F478630

General Info

Members Datasets Scaffolds Average Seq Length
742 224 742 164

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10088239|Ga0105241_100882394
Length 200
Sequence MKVAIQNQLIYSVALGNCFSEHFCAFIGFDRGETGPMAADNLTSGIDAFRQAALSCPLPAAVGLIGEKWAFLILRGALNGLHHFEEFQAGLGIARNILSDRLSKMVAGGILERAPDPEDGRRVIYSLTPKGEGLLPVVLALRQWGEEWGYGSMRVVLADRRDGRPVRKLCVMSHDGRELKLGDLTWVERDAAGSIRTAAE

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
217 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
221 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.72
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011682 3300001904 Bacteria 1426
2 JGI24741J21665_1020384 3300001915 Bacteria 1043
3 JGI24747J21853_1000204 3300001978 Bacteria 3161
4 JGI24740J21852_10018085 3300001979 Bacteria 2509
5 JGI24740J21852_10021715 3300001979 Bacteria 2221
6 JGI24739J22299_10020704 3300001989 Bacteria 2348
7 JGI24737J22298_10024619 3300001990 Bacteria 1906
8 JGI24737J22298_10035115 3300001990 Bacteria 1552
9 JGI24737J22298_10059820 3300001990 Bacteria 1147
10 JGI24743J22301_10000584 3300001991 Bacteria 4399
11 JGI24735J21928_10026522 3300002067 Bacteria 1741
12 JGI24735J21928_10075280 3300002067 Bacteria 967
13 JGI24738J21930_10003157 3300002075 Bacteria 4215
14 JGI24738J21930_10005672 3300002075 Bacteria 2972
15 JGI24738J21930_10015881 3300002075 Bacteria 1596
16 JGI24744J21845_10000021 3300002077 Bacteria 18312
17 JGI24035J26624_1010607 3300002126 Bacteria 918
18 JGI24034J26672_10023874 3300002239 Bacteria 972
19 Ga0065715_10012112 3300005293 Bacteria 2447
20 Ga0070658_10003546 3300005327 Bacteria 12808
21 Ga0070658_10023462 3300005327 Bacteria 4951
22 Ga0070658_10032959 3300005327 Bacteria 4166
23 Ga0070658_10048240 3300005327 Bacteria 3447
24 Ga0070658_10187535 3300005327 Bacteria 1742
25 Ga0070658_10201270 3300005327 Bacteria 1680
26 Ga0070658_10206600 3300005327 Bacteria 1658
27 Ga0070658_10234689 3300005327 Bacteria 1554
28 Ga0070658_10337026 3300005327 Bacteria 1290
29 Ga0070658_10704554 3300005327 Bacteria 876
30 Ga0070676_10039705 3300005328 Bacteria 2723
31 Ga0070676_10047500 3300005328 Bacteria 2507
32 Ga0070676_10630872 3300005328 Bacteria 776
33 Ga0070683_100004124 3300005329 Bacteria 11905
34 Ga0070683_100004359 3300005329 Bacteria 11648
35 Ga0070683_100043942 3300005329 Bacteria 4119
36 Ga0070683_100292645 3300005329 Bacteria 1549
37 Ga0070683_100852493 3300005329 Bacteria 874
38 Ga0070690_100006269 3300005330 Bacteria 6746
39 Ga0070690_100170949 3300005330 Bacteria 1496
40 Ga0070670_100021087 3300005331 Bacteria 5604
41 Ga0070670_100053337 3300005331 Bacteria 3473
42 Ga0070670_100162227 3300005331 Bacteria 1937
43 Ga0070670_100241516 3300005331 Unclassified 1572
44 Ga0070670_100420200 3300005331 Bacteria 1182
45 Ga0070670_100713541 3300005331 Bacteria 902
46 Ga0070677_10191731 3300005333 Bacteria 980
47 Ga0068869_100261492 3300005334 Bacteria 1385
48 Ga0068869_100294148 3300005334 Bacteria 1309
49 Ga0070666_10016125 3300005335 Bacteria 4774
50 Ga0070666_10028098 3300005335 Bacteria 3689
51 Ga0070666_10044862 3300005335 Bacteria 2963
52 Ga0070666_10161803 3300005335 Bacteria 1565
53 Ga0070666_10549454 3300005335 Bacteria 840
54 Ga0070680_100002570 3300005336 Bacteria 13424
55 Ga0070680_100003391 3300005336 Bacteria 11890
56 Ga0070680_100064048 3300005336 Bacteria 3012
57 Ga0070680_100142075 3300005336 Bacteria 2013
58 Ga0070680_100264351 3300005336 Unclassified 1456
59 Ga0070680_100562030 3300005336 Bacteria 978
60 Ga0070682_100028197 3300005337 Bacteria 3376
61 Ga0068868_100023182 3300005338 Bacteria 4696
62 Ga0068868_100047460 3300005338 Bacteria 3366
63 Ga0068868_100080502 3300005338 Bacteria 2610
64 Ga0068868_100786408 3300005338 Bacteria 857
65 Ga0070660_100000116 3300005339 Bacteria 49715
66 Ga0070660_100015242 3300005339 Bacteria 5545
67 Ga0070660_100048456 3300005339 Bacteria 3264
68 Ga0070660_100065600 3300005339 Bacteria 2825
69 Ga0070660_100069891 3300005339 Bacteria 2739
70 Ga0070660_100125794 3300005339 Bacteria 2048
71 Ga0070660_100187132 3300005339 Bacteria 1676
72 Ga0070660_100260417 3300005339 Bacteria 1416
73 Ga0070687_100081787 3300005343 Bacteria 1764
74 Ga0070687_100505980 3300005343 Bacteria 814
75 Ga0070661_100025014 3300005344 Bacteria 4287
76 Ga0070661_100034113 3300005344 Bacteria 3690
77 Ga0070661_100041097 3300005344 Bacteria 3374
78 Ga0070661_100056555 3300005344 Bacteria 2875
79 Ga0070661_100066827 3300005344 Bacteria 2641
80 Ga0070661_100092574 3300005344 Bacteria 2240
81 Ga0070661_100093596 3300005344 Bacteria 2227
82 Ga0070661_100115020 3300005344 Bacteria 2011
83 Ga0070661_100169222 3300005344 Bacteria 1659
84 Ga0070661_100422322 3300005344 Bacteria 1057
85 Ga0070661_100579965 3300005344 Bacteria 905
86 Ga0070692_10051674 3300005345 Bacteria 2138
87 Ga0070668_100117202 3300005347 Bacteria 2125
88 Ga0070668_100461269 3300005347 Bacteria 1094
89 Ga0070675_100067188 3300005354 Bacteria 2966
90 Ga0070675_100442254 3300005354 Bacteria 1165
91 Ga0070671_100004853 3300005355 Bacteria 10691
92 Ga0070671_100010817 3300005355 Bacteria 7322
93 Ga0070671_100021385 3300005355 Bacteria 5283
94 Ga0070671_100071911 3300005355 Bacteria 2887
95 Ga0070671_100072403 3300005355 Bacteria 2878
96 Ga0070671_100089736 3300005355 Bacteria 2573
97 Ga0070671_100277161 3300005355 Bacteria 1426
98 Ga0070674_100001041 3300005356 Bacteria 14499
99 Ga0070674_100069682 3300005356 Bacteria 2481
100 Ga0070674_100085997 3300005356 Bacteria 2258
101 Ga0070674_100712826 3300005356 Bacteria 859
102 Ga0070673_100002158 3300005364 Bacteria 11917
103 Ga0070673_100110096 3300005364 Bacteria 2283
104 Ga0070673_100703920 3300005364 Bacteria 928
105 Ga0070673_101669782 3300005364 Bacteria 602
106 Ga0070659_100011508 3300005366 Bacteria 6545
107 Ga0070659_100015457 3300005366 Bacteria 5717
108 Ga0070659_100090954 3300005366 Bacteria 2446
109 Ga0070659_100139847 3300005366 Bacteria 1971
110 Ga0070659_100154794 3300005366 Bacteria 1871
111 Ga0070659_100301012 3300005366 Bacteria 1337
112 Ga0070667_100026365 3300005367 Bacteria 4834
113 Ga0070667_100201843 3300005367 Bacteria 1765
114 Ga0070667_100240611 3300005367 Bacteria 1616
115 Ga0070667_100725410 3300005367 Bacteria 920
116 Ga0070667_101151444 3300005367 Bacteria 725
117 Ga0070709_10213133 3300005434 Bacteria 1374
118 Ga0070714_100076452 3300005435 Bacteria 2907
119 Ga0070714_100177177 3300005435 Bacteria 1938
120 Ga0070714_100423488 3300005435 Bacteria 1261
121 Ga0070714_100565118 3300005435 Unclassified 1090
122 Ga0070713_100392399 3300005436 Bacteria 1295
123 Ga0070705_101049364 3300005440 Bacteria 664
124 Ga0070663_100007525 3300005455 Bacteria 6634
125 Ga0070663_100035592 3300005455 Bacteria 3455
126 Ga0070663_100053451 3300005455 Bacteria 2883
127 Ga0070663_100111141 3300005455 Bacteria 2059
128 Ga0070663_100171798 3300005455 Bacteria 1676
129 Ga0070663_100214472 3300005455 Bacteria 1509
130 Ga0070663_100351429 3300005455 Bacteria 1194
131 Ga0070678_100002512 3300005456 Bacteria 10063
132 Ga0070678_100009817 3300005456 Bacteria 5820
133 Ga0070678_100035954 3300005456 Bacteria 3464
134 Ga0070678_100158536 3300005456 Bacteria 1831
135 Ga0070662_100011899 3300005457 Bacteria 5752
136 Ga0070662_100016462 3300005457 Bacteria 4966
137 Ga0070662_100033010 3300005457 Bacteria 3642
138 Ga0070662_100676207 3300005457 Bacteria 872
139 Ga0070681_10168041 3300005458 Bacteria 2115
140 Ga0070681_10197569 3300005458 Bacteria 1930
141 Ga0068867_100016168 3300005459 Bacteria 5300
142 Ga0068867_100386301 3300005459 Bacteria 1177
143 Ga0068867_100407770 3300005459 Bacteria 1148
144 Ga0070685_10158867 3300005466 Bacteria 1439
145 Ga0070685_10440150 3300005466 Bacteria 911
146 Ga0070679_100001280 3300005530 Bacteria 22214
147 Ga0070679_100051365 3300005530 Bacteria 4106
148 Ga0070679_100114225 3300005530 Bacteria 2686
149 Ga0070679_100180111 3300005530 Bacteria 2086
150 Ga0070679_100383486 3300005530 Bacteria 1352
151 Ga0070679_100411131 3300005530 Bacteria 1299
152 Ga0070679_100419355 3300005530 Bacteria 1284
153 Ga0070679_100849406 3300005530 Bacteria 856
154 Ga0070684_100008040 3300005535 Bacteria 8233
155 Ga0070684_100022154 3300005535 Bacteria 5296
156 Ga0070684_100227627 3300005535 Bacteria 1702
157 Ga0070684_101526187 3300005535 Bacteria 630
158 Ga0068853_100025046 3300005539 Bacteria 5006
159 Ga0068853_100042084 3300005539 Bacteria 3904
160 Ga0068853_100063524 3300005539 Bacteria 3198
161 Ga0068853_100196480 3300005539 Bacteria 1835
162 Ga0068853_100678983 3300005539 Bacteria 981
163 Ga0070672_100005516 3300005543 Bacteria 8392
164 Ga0070672_100023951 3300005543 Bacteria 4503
165 Ga0070672_100236956 3300005543 Bacteria 1534
166 Ga0070672_100465753 3300005543 Bacteria 1090
167 Ga0070672_100581068 3300005543 Bacteria 975
168 Ga0070672_100731150 3300005543 Bacteria 868
169 Ga0070693_100038234 3300005547 Bacteria 2681
170 Ga0070665_100050275 3300005548 Bacteria 4182
171 Ga0070665_100054124 3300005548 Bacteria 4025
172 Ga0068855_100133670 3300005563 Bacteria 2831
173 Ga0068855_100148314 3300005563 Bacteria 2669
174 Ga0068855_100158273 3300005563 Bacteria 2572
175 Ga0068855_100294100 3300005563 Bacteria 1800
176 Ga0070664_100010115 3300005564 Bacteria 7646
177 Ga0070664_100022314 3300005564 Bacteria 5219
178 Ga0070664_100024085 3300005564 Bacteria 5032
179 Ga0070664_100027876 3300005564 Bacteria 4697
180 Ga0070664_100115233 3300005564 Bacteria 2349
181 Ga0070664_100153259 3300005564 Bacteria 2035
182 Ga0070664_100177887 3300005564 Bacteria 1890
183 Ga0070664_100398754 3300005564 Bacteria 1258
184 Ga0070664_101663490 3300005564 Bacteria 605
185 Ga0068857_100029971 3300005577 Bacteria 4801
186 Ga0068857_100039813 3300005577 Bacteria 4165
187 Ga0068857_100097331 3300005577 Bacteria 2638
188 Ga0068857_101947232 3300005577 Bacteria 576
189 Ga0068854_100015728 3300005578 Bacteria 5023
190 Ga0068854_100038221 3300005578 Bacteria 3374
191 Ga0068854_100057624 3300005578 Bacteria 2802
192 Ga0068854_100076822 3300005578 Bacteria 2455
193 Ga0068854_100118414 3300005578 Bacteria 2006
194 Ga0068854_100390474 3300005578 Bacteria 1149
195 Ga0068856_100025157 3300005614 Bacteria 5801
196 Ga0068856_100047877 3300005614 Bacteria 4213
197 Ga0068856_100103479 3300005614 Bacteria 2841
198 Ga0068856_100137062 3300005614 Bacteria 2453
199 Ga0068856_100139472 3300005614 Bacteria 2431
200 Ga0068856_100159498 3300005614 Bacteria 2266
201 Ga0068856_100238050 3300005614 Bacteria 1836
202 Ga0068856_100601497 3300005614 Unclassified 1121
203 Ga0070702_100125677 3300005615 Bacteria 1612
204 Ga0068852_100001974 3300005616 Bacteria 13985
205 Ga0068852_100008915 3300005616 Bacteria 7420
206 Ga0068852_100032300 3300005616 Bacteria 4333
207 Ga0068852_100045286 3300005616 Bacteria 3741
208 Ga0068852_100084192 3300005616 Bacteria 2829
209 Ga0068852_100155966 3300005616 Bacteria 2127
210 Ga0068852_100169832 3300005616 Bacteria 2043
211 Ga0068852_100225645 3300005616 Bacteria 1783
212 Ga0068852_100350399 3300005616 Bacteria 1442
213 Ga0068852_100464934 3300005616 Bacteria 1255
214 Ga0068852_100502087 3300005616 Bacteria 1208
215 Ga0068852_100577573 3300005616 Bacteria 1126
216 Ga0068852_100654747 3300005616 Bacteria 1058
217 Ga0068852_100677444 3300005616 Unclassified 1040
218 Ga0068852_100684457 3300005616 Bacteria 1035
219 Ga0068859_100036982 3300005617 Bacteria 4900
220 Ga0068864_100001341 3300005618 Bacteria 20455
221 Ga0068864_100010881 3300005618 Bacteria 7520
222 Ga0068864_100062317 3300005618 Bacteria 3231
223 Ga0068866_10003689 3300005718 Bacteria 6272
224 Ga0068866_10033669 3300005718 Bacteria 2488
225 Ga0068851_10015861 3300005834 Bacteria 3596
226 Ga0068851_10090165 3300005834 Bacteria 1613
227 Ga0068851_10091637 3300005834 Bacteria 1601
228 Ga0068851_10179492 3300005834 Bacteria 1172
229 Ga0068851_10247609 3300005834 Bacteria 1010
230 Ga0068870_10075085 3300005840 Bacteria 1854
231 Ga0068863_100041199 3300005841 Bacteria 4391
232 Ga0068863_100047372 3300005841 Bacteria 4077
233 Ga0068858_100016001 3300005842 Bacteria 7044
234 Ga0068858_100273596 3300005842 Bacteria 1607
235 Ga0068860_100037810 3300005843 Bacteria 4619
236 Ga0081539_10021906 3300005985 Bacteria 4248
237 Ga0070717_10459431 3300006028 Bacteria 1148
238 Ga0070717_11154419 3300006028 Bacteria 705
239 Ga0097621_100053648 3300006237 Bacteria 3286
240 Ga0097621_100239918 3300006237 Bacteria 1584
241 Ga0097621_100252407 3300006237 Bacteria 1545
242 Ga0097621_100499432 3300006237 Bacteria 1102
243 Ga0068871_100054541 3300006358 Bacteria 3243
244 Ga0068871_100061949 3300006358 Bacteria 3056
245 Ga0068865_100026594 3300006881 Bacteria 3816
246 Ga0068865_100245800 3300006881 Bacteria 1410
247 Ga0097620_100036980 3300006931 Bacteria 4900
248 Ga0105240_10074545 3300009093 Bacteria 4188
249 Ga0105240_10087384 3300009093 Bacteria 3818
250 Ga0105245_10008134 3300009098 Bacteria 9169
251 Ga0105245_10020473 3300009098 Bacteria 5802
252 Ga0105245_10173471 3300009098 Bacteria 2055
253 Ga0105243_10035860 3300009148 Bacteria 3846
254 Ga0105243_10049487 3300009148 Bacteria 3316
255 Ga0105241_10069833 3300009174 Bacteria 2724
256 Ga0105241_10088239 3300009174 Bacteria 2442
257 Ga0105241_10730713 3300009174 Bacteria 906
258 Ga0105242_10030214 3300009176 Bacteria 4326
259 Ga0105242_10566524 3300009176 Bacteria 1092
260 Ga0105248_10000660 3300009177 Bacteria 39185
261 Ga0105248_10001775 3300009177 Bacteria 24009
262 Ga0105248_10046994 3300009177 Bacteria 4840
263 Ga0105248_10113704 3300009177 Bacteria 3053
264 Ga0105248_10263227 3300009177 Bacteria 1941
265 Ga0105248_10500364 3300009177 Bacteria 1370
266 Ga0105248_10592599 3300009177 Bacteria 1251
267 Ga0105248_11467141 3300009177 Bacteria 772
268 Ga0105238_10065300 3300009551 Bacteria 3640
269 Ga0105238_10153328 3300009551 Bacteria 2279
270 Ga0105238_10181866 3300009551 Bacteria 2079
271 Ga0105238_10348604 3300009551 Bacteria 1470
272 Ga0105238_11531707 3300009551 Bacteria 696
273 Ga0105239_10649910 3300010375 Bacteria 1204
274 Ga0105239_12511807 3300010375 Bacteria 600
275 Ga0105246_10068729 3300011119 Bacteria 2485
276 Ga0157373_10019690 3300013100 Bacteria 4909
277 Ga0157373_10163904 3300013100 Bacteria 1564
278 Ga0157373_10177479 3300013100 Bacteria 1500
279 Ga0157373_10200912 3300013100 Bacteria 1405
280 Ga0157373_10376326 3300013100 Bacteria 1015
281 Ga0157373_10431701 3300013100 Bacteria 946
282 Ga0157371_10033846 3300013102 Bacteria 3669
283 Ga0157371_10038689 3300013102 Bacteria 3412
284 Ga0157371_10039806 3300013102 Bacteria 3361
285 Ga0157371_10052929 3300013102 Bacteria 2883
286 Ga0157371_10096234 3300013102 Bacteria 2098
287 Ga0157371_10124358 3300013102 Bacteria 1834
288 Ga0157371_10160181 3300013102 Bacteria 1607
289 Ga0157371_11000886 3300013102 Bacteria 638
290 Ga0157370_10000497 3300013104 Bacteria 48916
291 Ga0157370_10010410 3300013104 Bacteria 9802
292 Ga0157370_10066402 3300013104 Bacteria 3412
293 Ga0157370_10116210 3300013104 Bacteria 2499
294 Ga0157370_10377737 3300013104 Bacteria 1305
295 Ga0157370_10395737 3300013104 Bacteria 1272
296 Ga0157370_10896778 3300013104 Bacteria 805
297 Ga0157369_10003764 3300013105 Bacteria 18028
298 Ga0157369_10013100 3300013105 Bacteria 9385
299 Ga0157369_10055446 3300013105 Bacteria 4278
300 Ga0157369_10200612 3300013105 Bacteria 2094
301 Ga0157369_10210792 3300013105 Bacteria 2036
302 Ga0157369_10284876 3300013105 Bacteria 1721
303 Ga0157369_10297134 3300013105 Bacteria 1680
304 Ga0157369_10475397 3300013105 Bacteria 1293
305 Ga0157369_10555183 3300013105 Bacteria 1187
306 Ga0157369_10927493 3300013105 Bacteria 893
307 Ga0157374_10053398 3300013296 Bacteria 3767
308 Ga0157374_10063506 3300013296 Bacteria 3463
309 Ga0157374_10138127 3300013296 Bacteria 2364
310 Ga0157374_10822399 3300013296 Bacteria 945
311 Ga0157374_11670802 3300013296 Bacteria 661
312 Ga0157378_10078794 3300013297 Bacteria 2973
313 Ga0157378_10291845 3300013297 Bacteria 1575
314 Ga0163162_10081661 3300013306 Bacteria 3303
315 Ga0163162_10364719 3300013306 Bacteria 1577
316 Ga0163162_10640486 3300013306 Bacteria 1187
317 Ga0163162_10753145 3300013306 Bacteria 1093
318 Ga0157372_10026426 3300013307 Bacteria 6317
319 Ga0157372_10218786 3300013307 Bacteria 2208
320 Ga0157372_10257274 3300013307 Bacteria 2027
321 Ga0157372_10319279 3300013307 Bacteria 1808
322 Ga0157372_10768190 3300013307 Bacteria 1120
323 Ga0157372_11070025 3300013307 Bacteria 933
324 Ga0157372_11821417 3300013307 Bacteria 700
325 Ga0157375_10119529 3300013308 Bacteria 2743
326 Ga0157375_10489511 3300013308 Bacteria 1394
327 Ga0182008_10208012 3300014497 Bacteria 997
328 Ga0157377_10035557 3300014745 Bacteria 2733
329 Ga0157379_10373300 3300014968 Bacteria 1308
330 Ga0157376_10063327 3300014969 Bacteria 3115
331 Ga0163161_10061919 3300017792 Bacteria 2725
332 Ga0163161_10374395 3300017792 Bacteria 1137
333 Ga0207697_10013257 3300025315 Bacteria 3441
334 Ga0207697_10040300 3300025315 Bacteria 1918
335 Ga0207697_10085278 3300025315 Bacteria 1334
336 Ga0207656_10046355 3300025321 Bacteria 1864
337 Ga0207656_10101231 3300025321 Bacteria 1321
338 Ga0207656_10130923 3300025321 Bacteria 1175
339 Ga0207656_10179386 3300025321 Bacteria 1016
340 Ga0207682_10047157 3300025893 Bacteria 1773
341 Ga0207682_10194039 3300025893 Bacteria 932
342 Ga0207642_10002131 3300025899 Bacteria 6126
343 Ga0207642_10008168 3300025899 Bacteria 3578
344 Ga0207688_10021461 3300025901 Bacteria 3528
345 Ga0207680_10000328 3300025903 Bacteria 22845
346 Ga0207680_10062756 3300025903 Bacteria 2271
347 Ga0207680_10259622 3300025903 Bacteria 1202
348 Ga0207647_10008311 3300025904 Bacteria 7444
349 Ga0207647_10015640 3300025904 Bacteria 5195
350 Ga0207647_10076374 3300025904 Bacteria 2015
351 Ga0207647_10097855 3300025904 Bacteria 1744
352 Ga0207647_10099897 3300025904 Bacteria 1723
353 Ga0207645_10044601 3300025907 Bacteria 2837
354 Ga0207645_10052507 3300025907 Bacteria 2604
355 Ga0207645_10082460 3300025907 Bacteria 2061
356 Ga0207643_10223166 3300025908 Bacteria 1154
357 Ga0207705_10000123 3300025909 Bacteria 85382
358 Ga0207705_10003236 3300025909 Bacteria 12402
359 Ga0207705_10003465 3300025909 Bacteria 11997
360 Ga0207705_10004136 3300025909 Bacteria 11003
361 Ga0207705_10004850 3300025909 Bacteria 10106
362 Ga0207705_10009612 3300025909 Bacteria 7032
363 Ga0207705_10015028 3300025909 Bacteria 5565
364 Ga0207705_10027408 3300025909 Bacteria 4063
365 Ga0207705_10049597 3300025909 Bacteria 3021
366 Ga0207705_10063830 3300025909 Bacteria 2661
367 Ga0207705_10092079 3300025909 Bacteria 2221
368 Ga0207705_10173743 3300025909 Bacteria 1623
369 Ga0207707_10100523 3300025912 Bacteria 2527
370 Ga0207707_10354541 3300025912 Bacteria 1264
371 Ga0207707_10437660 3300025912 Bacteria 1119
372 Ga0207707_10945419 3300025912 Bacteria 710
373 Ga0207695_10300747 3300025913 Bacteria 1496
374 Ga0207660_10000052 3300025917 Bacteria 59348
375 Ga0207660_10001036 3300025917 Bacteria 18381
376 Ga0207660_10108985 3300025917 Bacteria 2081
377 Ga0207662_10008372 3300025918 Bacteria 5661
378 Ga0207662_10112586 3300025918 Bacteria 1698
379 Ga0207657_10000650 3300025919 Bacteria 36973
380 Ga0207657_10004176 3300025919 Bacteria 15303
381 Ga0207657_10014127 3300025919 Bacteria 7812
382 Ga0207657_10018661 3300025919 Bacteria 6612
383 Ga0207657_10026691 3300025919 Bacteria 5301
384 Ga0207657_10040902 3300025919 Bacteria 4103
385 Ga0207657_10060097 3300025919 Bacteria 3262
386 Ga0207657_10167958 3300025919 Bacteria 1779
387 Ga0207657_10262585 3300025919 Unclassified 1374
388 Ga0207657_10371085 3300025919 Unclassified 1127
389 Ga0207649_10023389 3300025920 Bacteria 3578
390 Ga0207649_10024391 3300025920 Bacteria 3515
391 Ga0207649_10031257 3300025920 Bacteria 3163
392 Ga0207649_10035609 3300025920 Bacteria 2992
393 Ga0207649_10036486 3300025920 Bacteria 2961
394 Ga0207649_10061403 3300025920 Bacteria 2366
395 Ga0207649_10091115 3300025920 Bacteria 1996
396 Ga0207649_10101013 3300025920 Bacteria 1909
397 Ga0207649_10188709 3300025920 Bacteria 1448
398 Ga0207649_10263185 3300025920 Bacteria 1247
399 Ga0207649_10372703 3300025920 Bacteria 1062
400 Ga0207649_10725108 3300025920 Bacteria 772
401 Ga0207652_10000034 3300025921 Bacteria 138571
402 Ga0207652_10133879 3300025921 Bacteria 2212
403 Ga0207652_10138846 3300025921 Bacteria 2172
404 Ga0207652_10362730 3300025921 Bacteria 1308
405 Ga0207652_10929361 3300025921 Bacteria 767
406 Ga0207681_10117399 3300025923 Bacteria 1946
407 Ga0207694_10505937 3300025924 Bacteria 1012
408 Ga0207694_10966583 3300025924 Unclassified 720
409 Ga0207694_11371767 3300025924 Bacteria 597
410 Ga0207650_10038474 3300025925 Bacteria 3493
411 Ga0207650_10091632 3300025925 Bacteria 2323
412 Ga0207650_10142283 3300025925 Bacteria 1887
413 Ga0207650_10426663 3300025925 Bacteria 1101
414 Ga0207650_11307864 3300025925 Bacteria 617
415 Ga0207659_10255537 3300025926 Bacteria 1423
416 Ga0207659_10523077 3300025926 Bacteria 1006
417 Ga0207687_10013791 3300025927 Bacteria 5279
418 Ga0207687_10023383 3300025927 Bacteria 4118
419 Ga0207687_10025638 3300025927 Bacteria 3945
420 Ga0207687_10819389 3300025927 Bacteria 794
421 Ga0207700_10339840 3300025928 Bacteria 1305
422 Ga0207664_10008734 3300025929 Bacteria 7083
423 Ga0207664_10069171 3300025929 Bacteria 2838
424 Ga0207664_10457049 3300025929 Bacteria 1140
425 Ga0207664_10638540 3300025929 Unclassified 957
426 Ga0207644_10000358 3300025931 Bacteria 29705
427 Ga0207644_10000807 3300025931 Bacteria 19872
428 Ga0207644_10024565 3300025931 Bacteria 4138
429 Ga0207644_10031115 3300025931 Bacteria 3716
430 Ga0207644_10032830 3300025931 Bacteria 3624
431 Ga0207644_10057593 3300025931 Bacteria 2806
432 Ga0207644_10074202 3300025931 Bacteria 2496
433 Ga0207644_10085255 3300025931 Bacteria 2343
434 Ga0207644_10091900 3300025931 Bacteria 2263
435 Ga0207690_10011299 3300025932 Bacteria 5336
436 Ga0207690_10038358 3300025932 Bacteria 3117
437 Ga0207690_10063463 3300025932 Bacteria 2519
438 Ga0207690_10110944 3300025932 Bacteria 1975
439 Ga0207690_10202273 3300025932 Bacteria 1509
440 Ga0207690_10215168 3300025932 Bacteria 1467
441 Ga0207690_10337598 3300025932 Bacteria 1188
442 Ga0207690_10394337 3300025932 Bacteria 1103
443 Ga0207690_10458401 3300025932 Bacteria 1026
444 Ga0207706_10003800 3300025933 Bacteria 14394
445 Ga0207706_10019926 3300025933 Bacteria 6028
446 Ga0207706_10071990 3300025933 Bacteria 3041
447 Ga0207706_10077257 3300025933 Bacteria 2928
448 Ga0207706_10103934 3300025933 Bacteria 2499
449 Ga0207706_10106354 3300025933 Bacteria 2469
450 Ga0207706_10299259 3300025933 Bacteria 1402
451 Ga0207686_10419651 3300025934 Bacteria 1023
452 Ga0207709_10037346 3300025935 Bacteria 2886
453 Ga0207709_10049888 3300025935 Bacteria 2557
454 Ga0207669_10002786 3300025937 Bacteria 7496
455 Ga0207669_10116825 3300025937 Bacteria 1801
456 Ga0207669_10164538 3300025937 Bacteria 1571
457 Ga0207669_10589777 3300025937 Bacteria 902
458 Ga0207704_10056717 3300025938 Bacteria 2402
459 Ga0207704_10074511 3300025938 Bacteria 2166
460 Ga0207704_10188562 3300025938 Bacteria 1498
461 Ga0207704_10278045 3300025938 Bacteria 1271
462 Ga0207691_10005229 3300025940 Bacteria 12521
463 Ga0207691_10044268 3300025940 Bacteria 4098
464 Ga0207691_10084421 3300025940 Bacteria 2851
465 Ga0207691_10167262 3300025940 Bacteria 1927
466 Ga0207691_10230701 3300025940 Bacteria 1603
467 Ga0207691_10409559 3300025940 Bacteria 1156
468 Ga0207691_10656417 3300025940 Unclassified 886
469 Ga0207691_10821838 3300025940 Bacteria 780
470 Ga0207711_10007226 3300025941 Bacteria 9308
471 Ga0207711_10007812 3300025941 Bacteria 8940
472 Ga0207711_10045222 3300025941 Bacteria 3762
473 Ga0207711_10235124 3300025941 Bacteria 1679
474 Ga0207711_10475502 3300025941 Bacteria 1164
475 Ga0207711_11007433 3300025941 Bacteria 773
476 Ga0207711_11506566 3300025941 Unclassified 616
477 Ga0207689_10040941 3300025942 Bacteria 3833
478 Ga0207689_10203749 3300025942 Bacteria 1633
479 Ga0207661_10001415 3300025944 Bacteria 16185
480 Ga0207661_10009454 3300025944 Bacteria 6993
481 Ga0207661_10062788 3300025944 Bacteria 3006
482 Ga0207661_10091195 3300025944 Bacteria 2539
483 Ga0207661_10595769 3300025944 Bacteria 1014
484 Ga0207661_10635234 3300025944 Bacteria 981
485 Ga0207661_10843073 3300025944 Bacteria 844
486 Ga0207679_10023879 3300025945 Bacteria 4187
487 Ga0207679_10051339 3300025945 Bacteria 3018
488 Ga0207679_10145398 3300025945 Bacteria 1922
489 Ga0207679_10275284 3300025945 Bacteria 1441
490 Ga0207679_10447927 3300025945 Bacteria 1144
491 Ga0207667_10022070 3300025949 Bacteria 7043
492 Ga0207667_10236562 3300025949 Bacteria 1870
493 Ga0207667_10323433 3300025949 Bacteria 1575
494 Ga0207667_11012203 3300025949 Bacteria 818
495 Ga0207651_10001030 3300025960 Bacteria 12321
496 Ga0207651_10028843 3300025960 Bacteria 3507
497 Ga0207651_10046190 3300025960 Bacteria 2926
498 Ga0207651_10139789 3300025960 Bacteria 1868
499 Ga0207668_10155655 3300025972 Bacteria 1775
500 Ga0207640_10018554 3300025981 Bacteria 4090
501 Ga0207640_10097059 3300025981 Bacteria 2056
502 Ga0207640_10398753 3300025981 Bacteria 1120
503 Ga0207640_10430562 3300025981 Bacteria 1082
504 Ga0207640_10471271 3300025981 Bacteria 1039
505 Ga0207658_10009194 3300025986 Bacteria 6700
506 Ga0207658_10063588 3300025986 Bacteria 2766
507 Ga0207658_10198854 3300025986 Bacteria 1672
508 Ga0207658_10270879 3300025986 Bacteria 1451
509 Ga0207677_10002148 3300026023 Bacteria 10362
510 Ga0207677_10006119 3300026023 Bacteria 6571
511 Ga0207677_10011379 3300026023 Bacteria 5071
512 Ga0207677_10052215 3300026023 Bacteria 2776
513 Ga0207677_10152897 3300026023 Bacteria 1783
514 Ga0207677_10282520 3300026023 Unclassified 1363
515 Ga0207703_10035102 3300026035 Bacteria 3984
516 Ga0207703_10174042 3300026035 Bacteria 1895
517 Ga0207639_10058682 3300026041 Bacteria 2961
518 Ga0207639_10089776 3300026041 Bacteria 2456
519 Ga0207639_10646373 3300026041 Bacteria 978
520 Ga0207678_10000530 3300026067 Bacteria 34763
521 Ga0207678_10002494 3300026067 Bacteria 16747
522 Ga0207678_10021744 3300026067 Bacteria 5626
523 Ga0207678_10024326 3300026067 Bacteria 5290
524 Ga0207678_10027197 3300026067 Bacteria 4988
525 Ga0207678_10041478 3300026067 Bacteria 3991
526 Ga0207678_10154865 3300026067 Bacteria 1957
527 Ga0207678_10186931 3300026067 Bacteria 1770
528 Ga0207678_10201626 3300026067 Bacteria 1701
529 Ga0207678_10206848 3300026067 Bacteria 1679
530 Ga0207678_10354892 3300026067 Bacteria 1265
531 Ga0207678_10435416 3300026067 Bacteria 1138
532 Ga0207678_10453569 3300026067 Bacteria 1115
533 Ga0207702_10018792 3300026078 Bacteria 5715
534 Ga0207702_10050657 3300026078 Bacteria 3506
535 Ga0207702_10123728 3300026078 Bacteria 2318
536 Ga0207702_10385662 3300026078 Bacteria 1348
537 Ga0207702_10432780 3300026078 Bacteria 1274
538 Ga0207641_10029554 3300026088 Bacteria 4534
539 Ga0207641_10103196 3300026088 Bacteria 2515
540 Ga0207641_10108001 3300026088 Bacteria 2462
541 Ga0207641_10735453 3300026088 Bacteria 973
542 Ga0207648_10010297 3300026089 Bacteria 8880
543 Ga0207648_10011451 3300026089 Bacteria 8351
544 Ga0207648_10068994 3300026089 Bacteria 3081
545 Ga0207648_10456212 3300026089 Bacteria 1164
546 Ga0207648_10517057 3300026089 Bacteria 1093
547 Ga0207676_10000253 3300026095 Bacteria 46261
548 Ga0207676_10001727 3300026095 Bacteria 16099
549 Ga0207676_10039893 3300026095 Bacteria 3595
550 Ga0207676_10122960 3300026095 Bacteria 2192
551 Ga0207676_10488244 3300026095 Bacteria 1168
552 Ga0207674_10004040 3300026116 Bacteria 17803
553 Ga0207674_10013613 3300026116 Bacteria 9010
554 Ga0207674_10032947 3300026116 Bacteria 5430
555 Ga0207683_10010831 3300026121 Bacteria 7776
556 Ga0207683_10012503 3300026121 Bacteria 7241
557 Ga0207683_10049063 3300026121 Bacteria 3695
558 Ga0207683_10106564 3300026121 Bacteria 2506
559 Ga0207698_10015169 3300026142 Bacteria 5153
560 Ga0207698_10023566 3300026142 Bacteria 4302
561 Ga0207698_10035931 3300026142 Bacteria 3630
562 Ga0207698_10079393 3300026142 Bacteria 2639
563 Ga0207698_10090038 3300026142 Bacteria 2508
564 Ga0207698_10103521 3300026142 Bacteria 2366
565 Ga0207698_10188999 3300026142 Bacteria 1832
566 Ga0207698_10200030 3300026142 Bacteria 1788
567 Ga0207698_10205832 3300026142 Bacteria 1766
568 Ga0207698_10322451 3300026142 Unclassified 1447
569 Ga0207698_10504304 3300026142 Bacteria 1178
570 Ga0207698_10957347 3300026142 Bacteria 865
571 Ga0268266_10113944 3300028379 Bacteria 2398
572 Ga0268264_10439012 3300028381 Bacteria 1262
573 Ga0307408_100043976 3300031548 Bacteria 3180
574 Ga0307408_100968228 3300031548 Bacteria 782
575 Ga0307405_10036075 3300031731 Bacteria 2959
576 Ga0307405_11123725 3300031731 Bacteria 676
577 Ga0307413_10020497 3300031824 Bacteria 3518
578 Ga0307410_10045770 3300031852 Bacteria 2915
579 Ga0307409_100035870 3300031995 Bacteria 3638
580 Ga0307409_100063136 3300031995 Bacteria 2903
581 Ga0307409_100588533 3300031995 Bacteria 1098
582 Ga0307416_100012031 3300032002 Bacteria 5807
583 Ga0307416_101575692 3300032002 Bacteria 762
584 Ga0307414_10222938 3300032004 Bacteria 1549
585 Ga0307411_10035683 3300032005 Bacteria 3108
586 Ga0307411_10118565 3300032005 Bacteria 1909
587 Ga0307411_10699818 3300032005 Bacteria 882
588 Ga0307415_100056377 3300032126 Bacteria 2693
589 Ga0307415_100407050 3300032126 Bacteria 1163
590 Ga0307415_100647787 3300032126 Bacteria 947
591 Ga0373930_0143244 3300034816 Bacteria 595
592 Ga0373960_0005917 3300035121 Bacteria 2849
593 Ga0373943_0006847 3300035170 Bacteria 5113
594 Ga0373946_0005931 3300035171 Bacteria 4428
595 Ga0373931_0023562 3300035691 Bacteria 3110
596 Ga0373927_0027773 3300035695 Bacteria 3695
597 Ga0373947_0279550 3300035725 Bacteria 1109
598 Ga0373937_0590848 3300036401 Bacteria 1054
599 Ga0373925_0009468 3300037068 Bacteria 7091
600 Ga0395899_0012920 3300037312 Bacteria 6390
601 Ga0395899_0067804 3300037312 Bacteria 2617
602 Ga0395899_0087703 3300037312 Bacteria 2258
603 Ga0395899_0213781 3300037312 Bacteria 1339
604 Ga0395900_0001102 3300037418 Bacteria 34357
605 Ga0395900_0008653 3300037418 Bacteria 10456
606 Ga0395900_0015199 3300037418 Bacteria 7850
607 Ga0395900_0031013 3300037418 Bacteria 5491
608 Ga0395900_0106995 3300037418 Bacteria 2873
609 Ga0395900_0145515 3300037418 Bacteria 2423
610 Ga0395900_0166674 3300037418 Bacteria 2245
611 Ga0395900_0249855 3300037418 Bacteria 1775
612 Ga0395900_0297424 3300037418 Bacteria 1601
613 Ga0395900_0457506 3300037418 Bacteria 1231
614 Ga0395900_1028271 3300037418 Bacteria 743
615 Ga0395898_0016450 3300037466 Bacteria 7569
616 Ga0395898_0038278 3300037466 Bacteria 4754
617 Ga0395898_0204646 3300037466 Bacteria 1883
618 Ga0395898_0365318 3300037466 Bacteria 1376
619 Ga0395898_0389936 3300037466 Bacteria 1328
620 Ga0395898_0421527 3300037466 Bacteria 1272
621 Ga0395905_0002464 3300037471 Bacteria 20495
622 Ga0395905_0006500 3300037471 Bacteria 11753
623 Ga0395905_0008333 3300037471 Bacteria 10225
624 Ga0395905_0033641 3300037471 Bacteria 4813
625 Ga0395905_0105299 3300037471 Bacteria 2648
626 Ga0395905_0134636 3300037471 Bacteria 2324
627 Ga0395905_0229689 3300037471 Bacteria 1735
628 Ga0395905_0337027 3300037471 Bacteria 1399
629 Ga0395905_0391059 3300037471 Bacteria 1285
630 Ga0395901_0001088 3300038443 Bacteria 29016
631 Ga0395901_0002597 3300038443 Bacteria 18305
632 Ga0395901_0012345 3300038443 Bacteria 8666
633 Ga0395901_0073739 3300038443 Bacteria 3560
634 Ga0395901_0082883 3300038443 Bacteria 3351
635 Ga0395901_0123556 3300038443 Bacteria 2720
636 Ga0395901_0281365 3300038443 Bacteria 1728
637 Ga0395901_0442866 3300038443 Unclassified 1330
638 Ga0395901_0504295 3300038443 Bacteria 1231
639 Ga0436365_0531315 3300039437 Bacteria 7812
640 Ga0436363_0375292 3300039450 Bacteria 902
641 Ga0436363_0692539 3300039450 Bacteria 1285
642 Ga0439465_0031904 3300041413 Bacteria 1680
643 Ga0439448_0138677 3300042005 Unclassified 841
644 Ga0439432_015655 3300042006 Bacteria 2557
645 Ga0439449_0013260 3300042007 Bacteria 3101
646 Ga0439458_0008142 3300042157 Bacteria 2331
647 Ga0466969_0141262 3300044656 Bacteria 1113
648 Ga0466969_0157790 3300044656 Bacteria 1043
649 Ga0466972_0151989 3300044658 Bacteria 1088
650 Ga0466965_0220158 3300044683 Unclassified 1011
651 Ga0466965_0426355 3300044683 Bacteria 736
652 Ga0466966_0002429 3300044684 Bacteria 12173
653 Ga0466966_0052512 3300044684 Bacteria 2589
654 Ga0466966_0079413 3300044684 Bacteria 2045
655 Ga0466966_0602446 3300044684 Unclassified 661
656 Ga0466961_0038704 3300044693 Bacteria 3059
657 Ga0466961_0082694 3300044693 Bacteria 2031
658 Ga0466961_0105199 3300044693 Bacteria 1777
659 Ga0466961_0229477 3300044693 Bacteria 1143
660 Ga0466963_0014749 3300044694 Bacteria 4823
661 Ga0466963_0032293 3300044694 Bacteria 3389
662 Ga0466963_0323330 3300044694 Bacteria 1086
663 Ga0466964_0091615 3300044706 Bacteria 1324
664 Ga0466971_0004121 3300044719 Bacteria 6259
665 Ga0466971_0072983 3300044719 Bacteria 1559
666 Ga0466970_0036150 3300044765 Bacteria 2616
667 Ga0466970_0397746 3300044765 Bacteria 786
668 Ga0466970_0544963 3300044765 Bacteria 670
669 Ga0466970_0647722 3300044765 Bacteria 614
670 Ga0466957_0000705 3300044842 Bacteria 17083
671 Ga0466957_0119646 3300044842 Unclassified 1678
672 Ga0466960_0011619 3300044901 Bacteria 3692
673 Ga0466959_0106303 3300045049 Bacteria 2006
674 Ga0466959_0251547 3300045049 Bacteria 1219
675 Ga0466959_0308188 3300045049 Bacteria 1083
676 Ga0466959_0760919 3300045049 Unclassified 648
677 Ga0466958_0026480 3300045836 Bacteria 3427
678 Ga0466958_0031080 3300045836 Bacteria 3173
679 Ga0466958_0084439 3300045836 Bacteria 1958
680 Ga0466967_0000571 3300045976 Bacteria 18131
681 Ga0466967_0012199 3300045976 Bacteria 6559
682 Ga0466967_0029471 3300045976 Bacteria 4593
683 Ga0466967_0117321 3300045976 Bacteria 2453
684 Ga0466967_0278158 3300045976 Bacteria 1605
685 Ga0466967_0425157 3300045976 Bacteria 1295
686 Ga0495663_0104611 3300046525 Unclassified 935
687 Ga0495598_0000941 3300046537 Bacteria 5622
688 Ga0495621_0014678 3300046539 Bacteria 2484
689 Ga0495633_0023509 3300046558 Bacteria 3053
690 Ga0495659_0101253 3300046664 Bacteria 1116
691 Ga0495669_0062763 3300046684 Bacteria 1684
692 Ga0495669_0126323 3300046684 Bacteria 1202
693 Ga0495669_0154984 3300046684 Bacteria 1085
694 Ga0495669_0308209 3300046684 Unclassified 764
695 Ga0495670_0006379 3300046691 Bacteria 5795
696 Ga0495670_0319615 3300046691 Bacteria 833
697 Ga0495677_0021229 3300047445 Bacteria 2353
698 Ga0495677_0064488 3300047445 Bacteria 1361
699 Ga0496100_0006192 3300048903 Bacteria 6508
700 Ga0496100_0124551 3300048903 Bacteria 1807
701 Ga0496101_0001753 3300048904 Bacteria 13007
702 Ga0496101_0012456 3300048904 Bacteria 5676
703 Ga0496102_0018790 3300048905 Bacteria 6080
704 Ga0496102_0225697 3300048905 Unclassified 1766
705 Ga0496102_0237098 3300048905 Bacteria 1720
706 Ga0496103_0083064 3300048906 Unclassified 2016
707 Ga0496105_0087017 3300048908 Bacteria 2582
708 Ga0496106_0024396 3300048909 Bacteria 4496
709 Ga0496106_0065791 3300048909 Bacteria 2760
710 Ga0496106_0129789 3300048909 Bacteria 1976
711 Ga0496107_0003789 3300048910 Bacteria 10154
712 Ga0496107_0072222 3300048910 Bacteria 2508
713 Ga0496107_0106531 3300048910 Bacteria 2059
714 Ga0496107_0607199 3300048910 Bacteria 808
715 Ga0496108_0001787 3300048911 Bacteria 17132
716 Ga0496108_0043139 3300048911 Bacteria 3767
717 Ga0496109_0000995 3300048912 Bacteria 23386
718 Ga0496109_0006868 3300048912 Bacteria 9598
719 Ga0496109_0225849 3300048912 Bacteria 1761
720 Ga0496109_0663231 3300048912 Bacteria 980
721 Ga0496110_0005992 3300048913 Bacteria 9568
722 Ga0496110_0032650 3300048913 Bacteria 4498
723 Ga0496111_0018568 3300048914 Bacteria 4818
724 Ga0496111_0023557 3300048914 Bacteria 4324
725 Ga0496111_0115152 3300048914 Bacteria 1982
726 Ga0496112_0002054 3300048915 Bacteria 15962
727 Ga0496112_0005455 3300048915 Bacteria 11005
728 Ga0496112_0091406 3300048915 Bacteria 3012
729 Ga0496112_0119024 3300048915 Bacteria 2611
730 Ga0496113_0014949 3300048916 Bacteria 5313
731 Ga0496113_0023645 3300048916 Bacteria 4358
732 Ga0496113_0252889 3300048916 Bacteria 1407
733 Ga0496114_0053548 3300048917 Bacteria 3364
734 Ga0501209_001155 3300049656 Bacteria 3608
735 Ga0501224_001917 3300049664 Bacteria 2804
736 Ga0501235_007338 3300049669 Bacteria 2404
737 Ga0501249_003896 3300049679 Bacteria 3014
738 Ga0501229_024122 3300049706 Bacteria 815
739 Ga0501263_003457 3300049760 Bacteria 1687
740 Ga0501268_037296 3300049765 Bacteria 903
741 Ga0501270_001256 3300049767 Bacteria 2382
742 Ga0466962_0115330 3300061719 Bacteria 1294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025981 Ga0207640_10398753 Ga0207640_103987533 149
2 3300005331 Ga0070670_100053337 Ga0070670_1000533375 159
3 3300005354 Ga0070675_100442254 Ga0070675_1004422542 159
4 3300005564 Ga0070664_100027876 Ga0070664_1000278762 159
5 3300009177 Ga0105248_10592599 Ga0105248_105925992 159
6 3300025919 Ga0207657_10262585 Ga0207657_102625852 159
7 3300025925 Ga0207650_10142283 Ga0207650_101422832 159
8 3300025926 Ga0207659_10523077 Ga0207659_105230771 159
9 3300025941 Ga0207711_11506566 Ga0207711_115065661 159
10 3300047445 Ga0495677_0064488 Ga0495677_0064488_428_916 159
11 3300005543 Ga0070672_100465753 Ga0070672_1004657532 160
12 3300025940 Ga0207691_10167262 Ga0207691_101672622 160
13 3300031995 Ga0307409_100588533 Ga0307409_1005885332 160
14 3300037418 Ga0395900_0015199 Ga0395900_0015199_3064_3549 160
15 3300038443 Ga0395901_0123556 Ga0395901_0123556_2164_2649 160
16 3300005355 Ga0070671_100072403 Ga0070671_1000724033 162
17 3300005366 Ga0070659_100139847 Ga0070659_1001398473 162
18 3300005616 Ga0068852_100677444 Ga0068852_1006774442 162
19 3300005618 Ga0068864_100062317 Ga0068864_1000623174 162
20 3300005834 Ga0068851_10179492 Ga0068851_101794921 162
21 3300005841 Ga0068863_100047372 Ga0068863_1000473723 162
22 3300009177 Ga0105248_10001775 Ga0105248_1000177515 162
23 3300025925 Ga0207650_10038474 Ga0207650_100384744 162
24 3300025931 Ga0207644_10000807 Ga0207644_1000080718 162
25 3300025931 Ga0207644_10074202 Ga0207644_100742023 162
26 3300025932 Ga0207690_10202273 Ga0207690_102022732 162
27 3300025941 Ga0207711_10007226 Ga0207711_100072263 162
28 3300026088 Ga0207641_10103196 Ga0207641_101031963 162
29 3300026095 Ga0207676_10001727 Ga0207676_100017272 162
30 3300026142 Ga0207698_10322451 Ga0207698_103224512 162
31 3300032002 Ga0307416_101575692 Ga0307416_1015756921 162
32 3300032126 Ga0307415_100647787 Ga0307415_1006477872 162
33 3300048905 Ga0496102_0225697 Ga0496102_0225697_313_801 162
34 3300048911 Ga0496108_0043139 Ga0496108_0043139_1294_1782 162
35 3300048912 Ga0496109_0006868 Ga0496109_0006868_744_1232 162
36 3300048914 Ga0496111_0115152 Ga0496111_0115152_466_954 162
37 3300048915 Ga0496112_0002054 Ga0496112_0002054_14826_15314 162
38 3300048916 Ga0496113_0014949 Ga0496113_0014949_4543_5031 162
39 3300001990 JGI24737J22298_10059820 JGI24737J22298_100598202 163
40 3300002075 JGI24738J21930_10015881 JGI24738J21930_100158814 163
41 3300005327 Ga0070658_10003546 Ga0070658_100035467 163
42 3300005327 Ga0070658_10023462 Ga0070658_100234622 163
43 3300005327 Ga0070658_10201270 Ga0070658_102012702 163
44 3300005327 Ga0070658_10206600 Ga0070658_102066002 163
45 3300005328 Ga0070676_10039705 Ga0070676_100397051 163
46 3300005329 Ga0070683_100004359 Ga0070683_1000043599 163
47 3300005329 Ga0070683_100852493 Ga0070683_1008524932 163
48 3300005330 Ga0070690_100006269 Ga0070690_1000062695 163
49 3300005330 Ga0070690_100170949 Ga0070690_1001709491 163
50 3300005331 Ga0070670_100713541 Ga0070670_1007135411 163
51 3300005334 Ga0068869_100294148 Ga0068869_1002941482 163
52 3300005335 Ga0070666_10016125 Ga0070666_100161251 163
53 3300005335 Ga0070666_10044862 Ga0070666_100448622 163
54 3300005338 Ga0068868_100047460 Ga0068868_1000474603 163
55 3300005338 Ga0068868_100080502 Ga0068868_1000805022 163
56 3300005339 Ga0070660_100015242 Ga0070660_1000152425 163
57 3300005339 Ga0070660_100048456 Ga0070660_1000484563 163
58 3300005339 Ga0070660_100069891 Ga0070660_1000698912 163
59 3300005343 Ga0070687_100505980 Ga0070687_1005059802 163
60 3300005344 Ga0070661_100025014 Ga0070661_1000250145 163
61 3300005344 Ga0070661_100041097 Ga0070661_1000410972 163
62 3300005344 Ga0070661_100093596 Ga0070661_1000935962 163
63 3300005347 Ga0070668_100461269 Ga0070668_1004612692 163
64 3300005355 Ga0070671_100021385 Ga0070671_1000213852 163
65 3300005355 Ga0070671_100089736 Ga0070671_1000897364 163
66 3300005356 Ga0070674_100069682 Ga0070674_1000696821 163
67 3300005356 Ga0070674_100085997 Ga0070674_1000859971 163
68 3300005364 Ga0070673_100110096 Ga0070673_1001100963 163
69 3300005364 Ga0070673_101669782 Ga0070673_1016697821 163
70 3300005366 Ga0070659_100011508 Ga0070659_1000115085 163
71 3300005366 Ga0070659_100090954 Ga0070659_1000909543 163
72 3300005366 Ga0070659_100301012 Ga0070659_1003010122 163
73 3300005367 Ga0070667_100026365 Ga0070667_1000263654 163
74 3300005367 Ga0070667_101151444 Ga0070667_1011514442 163
75 3300005435 Ga0070714_100565118 Ga0070714_1005651182 163
76 3300005455 Ga0070663_100171798 Ga0070663_1001717983 163
77 3300005456 Ga0070678_100009817 Ga0070678_1000098175 163
78 3300005457 Ga0070662_100016462 Ga0070662_1000164623 163
79 3300005457 Ga0070662_100676207 Ga0070662_1006762071 163
80 3300005459 Ga0068867_100386301 Ga0068867_1003863012 163
81 3300005466 Ga0070685_10440150 Ga0070685_104401501 163
82 3300005535 Ga0070684_100008040 Ga0070684_1000080404 163
83 3300005539 Ga0068853_100063524 Ga0068853_1000635243 163
84 3300005539 Ga0068853_100196480 Ga0068853_1001964804 163
85 3300005543 Ga0070672_100005516 Ga0070672_1000055165 163
86 3300005543 Ga0070672_100236956 Ga0070672_1002369561 163
87 3300005543 Ga0070672_100731150 Ga0070672_1007311501 163
88 3300005563 Ga0068855_100148314 Ga0068855_1001483142 163
89 3300005564 Ga0070664_100010115 Ga0070664_1000101155 163
90 3300005578 Ga0068854_100390474 Ga0068854_1003904742 163
91 3300005614 Ga0068856_100047877 Ga0068856_1000478773 163
92 3300005615 Ga0070702_100125677 Ga0070702_1001256772 163
93 3300005616 Ga0068852_100032300 Ga0068852_1000323004 163
94 3300005616 Ga0068852_100502087 Ga0068852_1005020871 163
95 3300005617 Ga0068859_100036982 Ga0068859_1000369824 163
96 3300005618 Ga0068864_100010881 Ga0068864_1000108815 163
97 3300005718 Ga0068866_10033669 Ga0068866_100336693 163
98 3300005834 Ga0068851_10015861 Ga0068851_100158613 163
99 3300005841 Ga0068863_100041199 Ga0068863_1000411993 163
100 3300005842 Ga0068858_100016001 Ga0068858_1000160019 163
101 3300005842 Ga0068858_100273596 Ga0068858_1002735963 163
102 3300005843 Ga0068860_100037810 Ga0068860_1000378105 163
103 3300006237 Ga0097621_100053648 Ga0097621_1000536483 163
104 3300006237 Ga0097621_100499432 Ga0097621_1004994321 163
105 3300006358 Ga0068871_100054541 Ga0068871_1000545413 163
106 3300006881 Ga0068865_100026594 Ga0068865_1000265942 163
107 3300006881 Ga0068865_100245800 Ga0068865_1002458003 163
108 3300006931 Ga0097620_100036980 Ga0097620_1000369803 163
109 3300009093 Ga0105240_10074545 Ga0105240_100745453 163
110 3300009098 Ga0105245_10008134 Ga0105245_100081345 163
111 3300009148 Ga0105243_10035860 Ga0105243_100358605 163
112 3300009176 Ga0105242_10030214 Ga0105242_100302145 163
113 3300009177 Ga0105248_10046994 Ga0105248_100469945 163
114 3300009177 Ga0105248_10263227 Ga0105248_102632272 163
115 3300009551 Ga0105238_10065300 Ga0105238_100653005 163
116 3300013100 Ga0157373_10200912 Ga0157373_102009122 163
117 3300013102 Ga0157371_10033846 Ga0157371_100338465 163
118 3300013102 Ga0157371_10038689 Ga0157371_100386892 163
119 3300013102 Ga0157371_10039806 Ga0157371_100398061 163
120 3300013102 Ga0157371_11000886 Ga0157371_110008862 163
121 3300013104 Ga0157370_10395737 Ga0157370_103957372 163
122 3300013104 Ga0157370_10896778 Ga0157370_108967781 163
123 3300013105 Ga0157369_10013100 Ga0157369_100131005 163
124 3300013296 Ga0157374_10053398 Ga0157374_100533983 163
125 3300013297 Ga0157378_10291845 Ga0157378_102918453 163
126 3300013306 Ga0163162_10081661 Ga0163162_100816614 163
127 3300013307 Ga0157372_11070025 Ga0157372_110700252 163
128 3300014745 Ga0157377_10035557 Ga0157377_100355574 163
129 3300014968 Ga0157379_10373300 Ga0157379_103733002 163
130 3300014969 Ga0157376_10063327 Ga0157376_100633273 163
131 3300017792 Ga0163161_10374395 Ga0163161_103743952 163
132 3300025315 Ga0207697_10040300 Ga0207697_100403002 163
133 3300025321 Ga0207656_10130923 Ga0207656_101309233 163
134 3300025899 Ga0207642_10008168 Ga0207642_100081683 163
135 3300025903 Ga0207680_10000328 Ga0207680_1000032817 163
136 3300025903 Ga0207680_10062756 Ga0207680_100627563 163
137 3300025904 Ga0207647_10008311 Ga0207647_100083115 163
138 3300025907 Ga0207645_10044601 Ga0207645_100446011 163
139 3300025909 Ga0207705_10003236 Ga0207705_100032367 163
140 3300025909 Ga0207705_10003465 Ga0207705_100034656 163
141 3300025909 Ga0207705_10004850 Ga0207705_100048505 163
142 3300025909 Ga0207705_10009612 Ga0207705_100096126 163
143 3300025913 Ga0207695_10300747 Ga0207695_103007471 163
144 3300025918 Ga0207662_10112586 Ga0207662_101125864 163
145 3300025919 Ga0207657_10014127 Ga0207657_100141278 163
146 3300025919 Ga0207657_10026691 Ga0207657_100266915 163
147 3300025919 Ga0207657_10060097 Ga0207657_100600973 163
148 3300025920 Ga0207649_10023389 Ga0207649_100233893 163
149 3300025920 Ga0207649_10101013 Ga0207649_101010133 163
150 3300025920 Ga0207649_10725108 Ga0207649_107251082 163
151 3300025925 Ga0207650_11307864 Ga0207650_113078641 163
152 3300025927 Ga0207687_10025638 Ga0207687_100256384 163
153 3300025927 Ga0207687_10819389 Ga0207687_108193892 163
154 3300025929 Ga0207664_10638540 Ga0207664_106385401 163
155 3300025931 Ga0207644_10000358 Ga0207644_100003582 163
156 3300025931 Ga0207644_10091900 Ga0207644_100919004 163
157 3300025932 Ga0207690_10110944 Ga0207690_101109443 163
158 3300025932 Ga0207690_10337598 Ga0207690_103375981 163
159 3300025933 Ga0207706_10003800 Ga0207706_100038005 163
160 3300025933 Ga0207706_10299259 Ga0207706_102992592 163
161 3300025935 Ga0207709_10049888 Ga0207709_100498882 163
162 3300025937 Ga0207669_10116825 Ga0207669_101168251 163
163 3300025937 Ga0207669_10164538 Ga0207669_101645381 163
164 3300025938 Ga0207704_10074511 Ga0207704_100745113 163
165 3300025938 Ga0207704_10188562 Ga0207704_101885623 163
166 3300025940 Ga0207691_10005229 Ga0207691_100052295 163
167 3300025940 Ga0207691_10084421 Ga0207691_100844211 163
168 3300025940 Ga0207691_10409559 Ga0207691_104095591 163
169 3300025941 Ga0207711_10045222 Ga0207711_100452224 163
170 3300025942 Ga0207689_10203749 Ga0207689_102037492 163
171 3300025944 Ga0207661_10009454 Ga0207661_100094542 163
172 3300025944 Ga0207661_10843073 Ga0207661_108430732 163
173 3300025949 Ga0207667_10323433 Ga0207667_103234332 163
174 3300025960 Ga0207651_10001030 Ga0207651_100010306 163
175 3300025960 Ga0207651_10046190 Ga0207651_100461903 163
176 3300025981 Ga0207640_10471271 Ga0207640_104712712 163
177 3300025986 Ga0207658_10009194 Ga0207658_100091944 163
178 3300026023 Ga0207677_10002148 Ga0207677_100021486 163
179 3300026023 Ga0207677_10052215 Ga0207677_100522153 163
180 3300026035 Ga0207703_10035102 Ga0207703_100351023 163
181 3300026035 Ga0207703_10174042 Ga0207703_101740424 163
182 3300026041 Ga0207639_10058682 Ga0207639_100586823 163
183 3300026067 Ga0207678_10154865 Ga0207678_101548652 163
184 3300026067 Ga0207678_10206848 Ga0207678_102068483 163
185 3300026067 Ga0207678_10435416 Ga0207678_104354162 163
186 3300026078 Ga0207702_10123728 Ga0207702_101237282 163
187 3300026088 Ga0207641_10108001 Ga0207641_101080013 163
188 3300026089 Ga0207648_10010297 Ga0207648_100102975 163
189 3300026089 Ga0207648_10517057 Ga0207648_105170572 163
190 3300026095 Ga0207676_10039893 Ga0207676_100398934 163
191 3300026095 Ga0207676_10488244 Ga0207676_104882441 163
192 3300026121 Ga0207683_10012503 Ga0207683_100125035 163
193 3300026142 Ga0207698_10035931 Ga0207698_100359313 163
194 3300026142 Ga0207698_10103521 Ga0207698_101035213 163
195 3300028381 Ga0268264_10439012 Ga0268264_104390123 163
196 3300034816 Ga0373930_0143244 Ga0373930_0143244_22_513 163
197 3300035121 Ga0373960_0005917 Ga0373960_0005917_211_702 163
198 3300035691 Ga0373931_0023562 Ga0373931_0023562_1035_1526 163
199 3300037312 Ga0395899_0067804 Ga0395899_0067804_1609_2100 163
200 3300037418 Ga0395900_0001102 Ga0395900_0001102_10601_11092 163
201 3300037466 Ga0395898_0038278 Ga0395898_0038278_3746_4237 163
202 3300037471 Ga0395905_0033641 Ga0395905_0033641_518_1009 163
203 3300038443 Ga0395901_0001088 Ga0395901_0001088_24018_24509 163
204 3300044683 Ga0466965_0426355 Ga0466965_0426355_140_637 163
205 3300044684 Ga0466966_0079413 Ga0466966_0079413_710_1201 163
206 3300044719 Ga0466971_0004121 Ga0466971_0004121_4639_5130 163
207 3300044765 Ga0466970_0036150 Ga0466970_0036150_1621_2112 163
208 3300044842 Ga0466957_0000705 Ga0466957_0000705_12780_13271 163
209 3300045836 Ga0466958_0026480 Ga0466958_0026480_589_1080 163
210 3300045976 Ga0466967_0000571 Ga0466967_0000571_3819_4310 163
211 3300048903 Ga0496100_0006192 Ga0496100_0006192_915_1406 163
212 3300048904 Ga0496101_0001753 Ga0496101_0001753_10614_11105 163
213 3300048905 Ga0496102_0237098 Ga0496102_0237098_12_503 163
214 3300048906 Ga0496103_0083064 Ga0496103_0083064_1068_1559 163
215 3300048908 Ga0496105_0087017 Ga0496105_0087017_1293_1784 163
216 3300048909 Ga0496106_0065791 Ga0496106_0065791_915_1406 163
217 3300048910 Ga0496107_0003789 Ga0496107_0003789_4639_5130 163
218 3300048911 Ga0496108_0001787 Ga0496108_0001787_472_963 163
219 3300048913 Ga0496110_0032650 Ga0496110_0032650_2443_2934 163
220 3300048914 Ga0496111_0018568 Ga0496111_0018568_1895_2386 163
221 3300048915 Ga0496112_0091406 Ga0496112_0091406_2288_2779 163
222 3300048916 Ga0496113_0023645 Ga0496113_0023645_2172_2663 163
223 3300048917 Ga0496114_0053548 Ga0496114_0053548_1923_2414 163
224 3300001904 JGI24736J21556_1011682 JGI24736J21556_10116822 164
225 3300001915 JGI24741J21665_1020384 JGI24741J21665_10203842 164
226 3300001978 JGI24747J21853_1000204 JGI24747J21853_10002043 164
227 3300001979 JGI24740J21852_10018085 JGI24740J21852_100180853 164
228 3300001979 JGI24740J21852_10021715 JGI24740J21852_100217153 164
229 3300001989 JGI24739J22299_10020704 JGI24739J22299_100207043 164
230 3300001990 JGI24737J22298_10024619 JGI24737J22298_100246192 164
231 3300001990 JGI24737J22298_10035115 JGI24737J22298_100351153 164
232 3300001991 JGI24743J22301_10000584 JGI24743J22301_100005844 164
233 3300002067 JGI24735J21928_10026522 JGI24735J21928_100265222 164
234 3300002067 JGI24735J21928_10075280 JGI24735J21928_100752802 164
235 3300002075 JGI24738J21930_10003157 JGI24738J21930_100031574 164
236 3300002075 JGI24738J21930_10005672 JGI24738J21930_100056722 164
237 3300002077 JGI24744J21845_10000021 JGI24744J21845_1000002117 164
238 3300002126 JGI24035J26624_1010607 JGI24035J26624_10106071 164
239 3300002239 JGI24034J26672_10023874 JGI24034J26672_100238742 164
240 3300005293 Ga0065715_10012112 Ga0065715_100121123 164
241 3300005327 Ga0070658_10032959 Ga0070658_100329592 164
242 3300005327 Ga0070658_10048240 Ga0070658_100482404 164
243 3300005327 Ga0070658_10187535 Ga0070658_101875354 164
244 3300005327 Ga0070658_10234689 Ga0070658_102346892 164
245 3300005327 Ga0070658_10337026 Ga0070658_103370261 164
246 3300005327 Ga0070658_10704554 Ga0070658_107045542 164
247 3300005328 Ga0070676_10047500 Ga0070676_100475004 164
248 3300005328 Ga0070676_10630872 Ga0070676_106308722 164
249 3300005329 Ga0070683_100004124 Ga0070683_1000041246 164
250 3300005329 Ga0070683_100043942 Ga0070683_1000439424 164
251 3300005329 Ga0070683_100292645 Ga0070683_1002926452 164
252 3300005331 Ga0070670_100021087 Ga0070670_1000210876 164
253 3300005331 Ga0070670_100162227 Ga0070670_1001622272 164
254 3300005331 Ga0070670_100241516 Ga0070670_1002415161 164
255 3300005331 Ga0070670_100420200 Ga0070670_1004202001 164
256 3300005333 Ga0070677_10191731 Ga0070677_101917312 164
257 3300005334 Ga0068869_100261492 Ga0068869_1002614923 164
258 3300005335 Ga0070666_10028098 Ga0070666_100280984 164
259 3300005335 Ga0070666_10161803 Ga0070666_101618034 164
260 3300005335 Ga0070666_10549454 Ga0070666_105494541 164
261 3300005336 Ga0070680_100002570 Ga0070680_1000025707 164
262 3300005336 Ga0070680_100003391 Ga0070680_1000033911 164
263 3300005336 Ga0070680_100064048 Ga0070680_1000640484 164
264 3300005336 Ga0070680_100142075 Ga0070680_1001420754 164
265 3300005336 Ga0070680_100264351 Ga0070680_1002643513 164
266 3300005336 Ga0070680_100562030 Ga0070680_1005620302 164
267 3300005337 Ga0070682_100028197 Ga0070682_1000281975 164
268 3300005338 Ga0068868_100023182 Ga0068868_1000231825 164
269 3300005338 Ga0068868_100786408 Ga0068868_1007864081 164
270 3300005339 Ga0070660_100000116 Ga0070660_1000001164 164
271 3300005339 Ga0070660_100065600 Ga0070660_1000656003 164
272 3300005339 Ga0070660_100125794 Ga0070660_1001257941 164
273 3300005339 Ga0070660_100187132 Ga0070660_1001871322 164
274 3300005339 Ga0070660_100260417 Ga0070660_1002604173 164
275 3300005343 Ga0070687_100081787 Ga0070687_1000817874 164
276 3300005344 Ga0070661_100034113 Ga0070661_1000341135 164
277 3300005344 Ga0070661_100056555 Ga0070661_1000565554 164
278 3300005344 Ga0070661_100066827 Ga0070661_1000668272 164
279 3300005344 Ga0070661_100092574 Ga0070661_1000925744 164
280 3300005344 Ga0070661_100115020 Ga0070661_1001150204 164
281 3300005344 Ga0070661_100169222 Ga0070661_1001692222 164
282 3300005344 Ga0070661_100422322 Ga0070661_1004223221 164
283 3300005344 Ga0070661_100579965 Ga0070661_1005799652 164
284 3300005345 Ga0070692_10051674 Ga0070692_100516743 164
285 3300005347 Ga0070668_100117202 Ga0070668_1001172023 164
286 3300005354 Ga0070675_100067188 Ga0070675_1000671883 164
287 3300005355 Ga0070671_100004853 Ga0070671_1000048534 164
288 3300005355 Ga0070671_100010817 Ga0070671_1000108173 164
289 3300005355 Ga0070671_100071911 Ga0070671_1000719113 164
290 3300005355 Ga0070671_100277161 Ga0070671_1002771612 164
291 3300005356 Ga0070674_100001041 Ga0070674_1000010418 164
292 3300005356 Ga0070674_100712826 Ga0070674_1007128262 164
293 3300005364 Ga0070673_100002158 Ga0070673_10000215810 164
294 3300005364 Ga0070673_100703920 Ga0070673_1007039202 164
295 3300005366 Ga0070659_100015457 Ga0070659_1000154572 164
296 3300005366 Ga0070659_100154794 Ga0070659_1001547942 164
297 3300005367 Ga0070667_100201843 Ga0070667_1002018431 164
298 3300005367 Ga0070667_100240611 Ga0070667_1002406113 164
299 3300005367 Ga0070667_100725410 Ga0070667_1007254102 164
300 3300005434 Ga0070709_10213133 Ga0070709_102131331 164
301 3300005435 Ga0070714_100076452 Ga0070714_1000764524 164
302 3300005435 Ga0070714_100177177 Ga0070714_1001771773 164
303 3300005435 Ga0070714_100423488 Ga0070714_1004234883 164
304 3300005436 Ga0070713_100392399 Ga0070713_1003923993 164
305 3300005440 Ga0070705_101049364 Ga0070705_1010493641 164
306 3300005455 Ga0070663_100007525 Ga0070663_1000075256 164
307 3300005455 Ga0070663_100035592 Ga0070663_1000355924 164
308 3300005455 Ga0070663_100053451 Ga0070663_1000534513 164
309 3300005455 Ga0070663_100111141 Ga0070663_1001111412 164
310 3300005455 Ga0070663_100214472 Ga0070663_1002144722 164
311 3300005455 Ga0070663_100351429 Ga0070663_1003514291 164
312 3300005456 Ga0070678_100002512 Ga0070678_1000025124 164
313 3300005456 Ga0070678_100035954 Ga0070678_1000359543 164
314 3300005456 Ga0070678_100158536 Ga0070678_1001585364 164
315 3300005457 Ga0070662_100011899 Ga0070662_1000118995 164
316 3300005457 Ga0070662_100033010 Ga0070662_1000330104 164
317 3300005458 Ga0070681_10168041 Ga0070681_101680412 164
318 3300005458 Ga0070681_10197569 Ga0070681_101975693 164
319 3300005459 Ga0068867_100016168 Ga0068867_1000161684 164
320 3300005459 Ga0068867_100407770 Ga0068867_1004077702 164
321 3300005466 Ga0070685_10158867 Ga0070685_101588672 164
322 3300005530 Ga0070679_100001280 Ga0070679_1000012806 164
323 3300005530 Ga0070679_100051365 Ga0070679_1000513654 164
324 3300005530 Ga0070679_100114225 Ga0070679_1001142254 164
325 3300005530 Ga0070679_100180111 Ga0070679_1001801113 164
326 3300005530 Ga0070679_100383486 Ga0070679_1003834862 164
327 3300005530 Ga0070679_100411131 Ga0070679_1004111312 164
328 3300005530 Ga0070679_100419355 Ga0070679_1004193552 164
329 3300005530 Ga0070679_100849406 Ga0070679_1008494062 164
330 3300005535 Ga0070684_100022154 Ga0070684_1000221545 164
331 3300005535 Ga0070684_100227627 Ga0070684_1002276272 164
332 3300005535 Ga0070684_101526187 Ga0070684_1015261871 164
333 3300005539 Ga0068853_100025046 Ga0068853_1000250465 164
334 3300005539 Ga0068853_100042084 Ga0068853_1000420843 164
335 3300005539 Ga0068853_100678983 Ga0068853_1006789831 164
336 3300005543 Ga0070672_100023951 Ga0070672_1000239514 164
337 3300005543 Ga0070672_100581068 Ga0070672_1005810682 164
338 3300005547 Ga0070693_100038234 Ga0070693_1000382343 164
339 3300005548 Ga0070665_100050275 Ga0070665_1000502752 164
340 3300005548 Ga0070665_100054124 Ga0070665_1000541244 164
341 3300005563 Ga0068855_100133670 Ga0068855_1001336704 164
342 3300005563 Ga0068855_100158273 Ga0068855_1001582733 164
343 3300005563 Ga0068855_100294100 Ga0068855_1002941003 164
344 3300005564 Ga0070664_100022314 Ga0070664_1000223143 164
345 3300005564 Ga0070664_100024085 Ga0070664_1000240852 164
346 3300005564 Ga0070664_100115233 Ga0070664_1001152333 164
347 3300005564 Ga0070664_100153259 Ga0070664_1001532593 164
348 3300005564 Ga0070664_100177887 Ga0070664_1001778872 164
349 3300005564 Ga0070664_100398754 Ga0070664_1003987542 164
350 3300005564 Ga0070664_101663490 Ga0070664_1016634901 164
351 3300005577 Ga0068857_100029971 Ga0068857_1000299714 164
352 3300005577 Ga0068857_100039813 Ga0068857_1000398135 164
353 3300005577 Ga0068857_100097331 Ga0068857_1000973312 164
354 3300005577 Ga0068857_101947232 Ga0068857_1019472321 164
355 3300005578 Ga0068854_100015728 Ga0068854_1000157283 164
356 3300005578 Ga0068854_100038221 Ga0068854_1000382213 164
357 3300005578 Ga0068854_100057624 Ga0068854_1000576244 164
358 3300005578 Ga0068854_100076822 Ga0068854_1000768223 164
359 3300005578 Ga0068854_100118414 Ga0068854_1001184143 164
360 3300005614 Ga0068856_100025157 Ga0068856_1000251573 164
361 3300005614 Ga0068856_100103479 Ga0068856_1001034795 164
362 3300005614 Ga0068856_100137062 Ga0068856_1001370622 164
363 3300005614 Ga0068856_100139472 Ga0068856_1001394723 164
364 3300005614 Ga0068856_100159498 Ga0068856_1001594983 164
365 3300005614 Ga0068856_100238050 Ga0068856_1002380503 164
366 3300005614 Ga0068856_100601497 Ga0068856_1006014971 164
367 3300005616 Ga0068852_100001974 Ga0068852_1000019746 164
368 3300005616 Ga0068852_100008915 Ga0068852_1000089152 164
369 3300005616 Ga0068852_100045286 Ga0068852_1000452863 164
370 3300005616 Ga0068852_100084192 Ga0068852_1000841923 164
371 3300005616 Ga0068852_100155966 Ga0068852_1001559663 164
372 3300005616 Ga0068852_100169832 Ga0068852_1001698322 164
373 3300005616 Ga0068852_100225645 Ga0068852_1002256452 164
374 3300005616 Ga0068852_100350399 Ga0068852_1003503992 164
375 3300005616 Ga0068852_100464934 Ga0068852_1004649343 164
376 3300005616 Ga0068852_100577573 Ga0068852_1005775732 164
377 3300005616 Ga0068852_100654747 Ga0068852_1006547472 164
378 3300005616 Ga0068852_100684457 Ga0068852_1006844572 164
379 3300005618 Ga0068864_100001341 Ga0068864_10000134112 164
380 3300005718 Ga0068866_10003689 Ga0068866_100036892 164
381 3300005834 Ga0068851_10090165 Ga0068851_100901653 164
382 3300005834 Ga0068851_10091637 Ga0068851_100916372 164
383 3300005834 Ga0068851_10247609 Ga0068851_102476092 164
384 3300005840 Ga0068870_10075085 Ga0068870_100750851 164
385 3300005985 Ga0081539_10021906 Ga0081539_100219065 164
386 3300006028 Ga0070717_10459431 Ga0070717_104594312 164
387 3300006028 Ga0070717_11154419 Ga0070717_111544191 164
388 3300006237 Ga0097621_100239918 Ga0097621_1002399184 164
389 3300006237 Ga0097621_100252407 Ga0097621_1002524072 164
390 3300006358 Ga0068871_100061949 Ga0068871_1000619493 164
391 3300009093 Ga0105240_10087384 Ga0105240_100873843 164
392 3300009098 Ga0105245_10020473 Ga0105245_100204734 164
393 3300009098 Ga0105245_10173471 Ga0105245_101734714 164
394 3300009148 Ga0105243_10049487 Ga0105243_100494873 164
395 3300009174 Ga0105241_10069833 Ga0105241_100698332 164
396 3300009174 Ga0105241_10088239 Ga0105241_100882394 164
397 3300009174 Ga0105241_10730713 Ga0105241_107307132 164
398 3300009176 Ga0105242_10566524 Ga0105242_105665242 164
399 3300009177 Ga0105248_10000660 Ga0105248_1000066016 164
400 3300009177 Ga0105248_10113704 Ga0105248_101137042 164
401 3300009177 Ga0105248_10500364 Ga0105248_105003642 164
402 3300009177 Ga0105248_11467141 Ga0105248_114671412 164
403 3300009551 Ga0105238_10153328 Ga0105238_101533283 164
404 3300009551 Ga0105238_10181866 Ga0105238_101818663 164
405 3300009551 Ga0105238_10348604 Ga0105238_103486043 164
406 3300009551 Ga0105238_11531707 Ga0105238_115317071 164
407 3300010375 Ga0105239_10649910 Ga0105239_106499101 164
408 3300010375 Ga0105239_12511807 Ga0105239_125118071 164
409 3300011119 Ga0105246_10068729 Ga0105246_100687294 164
410 3300013100 Ga0157373_10019690 Ga0157373_100196903 164
411 3300013100 Ga0157373_10163904 Ga0157373_101639042 164
412 3300013100 Ga0157373_10177479 Ga0157373_101774792 164
413 3300013100 Ga0157373_10376326 Ga0157373_103763261 164
414 3300013100 Ga0157373_10431701 Ga0157373_104317012 164
415 3300013102 Ga0157371_10052929 Ga0157371_100529294 164
416 3300013102 Ga0157371_10096234 Ga0157371_100962341 164
417 3300013102 Ga0157371_10124358 Ga0157371_101243582 164
418 3300013102 Ga0157371_10160181 Ga0157371_101601811 164
419 3300013104 Ga0157370_10000497 Ga0157370_1000049719 164
420 3300013104 Ga0157370_10010410 Ga0157370_100104107 164
421 3300013104 Ga0157370_10066402 Ga0157370_100664024 164
422 3300013104 Ga0157370_10116210 Ga0157370_101162102 164
423 3300013104 Ga0157370_10377737 Ga0157370_103777372 164
424 3300013105 Ga0157369_10003764 Ga0157369_100037644 164
425 3300013105 Ga0157369_10055446 Ga0157369_100554463 164
426 3300013105 Ga0157369_10200612 Ga0157369_102006124 164
427 3300013105 Ga0157369_10210792 Ga0157369_102107922 164
428 3300013105 Ga0157369_10284876 Ga0157369_102848762 164
429 3300013105 Ga0157369_10297134 Ga0157369_102971342 164
430 3300013105 Ga0157369_10475397 Ga0157369_104753971 164
431 3300013105 Ga0157369_10555183 Ga0157369_105551832 164
432 3300013105 Ga0157369_10927493 Ga0157369_109274932 164
433 3300013296 Ga0157374_10063506 Ga0157374_100635064 164
434 3300013296 Ga0157374_10138127 Ga0157374_101381273 164
435 3300013296 Ga0157374_10822399 Ga0157374_108223992 164
436 3300013296 Ga0157374_11670802 Ga0157374_116708021 164
437 3300013297 Ga0157378_10078794 Ga0157378_100787944 164
438 3300013306 Ga0163162_10364719 Ga0163162_103647193 164
439 3300013306 Ga0163162_10640486 Ga0163162_106404861 164
440 3300013306 Ga0163162_10753145 Ga0163162_107531451 164
441 3300013307 Ga0157372_10026426 Ga0157372_100264263 164
442 3300013307 Ga0157372_10218786 Ga0157372_102187863 164
443 3300013307 Ga0157372_10257274 Ga0157372_102572744 164
444 3300013307 Ga0157372_10319279 Ga0157372_103192792 164
445 3300013307 Ga0157372_10768190 Ga0157372_107681902 164
446 3300013307 Ga0157372_11821417 Ga0157372_118214172 164
447 3300013308 Ga0157375_10119529 Ga0157375_101195293 164
448 3300013308 Ga0157375_10489511 Ga0157375_104895112 164
449 3300014497 Ga0182008_10208012 Ga0182008_102080122 164
450 3300017792 Ga0163161_10061919 Ga0163161_100619193 164
451 3300025315 Ga0207697_10013257 Ga0207697_100132573 164
452 3300025315 Ga0207697_10085278 Ga0207697_100852782 164
453 3300025321 Ga0207656_10046355 Ga0207656_100463552 164
454 3300025321 Ga0207656_10101231 Ga0207656_101012311 164
455 3300025321 Ga0207656_10179386 Ga0207656_101793862 164
456 3300025893 Ga0207682_10047157 Ga0207682_100471574 164
457 3300025893 Ga0207682_10194039 Ga0207682_101940392 164
458 3300025899 Ga0207642_10002131 Ga0207642_100021313 164
459 3300025901 Ga0207688_10021461 Ga0207688_100214614 164
460 3300025903 Ga0207680_10259622 Ga0207680_102596222 164
461 3300025904 Ga0207647_10015640 Ga0207647_100156403 164
462 3300025904 Ga0207647_10076374 Ga0207647_100763742 164
463 3300025904 Ga0207647_10097855 Ga0207647_100978553 164
464 3300025904 Ga0207647_10099897 Ga0207647_100998972 164
465 3300025907 Ga0207645_10052507 Ga0207645_100525073 164
466 3300025907 Ga0207645_10082460 Ga0207645_100824603 164
467 3300025908 Ga0207643_10223166 Ga0207643_102231662 164
468 3300025909 Ga0207705_10000123 Ga0207705_1000012354 164
469 3300025909 Ga0207705_10004136 Ga0207705_100041366 164
470 3300025909 Ga0207705_10015028 Ga0207705_100150284 164
471 3300025909 Ga0207705_10027408 Ga0207705_100274084 164
472 3300025909 Ga0207705_10049597 Ga0207705_100495973 164
473 3300025909 Ga0207705_10063830 Ga0207705_100638303 164
474 3300025909 Ga0207705_10092079 Ga0207705_100920792 164
475 3300025909 Ga0207705_10173743 Ga0207705_101737432 164
476 3300025912 Ga0207707_10100523 Ga0207707_101005231 164
477 3300025912 Ga0207707_10354541 Ga0207707_103545413 164
478 3300025912 Ga0207707_10437660 Ga0207707_104376602 164
479 3300025912 Ga0207707_10945419 Ga0207707_109454191 164
480 3300025917 Ga0207660_10000052 Ga0207660_1000005213 164
481 3300025917 Ga0207660_10001036 Ga0207660_100010367 164
482 3300025917 Ga0207660_10108985 Ga0207660_101089852 164
483 3300025918 Ga0207662_10008372 Ga0207662_100083723 164
484 3300025919 Ga0207657_10000650 Ga0207657_1000065046 164
485 3300025919 Ga0207657_10004176 Ga0207657_100041767 164
486 3300025919 Ga0207657_10018661 Ga0207657_100186615 164
487 3300025919 Ga0207657_10040902 Ga0207657_100409024 164
488 3300025919 Ga0207657_10167958 Ga0207657_101679582 164
489 3300025919 Ga0207657_10371085 Ga0207657_103710852 164
490 3300025920 Ga0207649_10024391 Ga0207649_100243915 164
491 3300025920 Ga0207649_10031257 Ga0207649_100312575 164
492 3300025920 Ga0207649_10035609 Ga0207649_100356093 164
493 3300025920 Ga0207649_10036486 Ga0207649_100364864 164
494 3300025920 Ga0207649_10061403 Ga0207649_100614033 164
495 3300025920 Ga0207649_10091115 Ga0207649_100911152 164
496 3300025920 Ga0207649_10188709 Ga0207649_101887091 164
497 3300025920 Ga0207649_10263185 Ga0207649_102631852 164
498 3300025920 Ga0207649_10372703 Ga0207649_103727032 164
499 3300025921 Ga0207652_10000034 Ga0207652_1000003460 164
500 3300025921 Ga0207652_10133879 Ga0207652_101338792 164
501 3300025921 Ga0207652_10138846 Ga0207652_101388463 164
502 3300025921 Ga0207652_10362730 Ga0207652_103627302 164
503 3300025921 Ga0207652_10929361 Ga0207652_109293612 164
504 3300025923 Ga0207681_10117399 Ga0207681_101173994 164
505 3300025924 Ga0207694_10505937 Ga0207694_105059372 164
506 3300025924 Ga0207694_10966583 Ga0207694_109665832 164
507 3300025924 Ga0207694_11371767 Ga0207694_113717671 164
508 3300025925 Ga0207650_10091632 Ga0207650_100916321 164
509 3300025925 Ga0207650_10426663 Ga0207650_104266632 164
510 3300025926 Ga0207659_10255537 Ga0207659_102555373 164
511 3300025927 Ga0207687_10013791 Ga0207687_100137914 164
512 3300025927 Ga0207687_10023383 Ga0207687_100233834 164
513 3300025928 Ga0207700_10339840 Ga0207700_103398403 164
514 3300025929 Ga0207664_10008734 Ga0207664_100087343 164
515 3300025929 Ga0207664_10069171 Ga0207664_100691713 164
516 3300025929 Ga0207664_10457049 Ga0207664_104570492 164
517 3300025931 Ga0207644_10024565 Ga0207644_100245655 164
518 3300025931 Ga0207644_10031115 Ga0207644_100311153 164
519 3300025931 Ga0207644_10032830 Ga0207644_100328303 164
520 3300025931 Ga0207644_10057593 Ga0207644_100575933 164
521 3300025931 Ga0207644_10085255 Ga0207644_100852552 164
522 3300025932 Ga0207690_10011299 Ga0207690_100112993 164
523 3300025932 Ga0207690_10038358 Ga0207690_100383583 164
524 3300025932 Ga0207690_10063463 Ga0207690_100634634 164
525 3300025932 Ga0207690_10215168 Ga0207690_102151681 164
526 3300025932 Ga0207690_10394337 Ga0207690_103943373 164
527 3300025932 Ga0207690_10458401 Ga0207690_104584012 164
528 3300025933 Ga0207706_10019926 Ga0207706_100199265 164
529 3300025933 Ga0207706_10071990 Ga0207706_100719903 164
530 3300025933 Ga0207706_10077257 Ga0207706_100772572 164
531 3300025933 Ga0207706_10103934 Ga0207706_101039344 164
532 3300025933 Ga0207706_10106354 Ga0207706_101063543 164
533 3300025934 Ga0207686_10419651 Ga0207686_104196512 164
534 3300025935 Ga0207709_10037346 Ga0207709_100373463 164
535 3300025937 Ga0207669_10002786 Ga0207669_100027865 164
536 3300025937 Ga0207669_10589777 Ga0207669_105897772 164
537 3300025938 Ga0207704_10056717 Ga0207704_100567173 164
538 3300025938 Ga0207704_10278045 Ga0207704_102780452 164
539 3300025940 Ga0207691_10044268 Ga0207691_100442683 164
540 3300025940 Ga0207691_10230701 Ga0207691_102307012 164
541 3300025940 Ga0207691_10656417 Ga0207691_106564172 164
542 3300025940 Ga0207691_10821838 Ga0207691_108218382 164
543 3300025941 Ga0207711_10007812 Ga0207711_100078126 164
544 3300025941 Ga0207711_10235124 Ga0207711_102351242 164
545 3300025941 Ga0207711_10475502 Ga0207711_104755023 164
546 3300025941 Ga0207711_11007433 Ga0207711_110074331 164
547 3300025942 Ga0207689_10040941 Ga0207689_100409414 164
548 3300025944 Ga0207661_10001415 Ga0207661_100014158 164
549 3300025944 Ga0207661_10062788 Ga0207661_100627882 164
550 3300025944 Ga0207661_10091195 Ga0207661_100911952 164
551 3300025944 Ga0207661_10595769 Ga0207661_105957691 164
552 3300025944 Ga0207661_10635234 Ga0207661_106352341 164
553 3300025945 Ga0207679_10023879 Ga0207679_100238794 164
554 3300025945 Ga0207679_10051339 Ga0207679_100513394 164
555 3300025945 Ga0207679_10145398 Ga0207679_101453984 164
556 3300025945 Ga0207679_10275284 Ga0207679_102752842 164
557 3300025945 Ga0207679_10447927 Ga0207679_104479272 164
558 3300025949 Ga0207667_10022070 Ga0207667_100220704 164
559 3300025949 Ga0207667_10236562 Ga0207667_102365622 164
560 3300025949 Ga0207667_11012203 Ga0207667_110122032 164
561 3300025960 Ga0207651_10028843 Ga0207651_100288434 164
562 3300025960 Ga0207651_10139789 Ga0207651_101397894 164
563 3300025972 Ga0207668_10155655 Ga0207668_101556553 164
564 3300025981 Ga0207640_10018554 Ga0207640_100185545 164
565 3300025981 Ga0207640_10097059 Ga0207640_100970592 164
566 3300025981 Ga0207640_10430562 Ga0207640_104305622 164
567 3300025986 Ga0207658_10063588 Ga0207658_100635884 164
568 3300025986 Ga0207658_10198854 Ga0207658_101988542 164
569 3300025986 Ga0207658_10270879 Ga0207658_102708792 164
570 3300026023 Ga0207677_10006119 Ga0207677_100061193 164
571 3300026023 Ga0207677_10011379 Ga0207677_100113793 164
572 3300026023 Ga0207677_10152897 Ga0207677_101528972 164
573 3300026023 Ga0207677_10282520 Ga0207677_102825202 164
574 3300026041 Ga0207639_10089776 Ga0207639_100897763 164
575 3300026041 Ga0207639_10646373 Ga0207639_106463732 164
576 3300026067 Ga0207678_10000530 Ga0207678_1000053025 164
577 3300026067 Ga0207678_10002494 Ga0207678_1000249413 164
578 3300026067 Ga0207678_10021744 Ga0207678_100217447 164
579 3300026067 Ga0207678_10024326 Ga0207678_100243264 164
580 3300026067 Ga0207678_10027197 Ga0207678_100271973 164
581 3300026067 Ga0207678_10041478 Ga0207678_100414783 164
582 3300026067 Ga0207678_10186931 Ga0207678_101869312 164
583 3300026067 Ga0207678_10201626 Ga0207678_102016262 164
584 3300026067 Ga0207678_10354892 Ga0207678_103548923 164
585 3300026067 Ga0207678_10453569 Ga0207678_104535691 164
586 3300026078 Ga0207702_10018792 Ga0207702_100187925 164
587 3300026078 Ga0207702_10050657 Ga0207702_100506572 164
588 3300026078 Ga0207702_10385662 Ga0207702_103856621 164
589 3300026078 Ga0207702_10432780 Ga0207702_104327803 164
590 3300026088 Ga0207641_10029554 Ga0207641_100295544 164
591 3300026088 Ga0207641_10735453 Ga0207641_107354531 164
592 3300026089 Ga0207648_10011451 Ga0207648_100114515 164
593 3300026089 Ga0207648_10068994 Ga0207648_100689943 164
594 3300026089 Ga0207648_10456212 Ga0207648_104562121 164
595 3300026095 Ga0207676_10000253 Ga0207676_1000025323 164
596 3300026095 Ga0207676_10122960 Ga0207676_101229604 164
597 3300026116 Ga0207674_10004040 Ga0207674_100040408 164
598 3300026116 Ga0207674_10013613 Ga0207674_100136134 164
599 3300026116 Ga0207674_10032947 Ga0207674_100329473 164
600 3300026121 Ga0207683_10010831 Ga0207683_100108315 164
601 3300026121 Ga0207683_10049063 Ga0207683_100490632 164
602 3300026121 Ga0207683_10106564 Ga0207683_101065643 164
603 3300026142 Ga0207698_10015169 Ga0207698_100151694 164
604 3300026142 Ga0207698_10023566 Ga0207698_100235665 164
605 3300026142 Ga0207698_10079393 Ga0207698_100793934 164
606 3300026142 Ga0207698_10090038 Ga0207698_100900383 164
607 3300026142 Ga0207698_10188999 Ga0207698_101889992 164
608 3300026142 Ga0207698_10200030 Ga0207698_102000302 164
609 3300026142 Ga0207698_10205832 Ga0207698_102058323 164
610 3300026142 Ga0207698_10504304 Ga0207698_105043043 164
611 3300026142 Ga0207698_10957347 Ga0207698_109573471 164
612 3300028379 Ga0268266_10113944 Ga0268266_101139444 164
613 3300031548 Ga0307408_100043976 Ga0307408_1000439762 164
614 3300031548 Ga0307408_100968228 Ga0307408_1009682282 164
615 3300031731 Ga0307405_10036075 Ga0307405_100360752 164
616 3300031731 Ga0307405_11123725 Ga0307405_111237251 164
617 3300031824 Ga0307413_10020497 Ga0307413_100204972 164
618 3300031852 Ga0307410_10045770 Ga0307410_100457702 164
619 3300031995 Ga0307409_100035870 Ga0307409_1000358703 164
620 3300031995 Ga0307409_100063136 Ga0307409_1000631362 164
621 3300032002 Ga0307416_100012031 Ga0307416_1000120313 164
622 3300032004 Ga0307414_10222938 Ga0307414_102229383 164
623 3300032005 Ga0307411_10035683 Ga0307411_100356832 164
624 3300032005 Ga0307411_10118565 Ga0307411_101185651 164
625 3300032005 Ga0307411_10699818 Ga0307411_106998182 164
626 3300032126 Ga0307415_100056377 Ga0307415_1000563773 164
627 3300032126 Ga0307415_100407050 Ga0307415_1004070502 164
628 3300035170 Ga0373943_0006847 Ga0373943_0006847_1303_1797 164
629 3300035171 Ga0373946_0005931 Ga0373946_0005931_2889_3383 164
630 3300035695 Ga0373927_0027773 Ga0373927_0027773_1271_1765 164
631 3300035725 Ga0373947_0279550 Ga0373947_0279550_91_585 164
632 3300036401 Ga0373937_0590848 Ga0373937_0590848_244_738 164
633 3300037068 Ga0373925_0009468 Ga0373925_0009468_4905_5399 164
634 3300037312 Ga0395899_0012920 Ga0395899_0012920_3496_3990 164
635 3300037312 Ga0395899_0087703 Ga0395899_0087703_1182_1676 164
636 3300037312 Ga0395899_0213781 Ga0395899_0213781_245_739 164
637 3300037418 Ga0395900_0008653 Ga0395900_0008653_6467_6961 164
638 3300037418 Ga0395900_0031013 Ga0395900_0031013_1157_1651 164
639 3300037418 Ga0395900_0106995 Ga0395900_0106995_1317_1811 164
640 3300037418 Ga0395900_0145515 Ga0395900_0145515_389_883 164
641 3300037418 Ga0395900_0166674 Ga0395900_0166674_789_1283 164
642 3300037418 Ga0395900_0249855 Ga0395900_0249855_343_837 164
643 3300037418 Ga0395900_0297424 Ga0395900_0297424_517_1011 164
644 3300037418 Ga0395900_0457506 Ga0395900_0457506_28_522 164
645 3300037418 Ga0395900_1028271 Ga0395900_1028271_140_634 164
646 3300037466 Ga0395898_0016450 Ga0395898_0016450_3580_4074 164
647 3300037466 Ga0395898_0204646 Ga0395898_0204646_462_956 164
648 3300037466 Ga0395898_0365318 Ga0395898_0365318_825_1319 164
649 3300037466 Ga0395898_0389936 Ga0395898_0389936_424_918 164
650 3300037466 Ga0395898_0421527 Ga0395898_0421527_197_691 164
651 3300037471 Ga0395905_0002464 Ga0395905_0002464_16689_17183 164
652 3300037471 Ga0395905_0006500 Ga0395905_0006500_7489_7983 164
653 3300037471 Ga0395905_0008333 Ga0395905_0008333_5277_5771 164
654 3300037471 Ga0395905_0105299 Ga0395905_0105299_977_1471 164
655 3300037471 Ga0395905_0134636 Ga0395905_0134636_305_799 164
656 3300037471 Ga0395905_0229689 Ga0395905_0229689_874_1368 164
657 3300037471 Ga0395905_0337027 Ga0395905_0337027_412_909 164
658 3300037471 Ga0395905_0391059 Ga0395905_0391059_605_1099 164
659 3300038443 Ga0395901_0002597 Ga0395901_0002597_16245_16739 164
660 3300038443 Ga0395901_0012345 Ga0395901_0012345_3994_4488 164
661 3300038443 Ga0395901_0073739 Ga0395901_0073739_1245_1739 164
662 3300038443 Ga0395901_0082883 Ga0395901_0082883_1014_1508 164
663 3300038443 Ga0395901_0281365 Ga0395901_0281365_657_1151 164
664 3300038443 Ga0395901_0442866 Ga0395901_0442866_725_1219 164
665 3300038443 Ga0395901_0504295 Ga0395901_0504295_710_1204 164
666 3300039437 Ga0436365_0531315 Ga0436365_0531315_1648_2142 164
667 3300039450 Ga0436363_0375292 Ga0436363_0375292_100_594 164
668 3300039450 Ga0436363_0692539 Ga0436363_0692539_94_588 164
669 3300041413 Ga0439465_0031904 Ga0439465_0031904_827_1321 164
670 3300042005 Ga0439448_0138677 Ga0439448_0138677_318_815 164
671 3300042006 Ga0439432_015655 Ga0439432_015655_554_1048 164
672 3300042007 Ga0439449_0013260 Ga0439449_0013260_77_571 164
673 3300042157 Ga0439458_0008142 Ga0439458_0008142_169_666 164
674 3300044656 Ga0466969_0141262 Ga0466969_0141262_566_1060 164
675 3300044656 Ga0466969_0157790 Ga0466969_0157790_446_946 164
676 3300044658 Ga0466972_0151989 Ga0466972_0151989_213_707 164
677 3300044683 Ga0466965_0220158 Ga0466965_0220158_67_561 164
678 3300044684 Ga0466966_0002429 Ga0466966_0002429_1137_1631 164
679 3300044684 Ga0466966_0052512 Ga0466966_0052512_677_1177 164
680 3300044684 Ga0466966_0602446 Ga0466966_0602446_58_552 164
681 3300044693 Ga0466961_0038704 Ga0466961_0038704_169_663 164
682 3300044693 Ga0466961_0082694 Ga0466961_0082694_870_1364 164
683 3300044693 Ga0466961_0105199 Ga0466961_0105199_118_618 164
684 3300044693 Ga0466961_0229477 Ga0466961_0229477_562_1062 164
685 3300044694 Ga0466963_0014749 Ga0466963_0014749_1553_2047 164
686 3300044694 Ga0466963_0032293 Ga0466963_0032293_1042_1536 164
687 3300044694 Ga0466963_0323330 Ga0466963_0323330_340_834 164
688 3300044706 Ga0466964_0091615 Ga0466964_0091615_797_1291 164
689 3300044719 Ga0466971_0072983 Ga0466971_0072983_863_1357 164
690 3300044765 Ga0466970_0397746 Ga0466970_0397746_270_764 164
691 3300044765 Ga0466970_0544963 Ga0466970_0544963_85_579 164
692 3300044765 Ga0466970_0647722 Ga0466970_0647722_20_514 164
693 3300044842 Ga0466957_0119646 Ga0466957_0119646_536_1030 164
694 3300044901 Ga0466960_0011619 Ga0466960_0011619_767_1261 164
695 3300045049 Ga0466959_0106303 Ga0466959_0106303_908_1402 164
696 3300045049 Ga0466959_0251547 Ga0466959_0251547_715_1209 164
697 3300045049 Ga0466959_0308188 Ga0466959_0308188_73_567 164
698 3300045049 Ga0466959_0760919 Ga0466959_0760919_38_538 164
699 3300045836 Ga0466958_0031080 Ga0466958_0031080_1921_2415 164
700 3300045836 Ga0466958_0084439 Ga0466958_0084439_521_1015 164
701 3300045976 Ga0466967_0012199 Ga0466967_0012199_5708_6205 164
702 3300045976 Ga0466967_0029471 Ga0466967_0029471_2911_3405 164
703 3300045976 Ga0466967_0117321 Ga0466967_0117321_739_1233 164
704 3300045976 Ga0466967_0278158 Ga0466967_0278158_1008_1505 164
705 3300045976 Ga0466967_0425157 Ga0466967_0425157_382_876 164
706 3300046525 Ga0495663_0104611 Ga0495663_0104611_106_603 164
707 3300046537 Ga0495598_0000941 Ga0495598_0000941_374_868 164
708 3300046539 Ga0495621_0014678 Ga0495621_0014678_1054_1548 164
709 3300046558 Ga0495633_0023509 Ga0495633_0023509_972_1466 164
710 3300046664 Ga0495659_0101253 Ga0495659_0101253_392_886 164
711 3300046684 Ga0495669_0062763 Ga0495669_0062763_488_982 164
712 3300046684 Ga0495669_0126323 Ga0495669_0126323_363_863 164
713 3300046684 Ga0495669_0154984 Ga0495669_0154984_125_619 164
714 3300046684 Ga0495669_0308209 Ga0495669_0308209_210_707 164
715 3300046691 Ga0495670_0006379 Ga0495670_0006379_3858_4352 164
716 3300046691 Ga0495670_0319615 Ga0495670_0319615_98_598 164
717 3300047445 Ga0495677_0021229 Ga0495677_0021229_1100_1594 164
718 3300048903 Ga0496100_0124551 Ga0496100_0124551_643_1140 164
719 3300048904 Ga0496101_0012456 Ga0496101_0012456_4072_4569 164
720 3300048905 Ga0496102_0018790 Ga0496102_0018790_4934_5428 164
721 3300048909 Ga0496106_0024396 Ga0496106_0024396_2316_2813 164
722 3300048909 Ga0496106_0129789 Ga0496106_0129789_781_1275 164
723 3300048910 Ga0496107_0072222 Ga0496107_0072222_672_1169 164
724 3300048910 Ga0496107_0106531 Ga0496107_0106531_1289_1783 164
725 3300048910 Ga0496107_0607199 Ga0496107_0607199_173_667 164
726 3300048912 Ga0496109_0000995 Ga0496109_0000995_16846_17343 164
727 3300048912 Ga0496109_0225849 Ga0496109_0225849_933_1427 164
728 3300048912 Ga0496109_0663231 Ga0496109_0663231_53_547 164
729 3300048913 Ga0496110_0005992 Ga0496110_0005992_3655_4152 164
730 3300048914 Ga0496111_0023557 Ga0496111_0023557_1126_1623 164
731 3300048915 Ga0496112_0005455 Ga0496112_0005455_9987_10484 164
732 3300048915 Ga0496112_0119024 Ga0496112_0119024_1912_2406 164
733 3300048916 Ga0496113_0252889 Ga0496113_0252889_283_777 164
734 3300049656 Ga0501209_001155 Ga0501209_001155_1482_1976 164
735 3300049664 Ga0501224_001917 Ga0501224_001917_1177_1671 164
736 3300049669 Ga0501235_007338 Ga0501235_007338_107_601 164
737 3300049679 Ga0501249_003896 Ga0501249_003896_1432_1926 164
738 3300049706 Ga0501229_024122 Ga0501229_024122_223_717 164
739 3300049760 Ga0501263_003457 Ga0501263_003457_841_1335 164
740 3300049765 Ga0501268_037296 Ga0501268_037296_311_805 164
741 3300049767 Ga0501270_001256 Ga0501270_001256_1812_2306 164
742 3300061719 Ga0466962_0115330 Ga0466962_0115330_729_1223 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

64

153

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9233 47 92
4fht-assembly1.cif.gz_A crystal structure of the pcav transcriptional regulator from streptomyces coelicolor in complex with its natural ligand 0.9229 35 98
4g9y-assembly1.cif.gz_A-2 crystal structure of the pcav transcriptional regulator from streptomyces coelicolor 0.9002 35 102
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8976 48 92
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8939 36 91
ID Description Score Start End Superfamily
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.99 47 92 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9723 47 91 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9614 47 91 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9525 37 90 1.10.10.10
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9521 36 91 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N3DMQ7-F1-model_v4 Transcriptional regulator 0.9366 18 106 GO:0003677
AF-A0A844ZWB8-F1-model_v4 Winged helix DNA-binding protein 0.909 30 153 GO:0003677
GO:0003700
AF-A0A2P7QH57-F1-model_v4 Transcriptional regulator 0.907 20 157 GO:0003677
AF-A0A4Q8R8C9-F1-model_v4 Transcriptional regulator 0.9063 25 148 GO:0003677
AF-A0A7H0GAQ1-F1-model_v4 deleted 0.902 21 159

Feature Viewer

pLDDT pTM Quality
74.14 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map