3300025941 | Bacteria | 1679 |
| 474 | Ga0207711_10475502 | 3300025941 | Bacteria | 1164 |
| 475 | Ga0207711_11007433 | 3300025941 | Bacteria | 773 |
| 476 | Ga0207711_11506566 | 3300025941 | Unclassified | 616 |
| 477 | Ga0207689_10040941 | 3300025942 | Bacteria | 3833 |
| 478 | Ga0207689_10203749 | 3300025942 | Bacteria | 1633 |
| 479 | Ga0207661_10001415 | 3300025944 | Bacteria | 16185 |
| 480 | Ga0207661_10009454 | 3300025944 | Bacteria | 6993 |
| 481 | Ga0207661_10062788 | 3300025944 | Bacteria | 3006 |
| 482 | Ga0207661_10091195 | 3300025944 | Bacteria | 2539 |
| 483 | Ga0207661_10595769 | 3300025944 | Bacteria | 1014 |
| 484 | Ga0207661_10635234 | 3300025944 | Bacteria | 981 |
| 485 | Ga0207661_10843073 | 3300025944 | Bacteria | 844 |
| 486 | Ga0207679_10023879 | 3300025945 | Bacteria | 4187 |
| 487 | Ga0207679_10051339 | 3300025945 | Bacteria | 3018 |
| 488 | Ga0207679_10145398 | 3300025945 | Bacteria | 1922 |
| 489 | Ga0207679_10275284 | 3300025945 | Bacteria | 1441 |
| 490 | Ga0207679_10447927 | 3300025945 | Bacteria | 1144 |
| 491 | Ga0207667_10022070 | 3300025949 | Bacteria | 7043 |
| 492 | Ga0207667_10236562 | 3300025949 | Bacteria | 1870 |
| 493 | Ga0207667_10323433 | 3300025949 | Bacteria | 1575 |
| 494 | Ga0207667_11012203 | 3300025949 | Bacteria | 818 |
| 495 | Ga0207651_10001030 | 3300025960 | Bacteria | 12321 |
| 496 | Ga0207651_10028843 | 3300025960 | Bacteria | 3507 |
| 497 | Ga0207651_10046190 | 3300025960 | Bacteria | 2926 |
| 498 | Ga0207651_10139789 | 3300025960 | Bacteria | 1868 |
| 499 | Ga0207668_10155655 | 3300025972 | Bacteria | 1775 |
| 500 | Ga0207640_10018554 | 3300025981 | Bacteria | 4090 |
| 501 | Ga0207640_10097059 | 3300025981 | Bacteria | 2056 |
| 502 | Ga0207640_10398753 | 3300025981 | Bacteria | 1120 |
| 503 | Ga0207640_10430562 | 3300025981 | Bacteria | 1082 |
| 504 | Ga0207640_10471271 | 3300025981 | Bacteria | 1039 |
| 505 | Ga0207658_10009194 | 3300025986 | Bacteria | 6700 |
| 506 | Ga0207658_10063588 | 3300025986 | Bacteria | 2766 |
| 507 | Ga0207658_10198854 | 3300025986 | Bacteria | 1672 |
| 508 | Ga0207658_10270879 | 3300025986 | Bacteria | 1451 |
| 509 | Ga0207677_10002148 | 3300026023 | Bacteria | 10362 |
| 510 | Ga0207677_10006119 | 3300026023 | Bacteria | 6571 |
| 511 | Ga0207677_10011379 | 3300026023 | Bacteria | 5071 |
| 512 | Ga0207677_10052215 | 3300026023 | Bacteria | 2776 |
| 513 | Ga0207677_10152897 | 3300026023 | Bacteria | 1783 |
| 514 | Ga0207677_10282520 | 3300026023 | Unclassified | 1363 |
| 515 | Ga0207703_10035102 | 3300026035 | Bacteria | 3984 |
| 516 | Ga0207703_10174042 | 3300026035 | Bacteria | 1895 |
| 517 | Ga0207639_10058682 | 3300026041 | Bacteria | 2961 |
| 518 | Ga0207639_10089776 | 3300026041 | Bacteria | 2456 |
| 519 | Ga0207639_10646373 | 3300026041 | Bacteria | 978 |
| 520 | Ga0207678_10000530 | 3300026067 | Bacteria | 34763 |
| 521 | Ga0207678_10002494 | 3300026067 | Bacteria | 16747 |
| 522 | Ga0207678_10021744 | 3300026067 | Bacteria | 5626 |
| 523 | Ga0207678_10024326 | 3300026067 | Bacteria | 5290 |
| 524 | Ga0207678_10027197 | 3300026067 | Bacteria | 4988 |
| 525 | Ga0207678_10041478 | 3300026067 | Bacteria | 3991 |
| 526 | Ga0207678_10154865 | 3300026067 | Bacteria | 1957 |
| 527 | Ga0207678_10186931 | 3300026067 | Bacteria | 1770 |
| 528 | Ga0207678_10201626 | 3300026067 | Bacteria | 1701 |
| 529 | Ga0207678_10206848 | 3300026067 | Bacteria | 1679 |
| 530 | Ga0207678_10354892 | 3300026067 | Bacteria | 1265 |
| 531 | Ga0207678_10435416 | 3300026067 | Bacteria | 1138 |
| 532 | Ga0207678_10453569 | 3300026067 | Bacteria | 1115 |
| 533 | Ga0207702_10018792 | 3300026078 | Bacteria | 5715 |
| 534 | Ga0207702_10050657 | 3300026078 | Bacteria | 3506 |
| 535 | Ga0207702_10123728 | 3300026078 | Bacteria | 2318 |
| 536 | Ga0207702_10385662 | 3300026078 | Bacteria | 1348 |
| 537 | Ga0207702_10432780 | 3300026078 | Bacteria | 1274 |
| 538 | Ga0207641_10029554 | 3300026088 | Bacteria | 4534 |
| 539 | Ga0207641_10103196 | 3300026088 | Bacteria | 2515 |
| 540 | Ga0207641_10108001 | 3300026088 | Bacteria | 2462 |
| 541 | Ga0207641_10735453 | 3300026088 | Bacteria | 973 |
| 542 | Ga0207648_10010297 | 3300026089 | Bacteria | 8880 |
| 543 | Ga0207648_10011451 | 3300026089 | Bacteria | 8351 |
| 544 | Ga0207648_10068994 | 3300026089 | Bacteria | 3081 |
| 545 | Ga0207648_10456212 | 3300026089 | Bacteria | 1164 |
| 546 | Ga0207648_10517057 | 3300026089 | Bacteria | 1093 |
| 547 | Ga0207676_10000253 | 3300026095 | Bacteria | 46261 |
| 548 | Ga0207676_10001727 | 3300026095 | Bacteria | 16099 |
| 549 | Ga0207676_10039893 | 3300026095 | Bacteria | 3595 |
| 550 | Ga0207676_10122960 | 3300026095 | Bacteria | 2192 |
| 551 | Ga0207676_10488244 | 3300026095 | Bacteria | 1168 |
| 552 | Ga0207674_10004040 | 3300026116 | Bacteria | 17803 |
| 553 | Ga0207674_10013613 | 3300026116 | Bacteria | 9010 |
| 554 | Ga0207674_10032947 | 3300026116 | Bacteria | 5430 |
| 555 | Ga0207683_10010831 | 3300026121 | Bacteria | 7776 |
| 556 | Ga0207683_10012503 | 3300026121 | Bacteria | 7241 |
| 557 | Ga0207683_10049063 | 3300026121 | Bacteria | 3695 |
| 558 | Ga0207683_10106564 | 3300026121 | Bacteria | 2506 |
| 559 | Ga0207698_10015169 | 3300026142 | Bacteria | 5153 |
| 560 | Ga0207698_10023566 | 3300026142 | Bacteria | 4302 |
| 561 | Ga0207698_10035931 | 3300026142 | Bacteria | 3630 |
| 562 | Ga0207698_10079393 | 3300026142 | Bacteria | 2639 |
| 563 | Ga0207698_10090038 | 3300026142 | Bacteria | 2508 |
| 564 | Ga0207698_10103521 | 3300026142 | Bacteria | 2366 |
| 565 | Ga0207698_10188999 | 3300026142 | Bacteria | 1832 |
| 566 | Ga0207698_10200030 | 3300026142 | Bacteria | 1788 |
| 567 | Ga0207698_10205832 | 3300026142 | Bacteria | 1766 |
| 568 | Ga0207698_10322451 | 3300026142 | Unclassified | 1447 |
| 569 | Ga0207698_10504304 | 3300026142 | Bacteria | 1178 |
| 570 | Ga0207698_10957347 | 3300026142 | Bacteria | 865 |
| 571 | Ga0268266_10113944 | 3300028379 | Bacteria | 2398 |
| 572 | Ga0268264_10439012 | 3300028381 | Bacteria | 1262 |
| 573 | Ga0307408_100043976 | 3300031548 | Bacteria | 3180 |
| 574 | Ga0307408_100968228 | 3300031548 | Bacteria | 782 |
| 575 | Ga0307405_10036075 | 3300031731 | Bacteria | 2959 |
| 576 | Ga0307405_11123725 | 3300031731 | Bacteria | 676 |
| 577 | Ga0307413_10020497 | 3300031824 | Bacteria | 3518 |
| 578 | Ga0307410_10045770 | 3300031852 | Bacteria | 2915 |
| 579 | Ga0307409_100035870 | 3300031995 | Bacteria | 3638 |
| 580 | Ga0307409_100063136 | 3300031995 | Bacteria | 2903 |
| 581 | Ga0307409_100588533 | 3300031995 | Bacteria | 1098 |
| 582 | Ga0307416_100012031 | 3300032002 | Bacteria | 5807 |
| 583 | Ga0307416_101575692 | 3300032002 | Bacteria | 762 |
| 584 | Ga0307414_10222938 | 3300032004 | Bacteria | 1549 |
| 585 | Ga0307411_10035683 | 3300032005 | Bacteria | 3108 |
| 586 | Ga0307411_10118565 | 3300032005 | Bacteria | 1909 |
| 587 | Ga0307411_10699818 | 3300032005 | Bacteria | 882 |
| 588 | Ga0307415_100056377 | 3300032126 | Bacteria | 2693 |
| 589 | Ga0307415_100407050 | 3300032126 | Bacteria | 1163 |
| 590 | Ga0307415_100647787 | 3300032126 | Bacteria | 947 |
| 591 | Ga0373930_0143244 | 3300034816 | Bacteria | 595 |
| 592 | Ga0373960_0005917 | 3300035121 | Bacteria | 2849 |
| 593 | Ga0373943_0006847 | 3300035170 | Bacteria | 5113 |
| 594 | Ga0373946_0005931 | 3300035171 | Bacteria | 4428 |
| 595 | Ga0373931_0023562 | 3300035691 | Bacteria | 3110 |
| 596 | Ga0373927_0027773 | 3300035695 | Bacteria | 3695 |
| 597 | Ga0373947_0279550 | 3300035725 | Bacteria | 1109 |
| 598 | Ga0373937_0590848 | 3300036401 | Bacteria | 1054 |
| 599 | Ga0373925_0009468 | 3300037068 | Bacteria | 7091 |
| 600 | Ga0395899_0012920 | 3300037312 | Bacteria | 6390 |
| 601 | Ga0395899_0067804 | 3300037312 | Bacteria | 2617 |
| 602 | Ga0395899_0087703 | 3300037312 | Bacteria | 2258 |
| 603 | Ga0395899_0213781 | 3300037312 | Bacteria | 1339 |
| 604 | Ga0395900_0001102 | 3300037418 | Bacteria | 34357 |
| 605 | Ga0395900_0008653 | 3300037418 | Bacteria | 10456 |
| 606 | Ga0395900_0015199 | 3300037418 | Bacteria | 7850 |
| 607 | Ga0395900_0031013 | 3300037418 | Bacteria | 5491 |
| 608 | Ga0395900_0106995 | 3300037418 | Bacteria | 2873 |
| 609 | Ga0395900_0145515 | 3300037418 | Bacteria | 2423 |
| 610 | Ga0395900_0166674 | 3300037418 | Bacteria | 2245 |
| 611 | Ga0395900_0249855 | 3300037418 | Bacteria | 1775 |
| 612 | Ga0395900_0297424 | 3300037418 | Bacteria | 1601 |
| 613 | Ga0395900_0457506 | 3300037418 | Bacteria | 1231 |
| 614 | Ga0395900_1028271 | 3300037418 | Bacteria | 743 |
| 615 | Ga0395898_0016450 | 3300037466 | Bacteria | 7569 |
| 616 | Ga0395898_0038278 | 3300037466 | Bacteria | 4754 |
| 617 | Ga0395898_0204646 | 3300037466 | Bacteria | 1883 |
| 618 | Ga0395898_0365318 | 3300037466 | Bacteria | 1376 |
| 619 | Ga0395898_0389936 | 3300037466 | Bacteria | 1328 |
| 620 | Ga0395898_0421527 | 3300037466 | Bacteria | 1272 |
| 621 | Ga0395905_0002464 | 3300037471 | Bacteria | 20495 |
| 622 | Ga0395905_0006500 | 3300037471 | Bacteria | 11753 |
| 623 | Ga0395905_0008333 | 3300037471 | Bacteria | 10225 |
| 624 | Ga0395905_0033641 | 3300037471 | Bacteria | 4813 |
| 625 | Ga0395905_0105299 | 3300037471 | Bacteria | 2648 |
| 626 | Ga0395905_0134636 | 3300037471 | Bacteria | 2324 |
| 627 | Ga0395905_0229689 | 3300037471 | Bacteria | 1735 |
| 628 | Ga0395905_0337027 | 3300037471 | Bacteria | 1399 |
| 629 | Ga0395905_0391059 | 3300037471 | Bacteria | 1285 |
| 630 | Ga0395901_0001088 | 3300038443 | Bacteria | 29016 |
| 631 | Ga0395901_0002597 | 3300038443 | Bacteria | 18305 |
| 632 | Ga0395901_0012345 | 3300038443 | Bacteria | 8666 |
| 633 | Ga0395901_0073739 | 3300038443 | Bacteria | 3560 |
| 634 | Ga0395901_0082883 | 3300038443 | Bacteria | 3351 |
| 635 | Ga0395901_0123556 | 3300038443 | Bacteria | 2720 |
| 636 | Ga0395901_0281365 | 3300038443 | Bacteria | 1728 |
| 637 | Ga0395901_0442866 | 3300038443 | Unclassified | 1330 |
| 638 | Ga0395901_0504295 | 3300038443 | Bacteria | 1231 |
| 639 | Ga0436365_0531315 | 3300039437 | Bacteria | 7812 |
| 640 | Ga0436363_0375292 | 3300039450 | Bacteria | 902 |
| 641 | Ga0436363_0692539 | 3300039450 | Bacteria | 1285 |
| 642 | Ga0439465_0031904 | 3300041413 | Bacteria | 1680 |
| 643 | Ga0439448_0138677 | 3300042005 | Unclassified | 841 |
| 644 | Ga0439432_015655 | 3300042006 | Bacteria | 2557 |
| 645 | Ga0439449_0013260 | 3300042007 | Bacteria | 3101 |
| 646 | Ga0439458_0008142 | 3300042157 | Bacteria | 2331 |
| 647 | Ga0466969_0141262 | 3300044656 | Bacteria | 1113 |
| 648 | Ga0466969_0157790 | 3300044656 | Bacteria | 1043 |
| 649 | Ga0466972_0151989 | 3300044658 | Bacteria | 1088 |
| 650 | Ga0466965_0220158 | 3300044683 | Unclassified | 1011 |
| 651 | Ga0466965_0426355 | 3300044683 | Bacteria | 736 |
| 652 | Ga0466966_0002429 | 3300044684 | Bacteria | 12173 |
| 653 | Ga0466966_0052512 | 3300044684 | Bacteria | 2589 |
| 654 | Ga0466966_0079413 | 3300044684 | Bacteria | 2045 |
| 655 | Ga0466966_0602446 | 3300044684 | Unclassified | 661 |
| 656 | Ga0466961_0038704 | 3300044693 | Bacteria | 3059 |
| 657 | Ga0466961_0082694 | 3300044693 | Bacteria | 2031 |
| 658 | Ga0466961_0105199 | 3300044693 | Bacteria | 1777 |
| 659 | Ga0466961_0229477 | 3300044693 | Bacteria | 1143 |
| 660 | Ga0466963_0014749 | 3300044694 | Bacteria | 4823 |
| 661 | Ga0466963_0032293 | 3300044694 | Bacteria | 3389 |
| 662 | Ga0466963_0323330 | 3300044694 | Bacteria | 1086 |
| 663 | Ga0466964_0091615 | 3300044706 | Bacteria | 1324 |
| 664 | Ga0466971_0004121 | 3300044719 | Bacteria | 6259 |
| 665 | Ga0466971_0072983 | 3300044719 | Bacteria | 1559 |
| 666 | Ga0466970_0036150 | 3300044765 | Bacteria | 2616 |
| 667 | Ga0466970_0397746 | 3300044765 | Bacteria | 786 |
| 668 | Ga0466970_0544963 | 3300044765 | Bacteria | 670 |
| 669 | Ga0466970_0647722 | 3300044765 | Bacteria | 614 |
| 670 | Ga0466957_0000705 | 3300044842 | Bacteria | 17083 |
| 671 | Ga0466957_0119646 | 3300044842 | Unclassified | 1678 |
| 672 | Ga0466960_0011619 | 3300044901 | Bacteria | 3692 |
| 673 | Ga0466959_0106303 | 3300045049 | Bacteria | 2006 |
| 674 | Ga0466959_0251547 | 3300045049 | Bacteria | 1219 |
| 675 | Ga0466959_0308188 | 3300045049 | Bacteria | 1083 |
| 676 | Ga0466959_0760919 | 3300045049 | Unclassified | 648 |
| 677 | Ga0466958_0026480 | 3300045836 | Bacteria | 3427 |
| 678 | Ga0466958_0031080 | 3300045836 | Bacteria | 3173 |
| 679 | Ga0466958_0084439 | 3300045836 | Bacteria | 1958 |
| 680 | Ga0466967_0000571 | 3300045976 | Bacteria | 18131 |
| 681 | Ga0466967_0012199 | 3300045976 | Bacteria | 6559 |
| 682 | Ga0466967_0029471 | 3300045976 | Bacteria | 4593 |
| 683 | Ga0466967_0117321 | 3300045976 | Bacteria | 2453 |
| 684 | Ga0466967_0278158 | 3300045976 | Bacteria | 1605 |
| 685 | Ga0466967_0425157 | 3300045976 | Bacteria | 1295 |
| 686 | Ga0495663_0104611 | 3300046525 | Unclassified | 935 |
| 687 | Ga0495598_0000941 | 3300046537 | Bacteria | 5622 |
| 688 | Ga0495621_0014678 | 3300046539 | Bacteria | 2484 |
| 689 | Ga0495633_0023509 | 3300046558 | Bacteria | 3053 |
| 690 | Ga0495659_0101253 | 3300046664 | Bacteria | 1116 |
| 691 | Ga0495669_0062763 | 3300046684 | Bacteria | 1684 |
| 692 | Ga0495669_0126323 | 3300046684 | Bacteria | 1202 |
| 693 | Ga0495669_0154984 | 3300046684 | Bacteria | 1085 |
| 694 | Ga0495669_0308209 | 3300046684 | Unclassified | 764 |
| 695 | Ga0495670_0006379 | 3300046691 | Bacteria | 5795 |
| 696 | Ga0495670_0319615 | 3300046691 | Bacteria | 833 |
| 697 | Ga0495677_0021229 | 3300047445 | Bacteria | 2353 |
| 698 | Ga0495677_0064488 | 3300047445 | Bacteria | 1361 |
| 699 | Ga0496100_0006192 | 3300048903 | Bacteria | 6508 |
| 700 | Ga0496100_0124551 | 3300048903 | Bacteria | 1807 |
| 701 | Ga0496101_0001753 | 3300048904 | Bacteria | 13007 |
| 702 | Ga0496101_0012456 | 3300048904 | Bacteria | 5676 |
| 703 | Ga0496102_0018790 | 3300048905 | Bacteria | 6080 |
| 704 | Ga0496102_0225697 | 3300048905 | Unclassified | 1766 |
| 705 | Ga0496102_0237098 | 3300048905 | Bacteria | 1720 |
| 706 | Ga0496103_0083064 | 3300048906 | Unclassified | 2016 |
| 707 | Ga0496105_0087017 | 3300048908 | Bacteria | 2582 |
| 708 | Ga0496106_0024396 | 3300048909 | Bacteria | 4496 |
| 709 | Ga0496106_0065791 | 3300048909 | Bacteria | 2760 |
| 710 | Ga0496106_0129789 | 3300048909 | Bacteria | 1976 |
| 711 | Ga0496107_0003789 | 3300048910 | Bacteria | 10154 |
| 712 | Ga0496107_0072222 | 3300048910 | Bacteria | 2508 |
| 713 | Ga0496107_0106531 | 3300048910 | Bacteria | 2059 |
| 714 | Ga0496107_0607199 | 3300048910 | Bacteria | 808 |
| 715 | Ga0496108_0001787 | 3300048911 | Bacteria | 17132 |
| 716 | Ga0496108_0043139 | 3300048911 | Bacteria | 3767 |
| 717 | Ga0496109_0000995 | 3300048912 | Bacteria | 23386 |
| 718 | Ga0496109_0006868 | 3300048912 | Bacteria | 9598 |
| 719 | Ga0496109_0225849 | 3300048912 | Bacteria | 1761 |
| 720 | Ga0496109_0663231 | 3300048912 | Bacteria | 980 |
| 721 | Ga0496110_0005992 | 3300048913 | Bacteria | 9568 |
| 722 | Ga0496110_0032650 | 3300048913 | Bacteria | 4498 |
| 723 | Ga0496111_0018568 | 3300048914 | Bacteria | 4818 |
| 724 | Ga0496111_0023557 | 3300048914 | Bacteria | 4324 |
| 725 | Ga0496111_0115152 | 3300048914 | Bacteria | 1982 |
| 726 | Ga0496112_0002054 | 3300048915 | Bacteria | 15962 |
| 727 | Ga0496112_0005455 | 3300048915 | Bacteria | 11005 |
| 728 | Ga0496112_0091406 | 3300048915 | Bacteria | 3012 |
| 729 | Ga0496112_0119024 | 3300048915 | Bacteria | 2611 |
| 730 | Ga0496113_0014949 | 3300048916 | Bacteria | 5313 |
| 731 | Ga0496113_0023645 | 3300048916 | Bacteria | 4358 |
| 732 | Ga0496113_0252889 | 3300048916 | Bacteria | 1407 |
| 733 | Ga0496114_0053548 | 3300048917 | Bacteria | 3364 |
| 734 | Ga0501209_001155 | 3300049656 | Bacteria | 3608 |
| 735 | Ga0501224_001917 | 3300049664 | Bacteria | 2804 |
| 736 | Ga0501235_007338 | 3300049669 | Bacteria | 2404 |
| 737 | Ga0501249_003896 | 3300049679 | Bacteria | 3014 |
| 738 | Ga0501229_024122 | 3300049706 | Bacteria | 815 |
| 739 | Ga0501263_003457 | 3300049760 | Bacteria | 1687 |
| 740 | Ga0501268_037296 | 3300049765 | Bacteria | 903 |
| 741 | Ga0501270_001256 | 3300049767 | Bacteria | 2382 |
| 742 | Ga0466962_0115330 | 3300061719 | Bacteria | 1294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025981 | Ga0207640_10398753 | Ga0207640_103987533 | 149 |
| 2 | 3300005331 | Ga0070670_100053337 | Ga0070670_1000533375 | 159 |
| 3 | 3300005354 | Ga0070675_100442254 | Ga0070675_1004422542 | 159 |
| 4 | 3300005564 | Ga0070664_100027876 | Ga0070664_1000278762 | 159 |
| 5 | 3300009177 | Ga0105248_10592599 | Ga0105248_105925992 | 159 |
| 6 | 3300025919 | Ga0207657_10262585 | Ga0207657_102625852 | 159 |
| 7 | 3300025925 | Ga0207650_10142283 | Ga0207650_101422832 | 159 |
| 8 | 3300025926 | Ga0207659_10523077 | Ga0207659_105230771 | 159 |
| 9 | 3300025941 | Ga0207711_11506566 | Ga0207711_115065661 | 159 |
| 10 | 3300047445 | Ga0495677_0064488 | Ga0495677_0064488_428_916 | 159 |
| 11 | 3300005543 | Ga0070672_100465753 | Ga0070672_1004657532 | 160 |
| 12 | 3300025940 | Ga0207691_10167262 | Ga0207691_101672622 | 160 |
| 13 | 3300031995 | Ga0307409_100588533 | Ga0307409_1005885332 | 160 |
| 14 | 3300037418 | Ga0395900_0015199 | Ga0395900_0015199_3064_3549 | 160 |
| 15 | 3300038443 | Ga0395901_0123556 | Ga0395901_0123556_2164_2649 | 160 |
| 16 | 3300005355 | Ga0070671_100072403 | Ga0070671_1000724033 | 162 |
| 17 | 3300005366 | Ga0070659_100139847 | Ga0070659_1001398473 | 162 |
| 18 | 3300005616 | Ga0068852_100677444 | Ga0068852_1006774442 | 162 |
| 19 | 3300005618 | Ga0068864_100062317 | Ga0068864_1000623174 | 162 |
| 20 | 3300005834 | Ga0068851_10179492 | Ga0068851_101794921 | 162 |
| 21 | 3300005841 | Ga0068863_100047372 | Ga0068863_1000473723 | 162 |
| 22 | 3300009177 | Ga0105248_10001775 | Ga0105248_1000177515 | 162 |
| 23 | 3300025925 | Ga0207650_10038474 | Ga0207650_100384744 | 162 |
| 24 | 3300025931 | Ga0207644_10000807 | Ga0207644_1000080718 | 162 |
| 25 | 3300025931 | Ga0207644_10074202 | Ga0207644_100742023 | 162 |
| 26 | 3300025932 | Ga0207690_10202273 | Ga0207690_102022732 | 162 |
| 27 | 3300025941 | Ga0207711_10007226 | Ga0207711_100072263 | 162 |
| 28 | 3300026088 | Ga0207641_10103196 | Ga0207641_101031963 | 162 |
| 29 | 3300026095 | Ga0207676_10001727 | Ga0207676_100017272 | 162 |
| 30 | 3300026142 | Ga0207698_10322451 | Ga0207698_103224512 | 162 |
| 31 | 3300032002 | Ga0307416_101575692 | Ga0307416_1015756921 | 162 |
| 32 | 3300032126 | Ga0307415_100647787 | Ga0307415_1006477872 | 162 |
| 33 | 3300048905 | Ga0496102_0225697 | Ga0496102_0225697_313_801 | 162 |
| 34 | 3300048911 | Ga0496108_0043139 | Ga0496108_0043139_1294_1782 | 162 |
| 35 | 3300048912 | Ga0496109_0006868 | Ga0496109_0006868_744_1232 | 162 |
| 36 | 3300048914 | Ga0496111_0115152 | Ga0496111_0115152_466_954 | 162 |
| 37 | 3300048915 | Ga0496112_0002054 | Ga0496112_0002054_14826_15314 | 162 |
| 38 | 3300048916 | Ga0496113_0014949 | Ga0496113_0014949_4543_5031 | 162 |
| 39 | 3300001990 | JGI24737J22298_10059820 | JGI24737J22298_100598202 | 163 |
| 40 | 3300002075 | JGI24738J21930_10015881 | JGI24738J21930_100158814 | 163 |
| 41 | 3300005327 | Ga0070658_10003546 | Ga0070658_100035467 | 163 |
| 42 | 3300005327 | Ga0070658_10023462 | Ga0070658_100234622 | 163 |
| 43 | 3300005327 | Ga0070658_10201270 | Ga0070658_102012702 | 163 |
| 44 | 3300005327 | Ga0070658_10206600 | Ga0070658_102066002 | 163 |
| 45 | 3300005328 | Ga0070676_10039705 | Ga0070676_100397051 | 163 |
| 46 | 3300005329 | Ga0070683_100004359 | Ga0070683_1000043599 | 163 |
| 47 | 3300005329 | Ga0070683_100852493 | Ga0070683_1008524932 | 163 |
| 48 | 3300005330 | Ga0070690_100006269 | Ga0070690_1000062695 | 163 |
| 49 | 3300005330 | Ga0070690_100170949 | Ga0070690_1001709491 | 163 |
| 50 | 3300005331 | Ga0070670_100713541 | Ga0070670_1007135411 | 163 |
| 51 | 3300005334 | Ga0068869_100294148 | Ga0068869_1002941482 | 163 |
| 52 | 3300005335 | Ga0070666_10016125 | Ga0070666_100161251 | 163 |
| 53 | 3300005335 | Ga0070666_10044862 | Ga0070666_100448622 | 163 |
| 54 | 3300005338 | Ga0068868_100047460 | Ga0068868_1000474603 | 163 |
| 55 | 3300005338 | Ga0068868_100080502 | Ga0068868_1000805022 | 163 |
| 56 | 3300005339 | Ga0070660_100015242 | Ga0070660_1000152425 | 163 |
| 57 | 3300005339 | Ga0070660_100048456 | Ga0070660_1000484563 | 163 |
| 58 | 3300005339 | Ga0070660_100069891 | Ga0070660_1000698912 | 163 |
| 59 | 3300005343 | Ga0070687_100505980 | Ga0070687_1005059802 | 163 |
| 60 | 3300005344 | Ga0070661_100025014 | Ga0070661_1000250145 | 163 |
| 61 | 3300005344 | Ga0070661_100041097 | Ga0070661_1000410972 | 163 |
| 62 | 3300005344 | Ga0070661_100093596 | Ga0070661_1000935962 | 163 |
| 63 | 3300005347 | Ga0070668_100461269 | Ga0070668_1004612692 | 163 |
| 64 | 3300005355 | Ga0070671_100021385 | Ga0070671_1000213852 | 163 |
| 65 | 3300005355 | Ga0070671_100089736 | Ga0070671_1000897364 | 163 |
| 66 | 3300005356 | Ga0070674_100069682 | Ga0070674_1000696821 | 163 |
| 67 | 3300005356 | Ga0070674_100085997 | Ga0070674_1000859971 | 163 |
| 68 | 3300005364 | Ga0070673_100110096 | Ga0070673_1001100963 | 163 |
| 69 | 3300005364 | Ga0070673_101669782 | Ga0070673_1016697821 | 163 |
| 70 | 3300005366 | Ga0070659_100011508 | Ga0070659_1000115085 | 163 |
| 71 | 3300005366 | Ga0070659_100090954 | Ga0070659_1000909543 | 163 |
| 72 | 3300005366 | Ga0070659_100301012 | Ga0070659_1003010122 | 163 |
| 73 | 3300005367 | Ga0070667_100026365 | Ga0070667_1000263654 | 163 |
| 74 | 3300005367 | Ga0070667_101151444 | Ga0070667_1011514442 | 163 |
| 75 | 3300005435 | Ga0070714_100565118 | Ga0070714_1005651182 | 163 |
| 76 | 3300005455 | Ga0070663_100171798 | Ga0070663_1001717983 | 163 |
| 77 | 3300005456 | Ga0070678_100009817 | Ga0070678_1000098175 | 163 |
| 78 | 3300005457 | Ga0070662_100016462 | Ga0070662_1000164623 | 163 |
| 79 | 3300005457 | Ga0070662_100676207 | Ga0070662_1006762071 | 163 |
| 80 | 3300005459 | Ga0068867_100386301 | Ga0068867_1003863012 | 163 |
| 81 | 3300005466 | Ga0070685_10440150 | Ga0070685_104401501 | 163 |
| 82 | 3300005535 | Ga0070684_100008040 | Ga0070684_1000080404 | 163 |
| 83 | 3300005539 | Ga0068853_100063524 | Ga0068853_1000635243 | 163 |
| 84 | 3300005539 | Ga0068853_100196480 | Ga0068853_1001964804 | 163 |
| 85 | 3300005543 | Ga0070672_100005516 | Ga0070672_1000055165 | 163 |
| 86 | 3300005543 | Ga0070672_100236956 | Ga0070672_1002369561 | 163 |
| 87 | 3300005543 | Ga0070672_100731150 | Ga0070672_1007311501 | 163 |
| 88 | 3300005563 | Ga0068855_100148314 | Ga0068855_1001483142 | 163 |
| 89 | 3300005564 | Ga0070664_100010115 | Ga0070664_1000101155 | 163 |
| 90 | 3300005578 | Ga0068854_100390474 | Ga0068854_1003904742 | 163 |
| 91 | 3300005614 | Ga0068856_100047877 | Ga0068856_1000478773 | 163 |
| 92 | 3300005615 | Ga0070702_100125677 | Ga0070702_1001256772 | 163 |
| 93 | 3300005616 | Ga0068852_100032300 | Ga0068852_1000323004 | 163 |
| 94 | 3300005616 | Ga0068852_100502087 | Ga0068852_1005020871 | 163 |
| 95 | 3300005617 | Ga0068859_100036982 | Ga0068859_1000369824 | 163 |
| 96 | 3300005618 | Ga0068864_100010881 | Ga0068864_1000108815 | 163 |
| 97 | 3300005718 | Ga0068866_10033669 | Ga0068866_100336693 | 163 |
| 98 | 3300005834 | Ga0068851_10015861 | Ga0068851_100158613 | 163 |
| 99 | 3300005841 | Ga0068863_100041199 | Ga0068863_1000411993 | 163 |
| 100 | 3300005842 | Ga0068858_100016001 | Ga0068858_1000160019 | 163 |
| 101 | 3300005842 | Ga0068858_100273596 | Ga0068858_1002735963 | 163 |
| 102 | 3300005843 | Ga0068860_100037810 | Ga0068860_1000378105 | 163 |
| 103 | 3300006237 | Ga0097621_100053648 | Ga0097621_1000536483 | 163 |
| 104 | 3300006237 | Ga0097621_100499432 | Ga0097621_1004994321 | 163 |
| 105 | 3300006358 | Ga0068871_100054541 | Ga0068871_1000545413 | 163 |
| 106 | 3300006881 | Ga0068865_100026594 | Ga0068865_1000265942 | 163 |
| 107 | 3300006881 | Ga0068865_100245800 | Ga0068865_1002458003 | 163 |
| 108 | 3300006931 | Ga0097620_100036980 | Ga0097620_1000369803 | 163 |
| 109 | 3300009093 | Ga0105240_10074545 | Ga0105240_100745453 | 163 |
| 110 | 3300009098 | Ga0105245_10008134 | Ga0105245_100081345 | 163 |
| 111 | 3300009148 | Ga0105243_10035860 | Ga0105243_100358605 | 163 |
| 112 | 3300009176 | Ga0105242_10030214 | Ga0105242_100302145 | 163 |
| 113 | 3300009177 | Ga0105248_10046994 | Ga0105248_100469945 | 163 |
| 114 | 3300009177 | Ga0105248_10263227 | Ga0105248_102632272 | 163 |
| 115 | 3300009551 | Ga0105238_10065300 | Ga0105238_100653005 | 163 |
| 116 | 3300013100 | Ga0157373_10200912 | Ga0157373_102009122 | 163 |
| 117 | 3300013102 | Ga0157371_10033846 | Ga0157371_100338465 | 163 |
| 118 | 3300013102 | Ga0157371_10038689 | Ga0157371_100386892 | 163 |
| 119 | 3300013102 | Ga0157371_10039806 | Ga0157371_100398061 | 163 |
| 120 | 3300013102 | Ga0157371_11000886 | Ga0157371_110008862 | 163 |
| 121 | 3300013104 | Ga0157370_10395737 | Ga0157370_103957372 | 163 |
| 122 | 3300013104 | Ga0157370_10896778 | Ga0157370_108967781 | 163 |
| 123 | 3300013105 | Ga0157369_10013100 | Ga0157369_100131005 | 163 |
| 124 | 3300013296 | Ga0157374_10053398 | Ga0157374_100533983 | 163 |
| 125 | 3300013297 | Ga0157378_10291845 | Ga0157378_102918453 | 163 |
| 126 | 3300013306 | Ga0163162_10081661 | Ga0163162_100816614 | 163 |
| 127 | 3300013307 | Ga0157372_11070025 | Ga0157372_110700252 | 163 |
| 128 | 3300014745 | Ga0157377_10035557 | Ga0157377_100355574 | 163 |
| 129 | 3300014968 | Ga0157379_10373300 | Ga0157379_103733002 | 163 |
| 130 | 3300014969 | Ga0157376_10063327 | Ga0157376_100633273 | 163 |
| 131 | 3300017792 | Ga0163161_10374395 | Ga0163161_103743952 | 163 |
| 132 | 3300025315 | Ga0207697_10040300 | Ga0207697_100403002 | 163 |
| 133 | 3300025321 | Ga0207656_10130923 | Ga0207656_101309233 | 163 |
| 134 | 3300025899 | Ga0207642_10008168 | Ga0207642_100081683 | 163 |
| 135 | 3300025903 | Ga0207680_10000328 | Ga0207680_1000032817 | 163 |
| 136 | 3300025903 | Ga0207680_10062756 | Ga0207680_100627563 | 163 |
| 137 | 3300025904 | Ga0207647_10008311 | Ga0207647_100083115 | 163 |
| 138 | 3300025907 | Ga0207645_10044601 | Ga0207645_100446011 | 163 |
| 139 | 3300025909 | Ga0207705_10003236 | Ga0207705_100032367 | 163 |
| 140 | 3300025909 | Ga0207705_10003465 | Ga0207705_100034656 | 163 |
| 141 | 3300025909 | Ga0207705_10004850 | Ga0207705_100048505 | 163 |
| 142 | 3300025909 | Ga0207705_10009612 | Ga0207705_100096126 | 163 |
| 143 | 3300025913 | Ga0207695_10300747 | Ga0207695_103007471 | 163 |
| 144 | 3300025918 | Ga0207662_10112586 | Ga0207662_101125864 | 163 |
| 145 | 3300025919 | Ga0207657_10014127 | Ga0207657_100141278 | 163 |
| 146 | 3300025919 | Ga0207657_10026691 | Ga0207657_100266915 | 163 |
| 147 | 3300025919 | Ga0207657_10060097 | Ga0207657_100600973 | 163 |
| 148 | 3300025920 | Ga0207649_10023389 | Ga0207649_100233893 | 163 |
| 149 | 3300025920 | Ga0207649_10101013 | Ga0207649_101010133 | 163 |
| 150 | 3300025920 | Ga0207649_10725108 | Ga0207649_107251082 | 163 |
| 151 | 3300025925 | Ga0207650_11307864 | Ga0207650_113078641 | 163 |
| 152 | 3300025927 | Ga0207687_10025638 | Ga0207687_100256384 | 163 |
| 153 | 3300025927 | Ga0207687_10819389 | Ga0207687_108193892 | 163 |
| 154 | 3300025929 | Ga0207664_10638540 | Ga0207664_106385401 | 163 |
| 155 | 3300025931 | Ga0207644_10000358 | Ga0207644_100003582 | 163 |
| 156 | 3300025931 | Ga0207644_10091900 | Ga0207644_100919004 | 163 |
| 157 | 3300025932 | Ga0207690_10110944 | Ga0207690_101109443 | 163 |
| 158 | 3300025932 | Ga0207690_10337598 | Ga0207690_103375981 | 163 |
| 159 | 3300025933 | Ga0207706_10003800 | Ga0207706_100038005 | 163 |
| 160 | 3300025933 | Ga0207706_10299259 | Ga0207706_102992592 | 163 |
| 161 | 3300025935 | Ga0207709_10049888 | Ga0207709_100498882 | 163 |
| 162 | 3300025937 | Ga0207669_10116825 | Ga0207669_101168251 | 163 |
| 163 | 3300025937 | Ga0207669_10164538 | Ga0207669_101645381 | 163 |
| 164 | 3300025938 | Ga0207704_10074511 | Ga0207704_100745113 | 163 |
| 165 | 3300025938 | Ga0207704_10188562 | Ga0207704_101885623 | 163 |
| 166 | 3300025940 | Ga0207691_10005229 | Ga0207691_100052295 | 163 |
| 167 | 3300025940 | Ga0207691_10084421 | Ga0207691_100844211 | 163 |
| 168 | 3300025940 | Ga0207691_10409559 | Ga0207691_104095591 | 163 |
| 169 | 3300025941 | Ga0207711_10045222 | Ga0207711_100452224 | 163 |
| 170 | 3300025942 | Ga0207689_10203749 | Ga0207689_102037492 | 163 |
| 171 | 3300025944 | Ga0207661_10009454 | Ga0207661_100094542 | 163 |
| 172 | 3300025944 | Ga0207661_10843073 | Ga0207661_108430732 | 163 |
| 173 | 3300025949 | Ga0207667_10323433 | Ga0207667_103234332 | 163 |
| 174 | 3300025960 | Ga0207651_10001030 | Ga0207651_100010306 | 163 |
| 175 | 3300025960 | Ga0207651_10046190 | Ga0207651_100461903 | 163 |
| 176 | 3300025981 | Ga0207640_10471271 | Ga0207640_104712712 | 163 |
| 177 | 3300025986 | Ga0207658_10009194 | Ga0207658_100091944 | 163 |
| 178 | 3300026023 | Ga0207677_10002148 | Ga0207677_100021486 | 163 |
| 179 | 3300026023 | Ga0207677_10052215 | Ga0207677_100522153 | 163 |
| 180 | 3300026035 | Ga0207703_10035102 | Ga0207703_100351023 | 163 |
| 181 | 3300026035 | Ga0207703_10174042 | Ga0207703_101740424 | 163 |
| 182 | 3300026041 | Ga0207639_10058682 | Ga0207639_100586823 | 163 |
| 183 | 3300026067 | Ga0207678_10154865 | Ga0207678_101548652 | 163 |
| 184 | 3300026067 | Ga0207678_10206848 | Ga0207678_102068483 | 163 |
| 185 | 3300026067 | Ga0207678_10435416 | Ga0207678_104354162 | 163 |
| 186 | 3300026078 | Ga0207702_10123728 | Ga0207702_101237282 | 163 |
| 187 | 3300026088 | Ga0207641_10108001 | Ga0207641_101080013 | 163 |
| 188 | 3300026089 | Ga0207648_10010297 | Ga0207648_100102975 | 163 |
| 189 | 3300026089 | Ga0207648_10517057 | Ga0207648_105170572 | 163 |
| 190 | 3300026095 | Ga0207676_10039893 | Ga0207676_100398934 | 163 |
| 191 | 3300026095 | Ga0207676_10488244 | Ga0207676_104882441 | 163 |
| 192 | 3300026121 | Ga0207683_10012503 | Ga0207683_100125035 | 163 |
| 193 | 3300026142 | Ga0207698_10035931 | Ga0207698_100359313 | 163 |
| 194 | 3300026142 | Ga0207698_10103521 | Ga0207698_101035213 | 163 |
| 195 | 3300028381 | Ga0268264_10439012 | Ga0268264_104390123 | 163 |
| 196 | 3300034816 | Ga0373930_0143244 | Ga0373930_0143244_22_513 | 163 |
| 197 | 3300035121 | Ga0373960_0005917 | Ga0373960_0005917_211_702 | 163 |
| 198 | 3300035691 | Ga0373931_0023562 | Ga0373931_0023562_1035_1526 | 163 |
| 199 | 3300037312 | Ga0395899_0067804 | Ga0395899_0067804_1609_2100 | 163 |
| 200 | 3300037418 | Ga0395900_0001102 | Ga0395900_0001102_10601_11092 | 163 |
| 201 | 3300037466 | Ga0395898_0038278 | Ga0395898_0038278_3746_4237 | 163 |
| 202 | 3300037471 | Ga0395905_0033641 | Ga0395905_0033641_518_1009 | 163 |
| 203 | 3300038443 | Ga0395901_0001088 | Ga0395901_0001088_24018_24509 | 163 |
| 204 | 3300044683 | Ga0466965_0426355 | Ga0466965_0426355_140_637 | 163 |
| 205 | 3300044684 | Ga0466966_0079413 | Ga0466966_0079413_710_1201 | 163 |
| 206 | 3300044719 | Ga0466971_0004121 | Ga0466971_0004121_4639_5130 | 163 |
| 207 | 3300044765 | Ga0466970_0036150 | Ga0466970_0036150_1621_2112 | 163 |
| 208 | 3300044842 | Ga0466957_0000705 | Ga0466957_0000705_12780_13271 | 163 |
| 209 | 3300045836 | Ga0466958_0026480 | Ga0466958_0026480_589_1080 | 163 |
| 210 | 3300045976 | Ga0466967_0000571 | Ga0466967_0000571_3819_4310 | 163 |
| 211 | 3300048903 | Ga0496100_0006192 | Ga0496100_0006192_915_1406 | 163 |
| 212 | 3300048904 | Ga0496101_0001753 | Ga0496101_0001753_10614_11105 | 163 |
| 213 | 3300048905 | Ga0496102_0237098 | Ga0496102_0237098_12_503 | 163 |
| 214 | 3300048906 | Ga0496103_0083064 | Ga0496103_0083064_1068_1559 | 163 |
| 215 | 3300048908 | Ga0496105_0087017 | Ga0496105_0087017_1293_1784 | 163 |
| 216 | 3300048909 | Ga0496106_0065791 | Ga0496106_0065791_915_1406 | 163 |
| 217 | 3300048910 | Ga0496107_0003789 | Ga0496107_0003789_4639_5130 | 163 |
| 218 | 3300048911 | Ga0496108_0001787 | Ga0496108_0001787_472_963 | 163 |
| 219 | 3300048913 | Ga0496110_0032650 | Ga0496110_0032650_2443_2934 | 163 |
| 220 | 3300048914 | Ga0496111_0018568 | Ga0496111_0018568_1895_2386 | 163 |
| 221 | 3300048915 | Ga0496112_0091406 | Ga0496112_0091406_2288_2779 | 163 |
| 222 | 3300048916 | Ga0496113_0023645 | Ga0496113_0023645_2172_2663 | 163 |
| 223 | 3300048917 | Ga0496114_0053548 | Ga0496114_0053548_1923_2414 | 163 |
| 224 | 3300001904 | JGI24736J21556_1011682 | JGI24736J21556_10116822 | 164 |
| 225 | 3300001915 | JGI24741J21665_1020384 | JGI24741J21665_10203842 | 164 |
| 226 | 3300001978 | JGI24747J21853_1000204 | JGI24747J21853_10002043 | 164 |
| 227 | 3300001979 | JGI24740J21852_10018085 | JGI24740J21852_100180853 | 164 |
| 228 | 3300001979 | JGI24740J21852_10021715 | JGI24740J21852_100217153 | 164 |
| 229 | 3300001989 | JGI24739J22299_10020704 | JGI24739J22299_100207043 | 164 |
| 230 | 3300001990 | JGI24737J22298_10024619 | JGI24737J22298_100246192 | 164 |
| 231 | 3300001990 | JGI24737J22298_10035115 | JGI24737J22298_100351153 | 164 |
| 232 | 3300001991 | JGI24743J22301_10000584 | JGI24743J22301_100005844 | 164 |
| 233 | 3300002067 | JGI24735J21928_10026522 | JGI24735J21928_100265222 | 164 |
| 234 | 3300002067 | JGI24735J21928_10075280 | JGI24735J21928_100752802 | 164 |
| 235 | 3300002075 | JGI24738J21930_10003157 | JGI24738J21930_100031574 | 164 |
| 236 | 3300002075 | JGI24738J21930_10005672 | JGI24738J21930_100056722 | 164 |
| 237 | 3300002077 | JGI24744J21845_10000021 | JGI24744J21845_1000002117 | 164 |
| 238 | 3300002126 | JGI24035J26624_1010607 | JGI24035J26624_10106071 | 164 |
| 239 | 3300002239 | JGI24034J26672_10023874 | JGI24034J26672_100238742 | 164 |
| 240 | 3300005293 | Ga0065715_10012112 | Ga0065715_100121123 | 164 |
| 241 | 3300005327 | Ga0070658_10032959 | Ga0070658_100329592 | 164 |
| 242 | 3300005327 | Ga0070658_10048240 | Ga0070658_100482404 | 164 |
| 243 | 3300005327 | Ga0070658_10187535 | Ga0070658_101875354 | 164 |
| 244 | 3300005327 | Ga0070658_10234689 | Ga0070658_102346892 | 164 |
| 245 | 3300005327 | Ga0070658_10337026 | Ga0070658_103370261 | 164 |
| 246 | 3300005327 | Ga0070658_10704554 | Ga0070658_107045542 | 164 |
| 247 | 3300005328 | Ga0070676_10047500 | Ga0070676_100475004 | 164 |
| 248 | 3300005328 | Ga0070676_10630872 | Ga0070676_106308722 | 164 |
| 249 | 3300005329 | Ga0070683_100004124 | Ga0070683_1000041246 | 164 |
| 250 | 3300005329 | Ga0070683_100043942 | Ga0070683_1000439424 | 164 |
| 251 | 3300005329 | Ga0070683_100292645 | Ga0070683_1002926452 | 164 |
| 252 | 3300005331 | Ga0070670_100021087 | Ga0070670_1000210876 | 164 |
| 253 | 3300005331 | Ga0070670_100162227 | Ga0070670_1001622272 | 164 |
| 254 | 3300005331 | Ga0070670_100241516 | Ga0070670_1002415161 | 164 |
| 255 | 3300005331 | Ga0070670_100420200 | Ga0070670_1004202001 | 164 |
| 256 | 3300005333 | Ga0070677_10191731 | Ga0070677_101917312 | 164 |
| 257 | 3300005334 | Ga0068869_100261492 | Ga0068869_1002614923 | 164 |
| 258 | 3300005335 | Ga0070666_10028098 | Ga0070666_100280984 | 164 |
| 259 | 3300005335 | Ga0070666_10161803 | Ga0070666_101618034 | 164 |
| 260 | 3300005335 | Ga0070666_10549454 | Ga0070666_105494541 | 164 |
| 261 | 3300005336 | Ga0070680_100002570 | Ga0070680_1000025707 | 164 |
| 262 | 3300005336 | Ga0070680_100003391 | Ga0070680_1000033911 | 164 |
| 263 | 3300005336 | Ga0070680_100064048 | Ga0070680_1000640484 | 164 |
| 264 | 3300005336 | Ga0070680_100142075 | Ga0070680_1001420754 | 164 |
| 265 | 3300005336 | Ga0070680_100264351 | Ga0070680_1002643513 | 164 |
| 266 | 3300005336 | Ga0070680_100562030 | Ga0070680_1005620302 | 164 |
| 267 | 3300005337 | Ga0070682_100028197 | Ga0070682_1000281975 | 164 |
| 268 | 3300005338 | Ga0068868_100023182 | Ga0068868_1000231825 | 164 |
| 269 | 3300005338 | Ga0068868_100786408 | Ga0068868_1007864081 | 164 |
| 270 | 3300005339 | Ga0070660_100000116 | Ga0070660_1000001164 | 164 |
| 271 | 3300005339 | Ga0070660_100065600 | Ga0070660_1000656003 | 164 |
| 272 | 3300005339 | Ga0070660_100125794 | Ga0070660_1001257941 | 164 |
| 273 | 3300005339 | Ga0070660_100187132 | Ga0070660_1001871322 | 164 |
| 274 | 3300005339 | Ga0070660_100260417 | Ga0070660_1002604173 | 164 |
| 275 | 3300005343 | Ga0070687_100081787 | Ga0070687_1000817874 | 164 |
| 276 | 3300005344 | Ga0070661_100034113 | Ga0070661_1000341135 | 164 |
| 277 | 3300005344 | Ga0070661_100056555 | Ga0070661_1000565554 | 164 |
| 278 | 3300005344 | Ga0070661_100066827 | Ga0070661_1000668272 | 164 |
| 279 | 3300005344 | Ga0070661_100092574 | Ga0070661_1000925744 | 164 |
| 280 | 3300005344 | Ga0070661_100115020 | Ga0070661_1001150204 | 164 |
| 281 | 3300005344 | Ga0070661_100169222 | Ga0070661_1001692222 | 164 |
| 282 | 3300005344 | Ga0070661_100422322 | Ga0070661_1004223221 | 164 |
| 283 | 3300005344 | Ga0070661_100579965 | Ga0070661_1005799652 | 164 |
| 284 | 3300005345 | Ga0070692_10051674 | Ga0070692_100516743 | 164 |
| 285 | 3300005347 | Ga0070668_100117202 | Ga0070668_1001172023 | 164 |
| 286 | 3300005354 | Ga0070675_100067188 | Ga0070675_1000671883 | 164 |
| 287 | 3300005355 | Ga0070671_100004853 | Ga0070671_1000048534 | 164 |
| 288 | 3300005355 | Ga0070671_100010817 | Ga0070671_1000108173 | 164 |
| 289 | 3300005355 | Ga0070671_100071911 | Ga0070671_1000719113 | 164 |
| 290 | 3300005355 | Ga0070671_100277161 | Ga0070671_1002771612 | 164 |
| 291 | 3300005356 | Ga0070674_100001041 | Ga0070674_1000010418 | 164 |
| 292 | 3300005356 | Ga0070674_100712826 | Ga0070674_1007128262 | 164 |
| 293 | 3300005364 | Ga0070673_100002158 | Ga0070673_10000215810 | 164 |
| 294 | 3300005364 | Ga0070673_100703920 | Ga0070673_1007039202 | 164 |
| 295 | 3300005366 | Ga0070659_100015457 | Ga0070659_1000154572 | 164 |
| 296 | 3300005366 | Ga0070659_100154794 | Ga0070659_1001547942 | 164 |
| 297 | 3300005367 | Ga0070667_100201843 | Ga0070667_1002018431 | 164 |
| 298 | 3300005367 | Ga0070667_100240611 | Ga0070667_1002406113 | 164 |
| 299 | 3300005367 | Ga0070667_100725410 | Ga0070667_1007254102 | 164 |
| 300 | 3300005434 | Ga0070709_10213133 | Ga0070709_102131331 | 164 |
| 301 | 3300005435 | Ga0070714_100076452 | Ga0070714_1000764524 | 164 |
| 302 | 3300005435 | Ga0070714_100177177 | Ga0070714_1001771773 | 164 |
| 303 | 3300005435 | Ga0070714_100423488 | Ga0070714_1004234883 | 164 |
| 304 | 3300005436 | Ga0070713_100392399 | Ga0070713_1003923993 | 164 |
| 305 | 3300005440 | Ga0070705_101049364 | Ga0070705_1010493641 | 164 |
| 306 | 3300005455 | Ga0070663_100007525 | Ga0070663_1000075256 | 164 |
| 307 | 3300005455 | Ga0070663_100035592 | Ga0070663_1000355924 | 164 |
| 308 | 3300005455 | Ga0070663_100053451 | Ga0070663_1000534513 | 164 |
| 309 | 3300005455 | Ga0070663_100111141 | Ga0070663_1001111412 | 164 |
| 310 | 3300005455 | Ga0070663_100214472 | Ga0070663_1002144722 | 164 |
| 311 | 3300005455 | Ga0070663_100351429 | Ga0070663_1003514291 | 164 |
| 312 | 3300005456 | Ga0070678_100002512 | Ga0070678_1000025124 | 164 |
| 313 | 3300005456 | Ga0070678_100035954 | Ga0070678_1000359543 | 164 |
| 314 | 3300005456 | Ga0070678_100158536 | Ga0070678_1001585364 | 164 |
| 315 | 3300005457 | Ga0070662_100011899 | Ga0070662_1000118995 | 164 |
| 316 | 3300005457 | Ga0070662_100033010 | Ga0070662_1000330104 | 164 |
| 317 | 3300005458 | Ga0070681_10168041 | Ga0070681_101680412 | 164 |
| 318 | 3300005458 | Ga0070681_10197569 | Ga0070681_101975693 | 164 |
| 319 | 3300005459 | Ga0068867_100016168 | Ga0068867_1000161684 | 164 |
| 320 | 3300005459 | Ga0068867_100407770 | Ga0068867_1004077702 | 164 |
| 321 | 3300005466 | Ga0070685_10158867 | Ga0070685_101588672 | 164 |
| 322 | 3300005530 | Ga0070679_100001280 | Ga0070679_1000012806 | 164 |
| 323 | 3300005530 | Ga0070679_100051365 | Ga0070679_1000513654 | 164 |
| 324 | 3300005530 | Ga0070679_100114225 | Ga0070679_1001142254 | 164 |
| 325 | 3300005530 | Ga0070679_100180111 | Ga0070679_1001801113 | 164 |
| 326 | 3300005530 | Ga0070679_100383486 | Ga0070679_1003834862 | 164 |
| 327 | 3300005530 | Ga0070679_100411131 | Ga0070679_1004111312 | 164 |
| 328 | 3300005530 | Ga0070679_100419355 | Ga0070679_1004193552 | 164 |
| 329 | 3300005530 | Ga0070679_100849406 | Ga0070679_1008494062 | 164 |
| 330 | 3300005535 | Ga0070684_100022154 | Ga0070684_1000221545 | 164 |
| 331 | 3300005535 | Ga0070684_100227627 | Ga0070684_1002276272 | 164 |
| 332 | 3300005535 | Ga0070684_101526187 | Ga0070684_1015261871 | 164 |
| 333 | 3300005539 | Ga0068853_100025046 | Ga0068853_1000250465 | 164 |
| 334 | 3300005539 | Ga0068853_100042084 | Ga0068853_1000420843 | 164 |
| 335 | 3300005539 | Ga0068853_100678983 | Ga0068853_1006789831 | 164 |
| 336 | 3300005543 | Ga0070672_100023951 | Ga0070672_1000239514 | 164 |
| 337 | 3300005543 | Ga0070672_100581068 | Ga0070672_1005810682 | 164 |
| 338 | 3300005547 | Ga0070693_100038234 | Ga0070693_1000382343 | 164 |
| 339 | 3300005548 | Ga0070665_100050275 | Ga0070665_1000502752 | 164 |
| 340 | 3300005548 | Ga0070665_100054124 | Ga0070665_1000541244 | 164 |
| 341 | 3300005563 | Ga0068855_100133670 | Ga0068855_1001336704 | 164 |
| 342 | 3300005563 | Ga0068855_100158273 | Ga0068855_1001582733 | 164 |
| 343 | 3300005563 | Ga0068855_100294100 | Ga0068855_1002941003 | 164 |
| 344 | 3300005564 | Ga0070664_100022314 | Ga0070664_1000223143 | 164 |
| 345 | 3300005564 | Ga0070664_100024085 | Ga0070664_1000240852 | 164 |
| 346 | 3300005564 | Ga0070664_100115233 | Ga0070664_1001152333 | 164 |
| 347 | 3300005564 | Ga0070664_100153259 | Ga0070664_1001532593 | 164 |
| 348 | 3300005564 | Ga0070664_100177887 | Ga0070664_1001778872 | 164 |
| 349 | 3300005564 | Ga0070664_100398754 | Ga0070664_1003987542 | 164 |
| 350 | 3300005564 | Ga0070664_101663490 | Ga0070664_1016634901 | 164 |
| 351 | 3300005577 | Ga0068857_100029971 | Ga0068857_1000299714 | 164 |
| 352 | 3300005577 | Ga0068857_100039813 | Ga0068857_1000398135 | 164 |
| 353 | 3300005577 | Ga0068857_100097331 | Ga0068857_1000973312 | 164 |
| 354 | 3300005577 | Ga0068857_101947232 | Ga0068857_1019472321 | 164 |
| 355 | 3300005578 | Ga0068854_100015728 | Ga0068854_1000157283 | 164 |
| 356 | 3300005578 | Ga0068854_100038221 | Ga0068854_1000382213 | 164 |
| 357 | 3300005578 | Ga0068854_100057624 | Ga0068854_1000576244 | 164 |
| 358 | 3300005578 | Ga0068854_100076822 | Ga0068854_1000768223 | 164 |
| 359 | 3300005578 | Ga0068854_100118414 | Ga0068854_1001184143 | 164 |
| 360 | 3300005614 | Ga0068856_100025157 | Ga0068856_1000251573 | 164 |
| 361 | 3300005614 | Ga0068856_100103479 | Ga0068856_1001034795 | 164 |
| 362 | 3300005614 | Ga0068856_100137062 | Ga0068856_1001370622 | 164 |
| 363 | 3300005614 | Ga0068856_100139472 | Ga0068856_1001394723 | 164 |
| 364 | 3300005614 | Ga0068856_100159498 | Ga0068856_1001594983 | 164 |
| 365 | 3300005614 | Ga0068856_100238050 | Ga0068856_1002380503 | 164 |
| 366 | 3300005614 | Ga0068856_100601497 | Ga0068856_1006014971 | 164 |
| 367 | 3300005616 | Ga0068852_100001974 | Ga0068852_1000019746 | 164 |
| 368 | 3300005616 | Ga0068852_100008915 | Ga0068852_1000089152 | 164 |
| 369 | 3300005616 | Ga0068852_100045286 | Ga0068852_1000452863 | 164 |
| 370 | 3300005616 | Ga0068852_100084192 | Ga0068852_1000841923 | 164 |
| 371 | 3300005616 | Ga0068852_100155966 | Ga0068852_1001559663 | 164 |
| 372 | 3300005616 | Ga0068852_100169832 | Ga0068852_1001698322 | 164 |
| 373 | 3300005616 | Ga0068852_100225645 | Ga0068852_1002256452 | 164 |
| 374 | 3300005616 | Ga0068852_100350399 | Ga0068852_1003503992 | 164 |
| 375 | 3300005616 | Ga0068852_100464934 | Ga0068852_1004649343 | 164 |
| 376 | 3300005616 | Ga0068852_100577573 | Ga0068852_1005775732 | 164 |
| 377 | 3300005616 | Ga0068852_100654747 | Ga0068852_1006547472 | 164 |
| 378 | 3300005616 | Ga0068852_100684457 | Ga0068852_1006844572 | 164 |
| 379 | 3300005618 | Ga0068864_100001341 | Ga0068864_10000134112 | 164 |
| 380 | 3300005718 | Ga0068866_10003689 | Ga0068866_100036892 | 164 |
| 381 | 3300005834 | Ga0068851_10090165 | Ga0068851_100901653 | 164 |
| 382 | 3300005834 | Ga0068851_10091637 | Ga0068851_100916372 | 164 |
| 383 | 3300005834 | Ga0068851_10247609 | Ga0068851_102476092 | 164 |
| 384 | 3300005840 | Ga0068870_10075085 | Ga0068870_100750851 | 164 |
| 385 | 3300005985 | Ga0081539_10021906 | Ga0081539_100219065 | 164 |
| 386 | 3300006028 | Ga0070717_10459431 | Ga0070717_104594312 | 164 |
| 387 | 3300006028 | Ga0070717_11154419 | Ga0070717_111544191 | 164 |
| 388 | 3300006237 | Ga0097621_100239918 | Ga0097621_1002399184 | 164 |
| 389 | 3300006237 | Ga0097621_100252407 | Ga0097621_1002524072 | 164 |
| 390 | 3300006358 | Ga0068871_100061949 | Ga0068871_1000619493 | 164 |
| 391 | 3300009093 | Ga0105240_10087384 | Ga0105240_100873843 | 164 |
| 392 | 3300009098 | Ga0105245_10020473 | Ga0105245_100204734 | 164 |
| 393 | 3300009098 | Ga0105245_10173471 | Ga0105245_101734714 | 164 |
| 394 | 3300009148 | Ga0105243_10049487 | Ga0105243_100494873 | 164 |
| 395 | 3300009174 | Ga0105241_10069833 | Ga0105241_100698332 | 164 |
| 396 | 3300009174 | Ga0105241_10088239 | Ga0105241_100882394 | 164 |
| 397 | 3300009174 | Ga0105241_10730713 | Ga0105241_107307132 | 164 |
| 398 | 3300009176 | Ga0105242_10566524 | Ga0105242_105665242 | 164 |
| 399 | 3300009177 | Ga0105248_10000660 | Ga0105248_1000066016 | 164 |
| 400 | 3300009177 | Ga0105248_10113704 | Ga0105248_101137042 | 164 |
| 401 | 3300009177 | Ga0105248_10500364 | Ga0105248_105003642 | 164 |
| 402 | 3300009177 | Ga0105248_11467141 | Ga0105248_114671412 | 164 |
| 403 | 3300009551 | Ga0105238_10153328 | Ga0105238_101533283 | 164 |
| 404 | 3300009551 | Ga0105238_10181866 | Ga0105238_101818663 | 164 |
| 405 | 3300009551 | Ga0105238_10348604 | Ga0105238_103486043 | 164 |
| 406 | 3300009551 | Ga0105238_11531707 | Ga0105238_115317071 | 164 |
| 407 | 3300010375 | Ga0105239_10649910 | Ga0105239_106499101 | 164 |
| 408 | 3300010375 | Ga0105239_12511807 | Ga0105239_125118071 | 164 |
| 409 | 3300011119 | Ga0105246_10068729 | Ga0105246_100687294 | 164 |
| 410 | 3300013100 | Ga0157373_10019690 | Ga0157373_100196903 | 164 |
| 411 | 3300013100 | Ga0157373_10163904 | Ga0157373_101639042 | 164 |
| 412 | 3300013100 | Ga0157373_10177479 | Ga0157373_101774792 | 164 |
| 413 | 3300013100 | Ga0157373_10376326 | Ga0157373_103763261 | 164 |
| 414 | 3300013100 | Ga0157373_10431701 | Ga0157373_104317012 | 164 |
| 415 | 3300013102 | Ga0157371_10052929 | Ga0157371_100529294 | 164 |
| 416 | 3300013102 | Ga0157371_10096234 | Ga0157371_100962341 | 164 |
| 417 | 3300013102 | Ga0157371_10124358 | Ga0157371_101243582 | 164 |
| 418 | 3300013102 | Ga0157371_10160181 | Ga0157371_101601811 | 164 |
| 419 | 3300013104 | Ga0157370_10000497 | Ga0157370_1000049719 | 164 |
| 420 | 3300013104 | Ga0157370_10010410 | Ga0157370_100104107 | 164 |
| 421 | 3300013104 | Ga0157370_10066402 | Ga0157370_100664024 | 164 |
| 422 | 3300013104 | Ga0157370_10116210 | Ga0157370_101162102 | 164 |
| 423 | 3300013104 | Ga0157370_10377737 | Ga0157370_103777372 | 164 |
| 424 | 3300013105 | Ga0157369_10003764 | Ga0157369_100037644 | 164 |
| 425 | 3300013105 | Ga0157369_10055446 | Ga0157369_100554463 | 164 |
| 426 | 3300013105 | Ga0157369_10200612 | Ga0157369_102006124 | 164 |
| 427 | 3300013105 | Ga0157369_10210792 | Ga0157369_102107922 | 164 |
| 428 | 3300013105 | Ga0157369_10284876 | Ga0157369_102848762 | 164 |
| 429 | 3300013105 | Ga0157369_10297134 | Ga0157369_102971342 | 164 |
| 430 | 3300013105 | Ga0157369_10475397 | Ga0157369_104753971 | 164 |
| 431 | 3300013105 | Ga0157369_10555183 | Ga0157369_105551832 | 164 |
| 432 | 3300013105 | Ga0157369_10927493 | Ga0157369_109274932 | 164 |
| 433 | 3300013296 | Ga0157374_10063506 | Ga0157374_100635064 | 164 |
| 434 | 3300013296 | Ga0157374_10138127 | Ga0157374_101381273 | 164 |
| 435 | 3300013296 | Ga0157374_10822399 | Ga0157374_108223992 | 164 |
| 436 | 3300013296 | Ga0157374_11670802 | Ga0157374_116708021 | 164 |
| 437 | 3300013297 | Ga0157378_10078794 | Ga0157378_100787944 | 164 |
| 438 | 3300013306 | Ga0163162_10364719 | Ga0163162_103647193 | 164 |
| 439 | 3300013306 | Ga0163162_10640486 | Ga0163162_106404861 | 164 |
| 440 | 3300013306 | Ga0163162_10753145 | Ga0163162_107531451 | 164 |
| 441 | 3300013307 | Ga0157372_10026426 | Ga0157372_100264263 | 164 |
| 442 | 3300013307 | Ga0157372_10218786 | Ga0157372_102187863 | 164 |
| 443 | 3300013307 | Ga0157372_10257274 | Ga0157372_102572744 | 164 |
| 444 | 3300013307 | Ga0157372_10319279 | Ga0157372_103192792 | 164 |
| 445 | 3300013307 | Ga0157372_10768190 | Ga0157372_107681902 | 164 |
| 446 | 3300013307 | Ga0157372_11821417 | Ga0157372_118214172 | 164 |
| 447 | 3300013308 | Ga0157375_10119529 | Ga0157375_101195293 | 164 |
| 448 | 3300013308 | Ga0157375_10489511 | Ga0157375_104895112 | 164 |
| 449 | 3300014497 | Ga0182008_10208012 | Ga0182008_102080122 | 164 |
| 450 | 3300017792 | Ga0163161_10061919 | Ga0163161_100619193 | 164 |
| 451 | 3300025315 | Ga0207697_10013257 | Ga0207697_100132573 | 164 |
| 452 | 3300025315 | Ga0207697_10085278 | Ga0207697_100852782 | 164 |
| 453 | 3300025321 | Ga0207656_10046355 | Ga0207656_100463552 | 164 |
| 454 | 3300025321 | Ga0207656_10101231 | Ga0207656_101012311 | 164 |
| 455 | 3300025321 | Ga0207656_10179386 | Ga0207656_101793862 | 164 |
| 456 | 3300025893 | Ga0207682_10047157 | Ga0207682_100471574 | 164 |
| 457 | 3300025893 | Ga0207682_10194039 | Ga0207682_101940392 | 164 |
| 458 | 3300025899 | Ga0207642_10002131 | Ga0207642_100021313 | 164 |
| 459 | 3300025901 | Ga0207688_10021461 | Ga0207688_100214614 | 164 |
| 460 | 3300025903 | Ga0207680_10259622 | Ga0207680_102596222 | 164 |
| 461 | 3300025904 | Ga0207647_10015640 | Ga0207647_100156403 | 164 |
| 462 | 3300025904 | Ga0207647_10076374 | Ga0207647_100763742 | 164 |
| 463 | 3300025904 | Ga0207647_10097855 | Ga0207647_100978553 | 164 |
| 464 | 3300025904 | Ga0207647_10099897 | Ga0207647_100998972 | 164 |
| 465 | 3300025907 | Ga0207645_10052507 | Ga0207645_100525073 | 164 |
| 466 | 3300025907 | Ga0207645_10082460 | Ga0207645_100824603 | 164 |
| 467 | 3300025908 | Ga0207643_10223166 | Ga0207643_102231662 | 164 |
| 468 | 3300025909 | Ga0207705_10000123 | Ga0207705_1000012354 | 164 |
| 469 | 3300025909 | Ga0207705_10004136 | Ga0207705_100041366 | 164 |
| 470 | 3300025909 | Ga0207705_10015028 | Ga0207705_100150284 | 164 |
| 471 | 3300025909 | Ga0207705_10027408 | Ga0207705_100274084 | 164 |
| 472 | 3300025909 | Ga0207705_10049597 | Ga0207705_100495973 | 164 |
| 473 | 3300025909 | Ga0207705_10063830 | Ga0207705_100638303 | 164 |
| 474 | 3300025909 | Ga0207705_10092079 | Ga0207705_100920792 | 164 |
| 475 | 3300025909 | Ga0207705_10173743 | Ga0207705_101737432 | 164 |
| 476 | 3300025912 | Ga0207707_10100523 | Ga0207707_101005231 | 164 |
| 477 | 3300025912 | Ga0207707_10354541 | Ga0207707_103545413 | 164 |
| 478 | 3300025912 | Ga0207707_10437660 | Ga0207707_104376602 | 164 |
| 479 | 3300025912 | Ga0207707_10945419 | Ga0207707_109454191 | 164 |
| 480 | 3300025917 | Ga0207660_10000052 | Ga0207660_1000005213 | 164 |
| 481 | 3300025917 | Ga0207660_10001036 | Ga0207660_100010367 | 164 |
| 482 | 3300025917 | Ga0207660_10108985 | Ga0207660_101089852 | 164 |
| 483 | 3300025918 | Ga0207662_10008372 | Ga0207662_100083723 | 164 |
| 484 | 3300025919 | Ga0207657_10000650 | Ga0207657_1000065046 | 164 |
| 485 | 3300025919 | Ga0207657_10004176 | Ga0207657_100041767 | 164 |
| 486 | 3300025919 | Ga0207657_10018661 | Ga0207657_100186615 | 164 |
| 487 | 3300025919 | Ga0207657_10040902 | Ga0207657_100409024 | 164 |
| 488 | 3300025919 | Ga0207657_10167958 | Ga0207657_101679582 | 164 |
| 489 | 3300025919 | Ga0207657_10371085 | Ga0207657_103710852 | 164 |
| 490 | 3300025920 | Ga0207649_10024391 | Ga0207649_100243915 | 164 |
| 491 | 3300025920 | Ga0207649_10031257 | Ga0207649_100312575 | 164 |
| 492 | 3300025920 | Ga0207649_10035609 | Ga0207649_100356093 | 164 |
| 493 | 3300025920 | Ga0207649_10036486 | Ga0207649_100364864 | 164 |
| 494 | 3300025920 | Ga0207649_10061403 | Ga0207649_100614033 | 164 |
| 495 | 3300025920 | Ga0207649_10091115 | Ga0207649_100911152 | 164 |
| 496 | 3300025920 | Ga0207649_10188709 | Ga0207649_101887091 | 164 |
| 497 | 3300025920 | Ga0207649_10263185 | Ga0207649_102631852 | 164 |
| 498 | 3300025920 | Ga0207649_10372703 | Ga0207649_103727032 | 164 |
| 499 | 3300025921 | Ga0207652_10000034 | Ga0207652_1000003460 | 164 |
| 500 | 3300025921 | Ga0207652_10133879 | Ga0207652_101338792 | 164 |
| 501 | 3300025921 | Ga0207652_10138846 | Ga0207652_101388463 | 164 |
| 502 | 3300025921 | Ga0207652_10362730 | Ga0207652_103627302 | 164 |
| 503 | 3300025921 | Ga0207652_10929361 | Ga0207652_109293612 | 164 |
| 504 | 3300025923 | Ga0207681_10117399 | Ga0207681_101173994 | 164 |
| 505 | 3300025924 | Ga0207694_10505937 | Ga0207694_105059372 | 164 |
| 506 | 3300025924 | Ga0207694_10966583 | Ga0207694_109665832 | 164 |
| 507 | 3300025924 | Ga0207694_11371767 | Ga0207694_113717671 | 164 |
| 508 | 3300025925 | Ga0207650_10091632 | Ga0207650_100916321 | 164 |
| 509 | 3300025925 | Ga0207650_10426663 | Ga0207650_104266632 | 164 |
| 510 | 3300025926 | Ga0207659_10255537 | Ga0207659_102555373 | 164 |
| 511 | 3300025927 | Ga0207687_10013791 | Ga0207687_100137914 | 164 |
| 512 | 3300025927 | Ga0207687_10023383 | Ga0207687_100233834 | 164 |
| 513 | 3300025928 | Ga0207700_10339840 | Ga0207700_103398403 | 164 |
| 514 | 3300025929 | Ga0207664_10008734 | Ga0207664_100087343 | 164 |
| 515 | 3300025929 | Ga0207664_10069171 | Ga0207664_100691713 | 164 |
| 516 | 3300025929 | Ga0207664_10457049 | Ga0207664_104570492 | 164 |
| 517 | 3300025931 | Ga0207644_10024565 | Ga0207644_100245655 | 164 |
| 518 | 3300025931 | Ga0207644_10031115 | Ga0207644_100311153 | 164 |
| 519 | 3300025931 | Ga0207644_10032830 | Ga0207644_100328303 | 164 |
| 520 | 3300025931 | Ga0207644_10057593 | Ga0207644_100575933 | 164 |
| 521 | 3300025931 | Ga0207644_10085255 | Ga0207644_100852552 | 164 |
| 522 | 3300025932 | Ga0207690_10011299 | Ga0207690_100112993 | 164 |
| 523 | 3300025932 | Ga0207690_10038358 | Ga0207690_100383583 | 164 |
| 524 | 3300025932 | Ga0207690_10063463 | Ga0207690_100634634 | 164 |
| 525 | 3300025932 | Ga0207690_10215168 | Ga0207690_102151681 | 164 |
| 526 | 3300025932 | Ga0207690_10394337 | Ga0207690_103943373 | 164 |
| 527 | 3300025932 | Ga0207690_10458401 | Ga0207690_104584012 | 164 |
| 528 | 3300025933 | Ga0207706_10019926 | Ga0207706_100199265 | 164 |
| 529 | 3300025933 | Ga0207706_10071990 | Ga0207706_100719903 | 164 |
| 530 | 3300025933 | Ga0207706_10077257 | Ga0207706_100772572 | 164 |
| 531 | 3300025933 | Ga0207706_10103934 | Ga0207706_101039344 | 164 |
| 532 | 3300025933 | Ga0207706_10106354 | Ga0207706_101063543 | 164 |
| 533 | 3300025934 | Ga0207686_10419651 | Ga0207686_104196512 | 164 |
| 534 | 3300025935 | Ga0207709_10037346 | Ga0207709_100373463 | 164 |
| 535 | 3300025937 | Ga0207669_10002786 | Ga0207669_100027865 | 164 |
| 536 | 3300025937 | Ga0207669_10589777 | Ga0207669_105897772 | 164 |
| 537 | 3300025938 | Ga0207704_10056717 | Ga0207704_100567173 | 164 |
| 538 | 3300025938 | Ga0207704_10278045 | Ga0207704_102780452 | 164 |
| 539 | 3300025940 | Ga0207691_10044268 | Ga0207691_100442683 | 164 |
| 540 | 3300025940 | Ga0207691_10230701 | Ga0207691_102307012 | 164 |
| 541 | 3300025940 | Ga0207691_10656417 | Ga0207691_106564172 | 164 |
| 542 | 3300025940 | Ga0207691_10821838 | Ga0207691_108218382 | 164 |
| 543 | 3300025941 | Ga0207711_10007812 | Ga0207711_100078126 | 164 |
| 544 | 3300025941 | Ga0207711_10235124 | Ga0207711_102351242 | 164 |
| 545 | 3300025941 | Ga0207711_10475502 | Ga0207711_104755023 | 164 |
| 546 | 3300025941 | Ga0207711_11007433 | Ga0207711_110074331 | 164 |
| 547 | 3300025942 | Ga0207689_10040941 | Ga0207689_100409414 | 164 |
| 548 | 3300025944 | Ga0207661_10001415 | Ga0207661_100014158 | 164 |
| 549 | 3300025944 | Ga0207661_10062788 | Ga0207661_100627882 | 164 |
| 550 | 3300025944 | Ga0207661_10091195 | Ga0207661_100911952 | 164 |
| 551 | 3300025944 | Ga0207661_10595769 | Ga0207661_105957691 | 164 |
| 552 | 3300025944 | Ga0207661_10635234 | Ga0207661_106352341 | 164 |
| 553 | 3300025945 | Ga0207679_10023879 | Ga0207679_100238794 | 164 |
| 554 | 3300025945 | Ga0207679_10051339 | Ga0207679_100513394 | 164 |
| 555 | 3300025945 | Ga0207679_10145398 | Ga0207679_101453984 | 164 |
| 556 | 3300025945 | Ga0207679_10275284 | Ga0207679_102752842 | 164 |
| 557 | 3300025945 | Ga0207679_10447927 | Ga0207679_104479272 | 164 |
| 558 | 3300025949 | Ga0207667_10022070 | Ga0207667_100220704 | 164 |
| 559 | 3300025949 | Ga0207667_10236562 | Ga0207667_102365622 | 164 |
| 560 | 3300025949 | Ga0207667_11012203 | Ga0207667_110122032 | 164 |
| 561 | 3300025960 | Ga0207651_10028843 | Ga0207651_100288434 | 164 |
| 562 | 3300025960 | Ga0207651_10139789 | Ga0207651_101397894 | 164 |
| 563 | 3300025972 | Ga0207668_10155655 | Ga0207668_101556553 | 164 |
| 564 | 3300025981 | Ga0207640_10018554 | Ga0207640_100185545 | 164 |
| 565 | 3300025981 | Ga0207640_10097059 | Ga0207640_100970592 | 164 |
| 566 | 3300025981 | Ga0207640_10430562 | Ga0207640_104305622 | 164 |
| 567 | 3300025986 | Ga0207658_10063588 | Ga0207658_100635884 | 164 |
| 568 | 3300025986 | Ga0207658_10198854 | Ga0207658_101988542 | 164 |
| 569 | 3300025986 | Ga0207658_10270879 | Ga0207658_102708792 | 164 |
| 570 | 3300026023 | Ga0207677_10006119 | Ga0207677_100061193 | 164 |
| 571 | 3300026023 | Ga0207677_10011379 | Ga0207677_100113793 | 164 |
| 572 | 3300026023 | Ga0207677_10152897 | Ga0207677_101528972 | 164 |
| 573 | 3300026023 | Ga0207677_10282520 | Ga0207677_102825202 | 164 |
| 574 | 3300026041 | Ga0207639_10089776 | Ga0207639_100897763 | 164 |
| 575 | 3300026041 | Ga0207639_10646373 | Ga0207639_106463732 | 164 |
| 576 | 3300026067 | Ga0207678_10000530 | Ga0207678_1000053025 | 164 |
| 577 | 3300026067 | Ga0207678_10002494 | Ga0207678_1000249413 | 164 |
| 578 | 3300026067 | Ga0207678_10021744 | Ga0207678_100217447 | 164 |
| 579 | 3300026067 | Ga0207678_10024326 | Ga0207678_100243264 | 164 |
| 580 | 3300026067 | Ga0207678_10027197 | Ga0207678_100271973 | 164 |
| 581 | 3300026067 | Ga0207678_10041478 | Ga0207678_100414783 | 164 |
| 582 | 3300026067 | Ga0207678_10186931 | Ga0207678_101869312 | 164 |
| 583 | 3300026067 | Ga0207678_10201626 | Ga0207678_102016262 | 164 |
| 584 | 3300026067 | Ga0207678_10354892 | Ga0207678_103548923 | 164 |
| 585 | 3300026067 | Ga0207678_10453569 | Ga0207678_104535691 | 164 |
| 586 | 3300026078 | Ga0207702_10018792 | Ga0207702_100187925 | 164 |
| 587 | 3300026078 | Ga0207702_10050657 | Ga0207702_100506572 | 164 |
| 588 | 3300026078 | Ga0207702_10385662 | Ga0207702_103856621 | 164 |
| 589 | 3300026078 | Ga0207702_10432780 | Ga0207702_104327803 | 164 |
| 590 | 3300026088 | Ga0207641_10029554 | Ga0207641_100295544 | 164 |
| 591 | 3300026088 | Ga0207641_10735453 | Ga0207641_107354531 | 164 |
| 592 | 3300026089 | Ga0207648_10011451 | Ga0207648_100114515 | 164 |
| 593 | 3300026089 | Ga0207648_10068994 | Ga0207648_100689943 | 164 |
| 594 | 3300026089 | Ga0207648_10456212 | Ga0207648_104562121 | 164 |
| 595 | 3300026095 | Ga0207676_10000253 | Ga0207676_1000025323 | 164 |
| 596 | 3300026095 | Ga0207676_10122960 | Ga0207676_101229604 | 164 |
| 597 | 3300026116 | Ga0207674_10004040 | Ga0207674_100040408 | 164 |
| 598 | 3300026116 | Ga0207674_10013613 | Ga0207674_100136134 | 164 |
| 599 | 3300026116 | Ga0207674_10032947 | Ga0207674_100329473 | 164 |
| 600 | 3300026121 | Ga0207683_10010831 | Ga0207683_100108315 | 164 |
| 601 | 3300026121 | Ga0207683_10049063 | Ga0207683_100490632 | 164 |
| 602 | 3300026121 | Ga0207683_10106564 | Ga0207683_101065643 | 164 |
| 603 | 3300026142 | Ga0207698_10015169 | Ga0207698_100151694 | 164 |
| 604 | 3300026142 | Ga0207698_10023566 | Ga0207698_100235665 | 164 |
| 605 | 3300026142 | Ga0207698_10079393 | Ga0207698_100793934 | 164 |
| 606 | 3300026142 | Ga0207698_10090038 | Ga0207698_100900383 | 164 |
| 607 | 3300026142 | Ga0207698_10188999 | Ga0207698_101889992 | 164 |
| 608 | 3300026142 | Ga0207698_10200030 | Ga0207698_102000302 | 164 |
| 609 | 3300026142 | Ga0207698_10205832 | Ga0207698_102058323 | 164 |
| 610 | 3300026142 | Ga0207698_10504304 | Ga0207698_105043043 | 164 |
| 611 | 3300026142 | Ga0207698_10957347 | Ga0207698_109573471 | 164 |
| 612 | 3300028379 | Ga0268266_10113944 | Ga0268266_101139444 | 164 |
| 613 | 3300031548 | Ga0307408_100043976 | Ga0307408_1000439762 | 164 |
| 614 | 3300031548 | Ga0307408_100968228 | Ga0307408_1009682282 | 164 |
| 615 | 3300031731 | Ga0307405_10036075 | Ga0307405_100360752 | 164 |
| 616 | 3300031731 | Ga0307405_11123725 | Ga0307405_111237251 | 164 |
| 617 | 3300031824 | Ga0307413_10020497 | Ga0307413_100204972 | 164 |
| 618 | 3300031852 | Ga0307410_10045770 | Ga0307410_100457702 | 164 |
| 619 | 3300031995 | Ga0307409_100035870 | Ga0307409_1000358703 | 164 |
| 620 | 3300031995 | Ga0307409_100063136 | Ga0307409_1000631362 | 164 |
| 621 | 3300032002 | Ga0307416_100012031 | Ga0307416_1000120313 | 164 |
| 622 | 3300032004 | Ga0307414_10222938 | Ga0307414_102229383 | 164 |
| 623 | 3300032005 | Ga0307411_10035683 | Ga0307411_100356832 | 164 |
| 624 | 3300032005 | Ga0307411_10118565 | Ga0307411_101185651 | 164 |
| 625 | 3300032005 | Ga0307411_10699818 | Ga0307411_106998182 | 164 |
| 626 | 3300032126 | Ga0307415_100056377 | Ga0307415_1000563773 | 164 |
| 627 | 3300032126 | Ga0307415_100407050 | Ga0307415_1004070502 | 164 |
| 628 | 3300035170 | Ga0373943_0006847 | Ga0373943_0006847_1303_1797 | 164 |
| 629 | 3300035171 | Ga0373946_0005931 | Ga0373946_0005931_2889_3383 | 164 |
| 630 | 3300035695 | Ga0373927_0027773 | Ga0373927_0027773_1271_1765 | 164 |
| 631 | 3300035725 | Ga0373947_0279550 | Ga0373947_0279550_91_585 | 164 |
| 632 | 3300036401 | Ga0373937_0590848 | Ga0373937_0590848_244_738 | 164 |
| 633 | 3300037068 | Ga0373925_0009468 | Ga0373925_0009468_4905_5399 | 164 |
| 634 | 3300037312 | Ga0395899_0012920 | Ga0395899_0012920_3496_3990 | 164 |
| 635 | 3300037312 | Ga0395899_0087703 | Ga0395899_0087703_1182_1676 | 164 |
| 636 | 3300037312 | Ga0395899_0213781 | Ga0395899_0213781_245_739 | 164 |
| 637 | 3300037418 | Ga0395900_0008653 | Ga0395900_0008653_6467_6961 | 164 |
| 638 | 3300037418 | Ga0395900_0031013 | Ga0395900_0031013_1157_1651 | 164 |
| 639 | 3300037418 | Ga0395900_0106995 | Ga0395900_0106995_1317_1811 | 164 |
| 640 | 3300037418 | Ga0395900_0145515 | Ga0395900_0145515_389_883 | 164 |
| 641 | 3300037418 | Ga0395900_0166674 | Ga0395900_0166674_789_1283 | 164 |
| 642 | 3300037418 | Ga0395900_0249855 | Ga0395900_0249855_343_837 | 164 |
| 643 | 3300037418 | Ga0395900_0297424 | Ga0395900_0297424_517_1011 | 164 |
| 644 | 3300037418 | Ga0395900_0457506 | Ga0395900_0457506_28_522 | 164 |
| 645 | 3300037418 | Ga0395900_1028271 | Ga0395900_1028271_140_634 | 164 |
| 646 | 3300037466 | Ga0395898_0016450 | Ga0395898_0016450_3580_4074 | 164 |
| 647 | 3300037466 | Ga0395898_0204646 | Ga0395898_0204646_462_956 | 164 |
| 648 | 3300037466 | Ga0395898_0365318 | Ga0395898_0365318_825_1319 | 164 |
| 649 | 3300037466 | Ga0395898_0389936 | Ga0395898_0389936_424_918 | 164 |
| 650 | 3300037466 | Ga0395898_0421527 | Ga0395898_0421527_197_691 | 164 |
| 651 | 3300037471 | Ga0395905_0002464 | Ga0395905_0002464_16689_17183 | 164 |
| 652 | 3300037471 | Ga0395905_0006500 | Ga0395905_0006500_7489_7983 | 164 |
| 653 | 3300037471 | Ga0395905_0008333 | Ga0395905_0008333_5277_5771 | 164 |
| 654 | 3300037471 | Ga0395905_0105299 | Ga0395905_0105299_977_1471 | 164 |
| 655 | 3300037471 | Ga0395905_0134636 | Ga0395905_0134636_305_799 | 164 |
| 656 | 3300037471 | Ga0395905_0229689 | Ga0395905_0229689_874_1368 | 164 |
| 657 | 3300037471 | Ga0395905_0337027 | Ga0395905_0337027_412_909 | 164 |
| 658 | 3300037471 | Ga0395905_0391059 | Ga0395905_0391059_605_1099 | 164 |
| 659 | 3300038443 | Ga0395901_0002597 | Ga0395901_0002597_16245_16739 | 164 |
| 660 | 3300038443 | Ga0395901_0012345 | Ga0395901_0012345_3994_4488 | 164 |
| 661 | 3300038443 | Ga0395901_0073739 | Ga0395901_0073739_1245_1739 | 164 |
| 662 | 3300038443 | Ga0395901_0082883 | Ga0395901_0082883_1014_1508 | 164 |
| 663 | 3300038443 | Ga0395901_0281365 | Ga0395901_0281365_657_1151 | 164 |
| 664 | 3300038443 | Ga0395901_0442866 | Ga0395901_0442866_725_1219 | 164 |
| 665 | 3300038443 | Ga0395901_0504295 | Ga0395901_0504295_710_1204 | 164 |
| 666 | 3300039437 | Ga0436365_0531315 | Ga0436365_0531315_1648_2142 | 164 |
| 667 | 3300039450 | Ga0436363_0375292 | Ga0436363_0375292_100_594 | 164 |
| 668 | 3300039450 | Ga0436363_0692539 | Ga0436363_0692539_94_588 | 164 |
| 669 | 3300041413 | Ga0439465_0031904 | Ga0439465_0031904_827_1321 | 164 |
| 670 | 3300042005 | Ga0439448_0138677 | Ga0439448_0138677_318_815 | 164 |
| 671 | 3300042006 | Ga0439432_015655 | Ga0439432_015655_554_1048 | 164 |
| 672 | 3300042007 | Ga0439449_0013260 | Ga0439449_0013260_77_571 | 164 |
| 673 | 3300042157 | Ga0439458_0008142 | Ga0439458_0008142_169_666 | 164 |
| 674 | 3300044656 | Ga0466969_0141262 | Ga0466969_0141262_566_1060 | 164 |
| 675 | 3300044656 | Ga0466969_0157790 | Ga0466969_0157790_446_946 | 164 |
| 676 | 3300044658 | Ga0466972_0151989 | Ga0466972_0151989_213_707 | 164 |
| 677 | 3300044683 | Ga0466965_0220158 | Ga0466965_0220158_67_561 | 164 |
| 678 | 3300044684 | Ga0466966_0002429 | Ga0466966_0002429_1137_1631 | 164 |
| 679 | 3300044684 | Ga0466966_0052512 | Ga0466966_0052512_677_1177 | 164 |
| 680 | 3300044684 | Ga0466966_0602446 | Ga0466966_0602446_58_552 | 164 |
| 681 | 3300044693 | Ga0466961_0038704 | Ga0466961_0038704_169_663 | 164 |
| 682 | 3300044693 | Ga0466961_0082694 | Ga0466961_0082694_870_1364 | 164 |
| 683 | 3300044693 | Ga0466961_0105199 | Ga0466961_0105199_118_618 | 164 |
| 684 | 3300044693 | Ga0466961_0229477 | Ga0466961_0229477_562_1062 | 164 |
| 685 | 3300044694 | Ga0466963_0014749 | Ga0466963_0014749_1553_2047 | 164 |
| 686 | 3300044694 | Ga0466963_0032293 | Ga0466963_0032293_1042_1536 | 164 |
| 687 | 3300044694 | Ga0466963_0323330 | Ga0466963_0323330_340_834 | 164 |
| 688 | 3300044706 | Ga0466964_0091615 | Ga0466964_0091615_797_1291 | 164 |
| 689 | 3300044719 | Ga0466971_0072983 | Ga0466971_0072983_863_1357 | 164 |
| 690 | 3300044765 | Ga0466970_0397746 | Ga0466970_0397746_270_764 | 164 |
| 691 | 3300044765 | Ga0466970_0544963 | Ga0466970_0544963_85_579 | 164 |
| 692 | 3300044765 | Ga0466970_0647722 | Ga0466970_0647722_20_514 | 164 |
| 693 | 3300044842 | Ga0466957_0119646 | Ga0466957_0119646_536_1030 | 164 |
| 694 | 3300044901 | Ga0466960_0011619 | Ga0466960_0011619_767_1261 | 164 |
| 695 | 3300045049 | Ga0466959_0106303 | Ga0466959_0106303_908_1402 | 164 |
| 696 | 3300045049 | Ga0466959_0251547 | Ga0466959_0251547_715_1209 | 164 |
| 697 | 3300045049 | Ga0466959_0308188 | Ga0466959_0308188_73_567 | 164 |
| 698 | 3300045049 | Ga0466959_0760919 | Ga0466959_0760919_38_538 | 164 |
| 699 | 3300045836 | Ga0466958_0031080 | Ga0466958_0031080_1921_2415 | 164 |
| 700 | 3300045836 | Ga0466958_0084439 | Ga0466958_0084439_521_1015 | 164 |
| 701 | 3300045976 | Ga0466967_0012199 | Ga0466967_0012199_5708_6205 | 164 |
| 702 | 3300045976 | Ga0466967_0029471 | Ga0466967_0029471_2911_3405 | 164 |
| 703 | 3300045976 | Ga0466967_0117321 | Ga0466967_0117321_739_1233 | 164 |
| 704 | 3300045976 | Ga0466967_0278158 | Ga0466967_0278158_1008_1505 | 164 |
| 705 | 3300045976 | Ga0466967_0425157 | Ga0466967_0425157_382_876 | 164 |
| 706 | 3300046525 | Ga0495663_0104611 | Ga0495663_0104611_106_603 | 164 |
| 707 | 3300046537 | Ga0495598_0000941 | Ga0495598_0000941_374_868 | 164 |
| 708 | 3300046539 | Ga0495621_0014678 | Ga0495621_0014678_1054_1548 | 164 |
| 709 | 3300046558 | Ga0495633_0023509 | Ga0495633_0023509_972_1466 | 164 |
| 710 | 3300046664 | Ga0495659_0101253 | Ga0495659_0101253_392_886 | 164 |
| 711 | 3300046684 | Ga0495669_0062763 | Ga0495669_0062763_488_982 | 164 |
| 712 | 3300046684 | Ga0495669_0126323 | Ga0495669_0126323_363_863 | 164 |
| 713 | 3300046684 | Ga0495669_0154984 | Ga0495669_0154984_125_619 | 164 |
| 714 | 3300046684 | Ga0495669_0308209 | Ga0495669_0308209_210_707 | 164 |
| 715 | 3300046691 | Ga0495670_0006379 | Ga0495670_0006379_3858_4352 | 164 |
| 716 | 3300046691 | Ga0495670_0319615 | Ga0495670_0319615_98_598 | 164 |
| 717 | 3300047445 | Ga0495677_0021229 | Ga0495677_0021229_1100_1594 | 164 |
| 718 | 3300048903 | Ga0496100_0124551 | Ga0496100_0124551_643_1140 | 164 |
| 719 | 3300048904 | Ga0496101_0012456 | Ga0496101_0012456_4072_4569 | 164 |
| 720 | 3300048905 | Ga0496102_0018790 | Ga0496102_0018790_4934_5428 | 164 |
| 721 | 3300048909 | Ga0496106_0024396 | Ga0496106_0024396_2316_2813 | 164 |
| 722 | 3300048909 | Ga0496106_0129789 | Ga0496106_0129789_781_1275 | 164 |
| 723 | 3300048910 | Ga0496107_0072222 | Ga0496107_0072222_672_1169 | 164 |
| 724 | 3300048910 | Ga0496107_0106531 | Ga0496107_0106531_1289_1783 | 164 |
| 725 | 3300048910 | Ga0496107_0607199 | Ga0496107_0607199_173_667 | 164 |
| 726 | 3300048912 | Ga0496109_0000995 | Ga0496109_0000995_16846_17343 | 164 |
| 727 | 3300048912 | Ga0496109_0225849 | Ga0496109_0225849_933_1427 | 164 |
| 728 | 3300048912 | Ga0496109_0663231 | Ga0496109_0663231_53_547 | 164 |
| 729 | 3300048913 | Ga0496110_0005992 | Ga0496110_0005992_3655_4152 | 164 |
| 730 | 3300048914 | Ga0496111_0023557 | Ga0496111_0023557_1126_1623 | 164 |
| 731 | 3300048915 | Ga0496112_0005455 | Ga0496112_0005455_9987_10484 | 164 |
| 732 | 3300048915 | Ga0496112_0119024 | Ga0496112_0119024_1912_2406 | 164 |
| 733 | 3300048916 | Ga0496113_0252889 | Ga0496113_0252889_283_777 | 164 |
| 734 | 3300049656 | Ga0501209_001155 | Ga0501209_001155_1482_1976 | 164 |
| 735 | 3300049664 | Ga0501224_001917 | Ga0501224_001917_1177_1671 | 164 |
| 736 | 3300049669 | Ga0501235_007338 | Ga0501235_007338_107_601 | 164 |
| 737 | 3300049679 | Ga0501249_003896 | Ga0501249_003896_1432_1926 | 164 |
| 738 | 3300049706 | Ga0501229_024122 | Ga0501229_024122_223_717 | 164 |
| 739 | 3300049760 | Ga0501263_003457 | Ga0501263_003457_841_1335 | 164 |
| 740 | 3300049765 | Ga0501268_037296 | Ga0501268_037296_311_805 | 164 |
| 741 | 3300049767 | Ga0501270_001256 | Ga0501270_001256_1812_2306 | 164 |
| 742 | 3300061719 | Ga0466962_0115330 | Ga0466962_0115330_729_1223 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9233 | 47 | 92 |
| 4fht-assembly1.cif.gz_A | crystal structure of the pcav transcriptional regulator from streptomyces coelicolor in complex with its natural ligand | 0.9229 | 35 | 98 |
| 4g9y-assembly1.cif.gz_A-2 | crystal structure of the pcav transcriptional regulator from streptomyces coelicolor | 0.9002 | 35 | 102 |
| 5zuo-assembly1.cif.gz_A | crystal structure of bz junction in diverse sequence | 0.8976 | 48 | 92 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.8939 | 36 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FTK6_47_112_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.99 | 47 | 92 | 1.10.10.10 |
| af_P32910_88_152_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9723 | 47 | 91 | 1.10.10.10 |
| af_O94553_84_149_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9614 | 47 | 91 | 1.10.10.10 |
| af_Q69XJ1_51_114_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9525 | 37 | 90 | 1.10.10.10 |
| af_Q4DKK4_76_138_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9521 | 36 | 91 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3DMQ7-F1-model_v4 | Transcriptional regulator | 0.9366 | 18 | 106 |
GO:0003677
|
| AF-A0A844ZWB8-F1-model_v4 | Winged helix DNA-binding protein | 0.909 | 30 | 153 |
GO:0003677
GO:0003700 |
| AF-A0A2P7QH57-F1-model_v4 | Transcriptional regulator | 0.907 | 20 | 157 |
GO:0003677
|
| AF-A0A4Q8R8C9-F1-model_v4 | Transcriptional regulator | 0.9063 | 25 | 148 |
GO:0003677
|
| AF-A0A7H0GAQ1-F1-model_v4 | deleted | 0.902 | 21 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar