F478310

General Info

Members Datasets Scaffolds Average Seq Length
737 316 344 341

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1007348|Ga0055524_10073481
Length 407
Sequence MAVAFLSHEFHFRHRAASEPSTAALMPSGFDVDCRYRLHRVLSAGCFFQDMRPDLGDQFSMNIRMMLLGSAAALVAAPAFAADAIVAAEPEPVEYVRVCDAYGTGYFYIPGTETCLKIEGYIRFQVNVGPNAGGTSATNDSSWDAVTRGQVQFTAKSDTEYGPLTGVIVLQANADNATDQDTILDSAYLDVAGFRAGLFYSWWDDGLSGETDDIGSPVTLHNSIRYQYETGSFYAGLSVDELEDGVFQVGEDPNNVGVAFGIGGTAGAFSYQITGGWDFDNEDGAIRAMGTAEIGPGTLGLAAVYSSGPNSYYANAEWAVAAEXXXKATDKLKITPGVQYYGNYLGSIGSDAVVPDDFDGLGDAWKVGLTVDYQIVDNFYAKASVQYLDPEDGDDVTTGYFRLQRSF

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2519899620 Rhizobium sp. Pop5 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
28 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
32 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
33 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
34 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
35 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
36 2643221599 Rhizobium sp. Root708 Isolate Unclassified
37 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
38 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
39 2718217882 Rhizobium sp. N741 Isolate Nodule
40 2718217927 Rhizobium sp. N324 Isolate Nodule
41 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
42 2718218009 Rhizobium sp. N561 Isolate Nodule
43 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
44 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
45 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
46 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
47 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
48 2718218363 Rhizobium sp. N113 Isolate Nodule
49 2718218365 Rhizobium sp. N731 Isolate Nodule
50 2718218366 Rhizobium sp. N621 Isolate Nodule
51 2718218423 Rhizobium sp. N941 Isolate Nodule
52 2721755514 Rhizobium sp. N6212 Isolate Nodule
53 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
54 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
55 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
56 2721755809 Rhizobium sp. N541 Isolate Nodule
57 2721755810 Rhizobium sp. N871 Isolate Nodule
58 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
59 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
60 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
61 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
62 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
63 2728369365 Rhizobium sp. N1341 Isolate Nodule
64 2728369397 Rhizobium sp. N1314 Isolate Nodule
65 2738541293 Rhizobium sp. GV031 Isolate Unclassified
66 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
67 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
68 2791355256 Rhizobium sp. M10 Isolate Nodule
69 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
70 2791355260 Rhizobium sp. L9 Isolate Nodule
71 2791355261 Rhizobium sp. J15 Isolate Nodule
72 2791355262 Rhizobium sp. M1 Isolate Nodule
73 2791355263 Rhizobium chutanense C5 Isolate Nodule
74 2791355265 Rhizobium sp. H4 Isolate Nodule
75 2791355266 Rhizobium sp. L43 Isolate Nodule
76 2791355267 Rhizobium sp. L18 Isolate Nodule
77 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
78 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
79 2802429633 Rhizobium anhuiense J3 Isolate Nodule
80 2802429634 Rhizobium anhuiense S10 Isolate Nodule
81 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
82 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
83 2802429637 Rhizobium anhuiense C15 Isolate Nodule
84 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
85 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
86 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
87 2838048938 Rhizobium pisi 27/80 Isolate Nodule
88 2838061910 Rhizobium phaseoli L15 Isolate Nodule
89 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
90 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
91 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
92 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
93 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
94 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
95 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
96 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
97 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
98 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
99 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
100 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
101 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
102 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
103 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
104 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
105 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
106 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
107 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
108 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
109 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
110 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
111 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
112 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
113 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
114 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
115 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
116 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
117 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
118 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
119 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
120 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
121 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
122 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
123 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
124 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
125 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
126 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
127 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
128 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
129 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
130 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
131 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
132 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
133 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
134 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
135 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
136 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
137 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
138 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
139 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
140 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
141 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
142 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
143 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
144 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
145 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
146 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
147 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
148 2933599457 Rhizobium phaseoli M3 Isolate Nodule
149 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
150 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
151 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
152 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
153 2996887358 Rhizobium sp. R711 Isolate Nodule
154 2996893221 Rhizobium sp. R635 Isolate Nodule
155 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
156 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
157 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
158 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
159 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
160 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
161 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
162 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
163 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
164 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
165 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
166 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
167 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
168 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
169 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
174 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
175 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
176 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
177 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
178 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
179 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
182 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
185 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
204 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
205 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
206 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
207 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
287 8005258706 Rhizobium sp. R693 Isolate Nodule
288 8005275841 Rhizobium sp. N4311 Isolate Nodule
289 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
290 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
291 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
292 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
293 8005321885 Rhizobium sp. R72 Isolate Nodule
294 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
295 8005382845 Rhizobium sp. R634 Isolate Nodule
296 8005395548 Rhizobium sp. R339 Isolate Nodule
297 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
298 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
299 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
300 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
301 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
302 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
303 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
304 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
305 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
306 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
307 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
308 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
309 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
310 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
311 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
312 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
313 8024501048 Rhizobium sp. H4 Isolate Nodule
314 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
315 8056382006 Rhizobium croatiense 13T Isolate Nodule
316 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.32
Metatranscriptomes 1.49
Isolates 53.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.29
Nodule 45.18
Rhizoplane 1.9
Rhizosphere 15.47
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000020 3300002739 Bacteria 40034
2 JGI25158J39367_1000059 3300002739 Bacteria 24502
3 JGI25158J39367_1000088 3300002739 Bacteria 21274
4 JGI25158J39367_1001004 3300002739 Bacteria 5171
5 JGI25152J39213_1000001 3300002773 Bacteria 224104
6 JGI25152J39213_1000015 3300002773 Bacteria 120605
7 JGI25152J39213_1000302 3300002773 Bacteria 31894
8 JGI25152J39213_1000386 3300002773 Bacteria 26927
9 JGI25152J39213_1000656 3300002773 Bacteria 18117
10 JGI25152J39213_1002065 3300002773 Bacteria 7905
11 JGI25152J39213_1008892 3300002773 Bacteria 2443
12 JGI25152J39213_1011454 3300002773 Bacteria 1960
13 JGI25150J39212_1000007 3300002774 Bacteria 253635
14 JGI25150J39212_1000010 3300002774 Bacteria 236260
15 JGI25150J39212_1000024 3300002774 Bacteria 129646
16 JGI25150J39212_1000031 3300002774 Bacteria 100456
17 JGI25159J45721_1000504 3300002987 Bacteria 17816
18 JGI25159J45721_1000852 3300002987 Bacteria 13301
19 JGI25159J45721_1000909 3300002987 Bacteria 12860
20 JGI25159J45721_1007364 3300002987 Bacteria 3163
21 Ga0006778J45830_1021670 3300003162 Bacteria 1168
22 Ga0006759J45824_1057086 3300003163 Bacteria 1168
23 JGI25151J46595_10000013 3300003187 Bacteria 253635
24 JGI25151J46595_10000026 3300003187 Bacteria 211045
25 JGI25151J46595_10000027 3300003187 Bacteria 208739
26 JGI25151J46595_10000062 3300003187 Bacteria 146687
27 JGI25151J46595_10005729 3300003187 Bacteria 6370
28 JGI25153J46596_10000314 3300003215 Bacteria 35749
29 JGI25153J46596_10001838 3300003215 Bacteria 12594
30 JGI25153J46596_10005339 3300003215 Bacteria 6751
31 JGI25153J46596_10005698 3300003215 Bacteria 6494
32 JGI25153J46596_10005759 3300003215 Bacteria 6455
33 Ga0006758J48902_1005534 3300003300 Bacteria 1185
34 JGI25160J50197_1004086 3300003354 Bacteria 6355
35 JGI25160J50197_1018656 3300003354 Bacteria 2153
36 JGI25161J50226_1000050 3300003374 Bacteria 110628
37 JGI25161J50226_1000123 3300003374 Bacteria 56542
38 JGI25161J50226_1000133 3300003374 Bacteria 52508
39 JGI25161J50226_1000414 3300003374 Bacteria 20639
40 Ga0006562J51391_1001846 3300003578 Bacteria 1455
41 Ga0032354_1013707 3300003693 Bacteria 1171
42 Ga0055526_1001540 3300003771 Bacteria 16308
43 Ga0055526_1002823 3300003771 Bacteria 11492
44 Ga0055526_1004479 3300003771 Bacteria 8375
45 Ga0055526_1012450 3300003771 Bacteria 3707
46 Ga0055526_1015046 3300003771 Bacteria 3132
47 Ga0055526_1017752 3300003771 Bacteria 2698
48 Ga0055526_1018234 3300003771 Bacteria 2630
49 Ga0055524_1007348 3300003775 Bacteria 4689
50 Ga0055524_1010315 3300003775 Bacteria 3730
51 Ga0055524_1013827 3300003775 Bacteria 3021
52 Ga0055524_1014863 3300003775 Bacteria 2864
53 Ga0055524_1017897 3300003775 Bacteria 2482
54 Ga0055528_1001073 3300003790 Bacteria 18018
55 Ga0055528_1009860 3300003790 Bacteria 3948
56 Ga0055528_1016790 3300003790 Bacteria 2567
57 Ga0055540_1000453 3300003792 Bacteria 31964
58 Ga0055540_1006779 3300003792 Bacteria 4473
59 Ga0055540_1013250 3300003792 Bacteria 2532
60 Ga0055540_1024321 3300003792 Bacteria 1505
61 Ga0055543_1000023 3300004625 Bacteria 140513
62 Ga0055543_1000048 3300004625 Bacteria 109807
63 Ga0055543_1000116 3300004625 Bacteria 67872
64 Ga0055543_1000219 3300004625 Bacteria 45978
65 Ga0065165_1012372 3300005262 Bacteria 3480
66 Ga0070682_100154604 3300005337 Bacteria 1578
67 Ga0070682_100178822 3300005337 Bacteria 1480
68 Ga0075362_10052322 3300006177 Bacteria 1830
69 Ga0075370_10067930 3300006353 Unclassified 2035
70 Ga0105251_10056933 3300009011 Bacteria 1849
71 Ga0105248_10541938 3300009177 Bacteria 1313
72 Ga0123341_1000037 3300009765 Bacteria 60834
73 Ga0123341_1000048 3300009765 Bacteria 50946
74 Ga0123341_1000059 3300009765 Bacteria 46893
75 Ga0123342_1000455 3300009766 Bacteria 64500
76 Ga0123342_1005187 3300009766 Bacteria 19185
77 Ga0123342_1012803 3300009766 Bacteria 8616
78 Ga0123342_1021801 3300009766 Bacteria 4444
79 Ga0105246_10330809 3300011119 Bacteria 1242
80 Ga0157325_1000754 3300012485 Bacteria 1344
81 Ga0209436_100020 3300025208 Bacteria 104602
82 Ga0209436_100031 3300025208 Bacteria 82827
83 Ga0209436_100064 3300025208 Bacteria 56015
84 Ga0209436_100066 3300025208 Bacteria 54510
85 Ga0207425_1000010 3300025245 Bacteria 572898
86 Ga0207425_1000031 3300025245 Bacteria 261181
87 Ga0207425_1000032 3300025245 Bacteria 253689
88 Ga0207425_1000043 3300025245 Bacteria 208791
89 Ga0207425_1002955 3300025245 Bacteria 5687
90 Ga0207425_1025014 3300025245 Bacteria 1235
91 Ga0209129_1000053 3300025258 Bacteria 262823
92 Ga0209129_1000056 3300025258 Bacteria 253689
93 Ga0209129_1000069 3300025258 Bacteria 212790
94 Ga0209129_1000072 3300025258 Bacteria 208805
95 Ga0209129_1000099 3300025258 Bacteria 162471
96 Ga0209129_1000621 3300025258 Bacteria 23820
97 Ga0209129_1001497 3300025258 Bacteria 12990
98 Ga0209129_1002707 3300025258 Bacteria 8312
99 Ga0209129_1003512 3300025258 Bacteria 6773
100 Ga0209129_1004442 3300025258 Bacteria 5466
101 Ga0209129_1007279 3300025258 Bacteria 3336
102 Ga0209129_1009522 3300025258 Bacteria 2545
103 Ga0209673_1000060 3300025273 Bacteria 263602
104 Ga0209673_1000285 3300025273 Bacteria 94731
105 Ga0209673_1000317 3300025273 Bacteria 88898
106 Ga0209673_1000649 3300025273 Bacteria 51399
107 Ga0209673_1001100 3300025273 Bacteria 30309
108 Ga0209673_1003212 3300025273 Bacteria 9895
109 Ga0209673_1003220 3300025273 Bacteria 9881
110 Ga0209673_1005122 3300025273 Bacteria 6714
111 Ga0209673_1005745 3300025273 Bacteria 6179
112 Ga0209673_1005815 3300025273 Bacteria 6114
113 Ga0209673_1008506 3300025273 Bacteria 4559
114 Ga0209673_1013936 3300025273 Bacteria 3142
115 Ga0209673_1014725 3300025273 Bacteria 3015
116 Ga0209673_1019520 3300025273 Bacteria 2430
117 Ga0209130_1000004 3300025284 Bacteria 633436
118 Ga0209130_1000006 3300025284 Bacteria 596528
119 Ga0209130_1000022 3300025284 Bacteria 361244
120 Ga0209130_1000031 3300025284 Bacteria 322932
121 Ga0209025_1000022 3300025294 Bacteria 574487
122 Ga0209025_1000087 3300025294 Bacteria 261181
123 Ga0209025_1000090 3300025294 Bacteria 253689
124 Ga0209025_1000120 3300025294 Bacteria 208791
125 Ga0209025_1001567 3300025294 Bacteria 28985
126 Ga0209025_1008482 3300025294 Bacteria 7391
127 Ga0209025_1019927 3300025294 Bacteria 3700
128 Ga0209025_1039490 3300025294 Bacteria 2057
129 Ga0209564_1000116 3300025295 Bacteria 207889
130 Ga0209564_1000362 3300025295 Bacteria 84376
131 Ga0209564_1000399 3300025295 Bacteria 77444
132 Ga0209564_1000586 3300025295 Bacteria 57490
133 Ga0209564_1001142 3300025295 Bacteria 31132
134 Ga0209564_1001217 3300025295 Bacteria 29183
135 Ga0209564_1003779 3300025295 Bacteria 9853
136 Ga0209564_1023598 3300025295 Bacteria 2130
137 Ga0209564_1026496 3300025295 Bacteria 1912
138 Ga0209758_1000081 3300025297 Bacteria 261181
139 Ga0209758_1000084 3300025297 Bacteria 256346
140 Ga0209758_1000086 3300025297 Bacteria 254778
141 Ga0209758_1000111 3300025297 Bacteria 208790
142 Ga0209758_1000540 3300025297 Bacteria 60103
143 Ga0209758_1000564 3300025297 Bacteria 58328
144 Ga0209758_1004285 3300025297 Bacteria 12034
145 Ga0209758_1006944 3300025297 Bacteria 7892
146 Ga0209758_1012676 3300025297 Bacteria 4687
147 Ga0209758_1013859 3300025297 Bacteria 4348
148 Ga0209758_1014650 3300025297 Bacteria 4149
149 Ga0209256_1001699 3300025299 Bacteria 21240
150 Ga0209256_1002737 3300025299 Bacteria 13632
151 Ga0209256_1003087 3300025299 Bacteria 12224
152 Ga0209256_1003709 3300025299 Bacteria 10370
153 Ga0209256_1005668 3300025299 Bacteria 7031
154 Ga0209256_1006317 3300025299 Bacteria 6338
155 Ga0209256_1010144 3300025299 Bacteria 3997
156 Ga0209256_1010196 3300025299 Bacteria 3976
157 Ga0209256_1017253 3300025299 Bacteria 2409
158 Ga0207426_1000003 3300025302 Bacteria 1063212
159 Ga0207426_1000005 3300025302 Bacteria 1037188
160 Ga0207426_1000042 3300025302 Bacteria 433289
161 Ga0207426_1000106 3300025302 Bacteria 244368
162 Ga0207426_1000283 3300025302 Bacteria 103487
163 Ga0207426_1000447 3300025302 Bacteria 66140
164 Ga0207426_1005487 3300025302 Bacteria 5773
165 Ga0209051_1000202 3300025303 Bacteria 106010
166 Ga0209051_1000371 3300025303 Bacteria 64402
167 Ga0209051_1004341 3300025303 Bacteria 8795
168 Ga0209051_1006142 3300025303 Bacteria 6824
169 Ga0209051_1009762 3300025303 Bacteria 4916
170 Ga0209051_1024882 3300025303 Bacteria 2451
171 Ga0209257_1005871 3300025304 Bacteria 8295
172 Ga0209257_1015876 3300025304 Bacteria 3091
173 Ga0207678_10047376 3300026067 Bacteria 3717
174 Ga0307513_10004545 3300031456 Bacteria 18512
175 Ga0307405_10000681 3300031731 Bacteria 13156
176 Ga0307405_10000891 3300031731 Bacteria 11843
177 Ga0307412_10000824 3300031911 Bacteria 17889
178 Ga0307412_10004226 3300031911 Bacteria 8007
179 Ga0439465_0012653 3300041413 Bacteria 2639
180 Ga0439465_0032250 3300041413 Bacteria 1672
181 Ga0451833_0979623 3300041491 Bacteria 2216
182 Ga0451835_0354976 3300041492 Bacteria 1452
183 Ga0451839_0349739 3300041496 Bacteria 1202
184 Ga0451847_0113323 3300041503 Bacteria 2185
185 Ga0451851_0614241 3300041507 Bacteria 3252
186 Ga0452268_40479 3300041907 Bacteria 1785
187 Ga0495638_0000353 3300046460 Bacteria 57451
188 Ga0495638_0001134 3300046460 Bacteria 25773
189 Ga0495638_0139488 3300046460 Bacteria 1416
190 Ga0495605_0003774 3300046474 Bacteria 8989
191 Ga0495585_0007465 3300046492 Bacteria 6687
192 Ga0495583_0001269 3300046506 Bacteria 26443
193 Ga0495606_0111401 3300046507 Bacteria 1650
194 Ga0495610_0005470 3300046512 Bacteria 9019
195 Ga0495610_0012107 3300046512 Bacteria 5215
196 Ga0495610_0015370 3300046512 Bacteria 4452
197 Ga0495620_0031550 3300046515 Bacteria 2427
198 Ga0495620_0065125 3300046515 Bacteria 1505
199 Ga0495631_0001310 3300046518 Bacteria 15251
200 Ga0495631_0003060 3300046518 Bacteria 9237
201 Ga0495631_0042865 3300046518 Bacteria 1998
202 Ga0495632_0004987 3300046519 Bacteria 8895
203 Ga0495632_0006839 3300046519 Bacteria 7276
204 Ga0495643_0031365 3300046522 Bacteria 2957
205 Ga0495648_0185637 3300046524 Bacteria 1053
206 Ga0495609_0058361 3300046538 Bacteria 1707
207 Ga0495597_0025813 3300046542 Bacteria 2703
208 Ga0495668_0003677 3300046616 Bacteria 11331
209 Ga0495611_0004410 3300046648 Bacteria 6091
210 Ga0495625_0002820 3300046660 Bacteria 18292
211 Ga0495625_0025672 3300046660 Bacteria 4465
212 Ga0495625_0065123 3300046660 Bacteria 2569
213 Ga0495625_0099598 3300046660 Bacteria 1998
214 Ga0495670_0008835 3300046691 Bacteria 4957
215 Ga0495670_0020237 3300046691 Bacteria 3280
216 Ga0495671_0067202 3300046692 Bacteria 1763
217 Ga0495660_0027516 3300046810 Bacteria 3217
218 Ga0495672_0018588 3300047320 Bacteria 4609
219 Ga0495687_051299 3300047443 Bacteria 1751
220 Ga0495687_066560 3300047443 Bacteria 1462
221 Ga0495685_046363 3300047447 Bacteria 1479
222 Ga0495673_0052967 3300047469 Bacteria 1772
223 Ga0495686_0019595 3300047472 Bacteria 4520
224 Ga0495615_0026076 3300048090 Bacteria 1362
225 Ga0495626_0057778 3300048091 Bacteria 1775
226 Ga0496101_0072200 3300048904 Bacteria 2533
227 Ga0496102_0078996 3300048905 Bacteria 3029
228 Ga0496102_0215961 3300048905 Bacteria 1808
229 Ga0496104_0010996 3300048907 Bacteria 8098
230 Ga0496104_0018074 3300048907 Bacteria 6428
231 Ga0496105_0011321 3300048908 Bacteria 7044
232 Ga0496105_0060976 3300048908 Bacteria 3113
233 Ga0496106_0000050 3300048909 Bacteria 96126
234 Ga0496106_0000288 3300048909 Bacteria 35636
235 Ga0496106_0000825 3300048909 Bacteria 22458
236 Ga0496107_0151999 3300048910 Bacteria 1713
237 Ga0496111_0050338 3300048914 Bacteria 3005
238 Ga0496113_0236639 3300048916 Bacteria 1457
239 Ga0496114_0298047 3300048917 Bacteria 1423
240 Ga0496116_0001100 3300048919 Bacteria 32458
241 Ga0496116_0001788 3300048919 Bacteria 23378
242 Ga0496116_0002110 3300048919 Bacteria 21206
243 Ga0496116_0008219 3300048919 Bacteria 9095
244 Ga0496116_0010086 3300048919 Bacteria 7965
245 Ga0496116_0012902 3300048919 Bacteria 6783
246 Ga0496116_0040962 3300048919 Bacteria 3183
247 Ga0496117_0003689 3300048920 Bacteria 17580
248 Ga0496117_0014680 3300048920 Bacteria 6730
249 Ga0496117_0062952 3300048920 Bacteria 2538
250 Ga0496117_0123443 3300048920 Bacteria 1586
251 Ga0496118_0016976 3300048921 Bacteria 6648
252 Ga0496118_0030382 3300048921 Bacteria 4510
253 Ga0496118_0032840 3300048921 Bacteria 4267
254 Ga0496118_0050979 3300048921 Bacteria 3170
255 Ga0496118_0053540 3300048921 Bacteria 3066
256 Ga0496119_0043277 3300048922 Bacteria 2847
257 Ga0496120_0119588 3300048923 Bacteria 1364
258 Ga0496121_0017825 3300048924 Bacteria 7212
259 Ga0496121_0067597 3300048924 Bacteria 2895
260 Ga0496121_0094386 3300048924 Unclassified 2327
261 Ga0496121_0140635 3300048924 Bacteria 1791
262 Ga0496121_0176342 3300048924 Bacteria 1547
263 Ga0496121_0187741 3300048924 Bacteria 1485
264 Ga0496122_0008679 3300048925 Bacteria 10895
265 Ga0496122_0014461 3300048925 Bacteria 7628
266 Ga0496122_0049954 3300048925 Bacteria 3194
267 Ga0496122_0060405 3300048925 Bacteria 2791
268 Ga0496122_0089231 3300048925 Bacteria 2109
269 Ga0496123_0014859 3300048926 Bacteria 6424
270 Ga0496123_0025560 3300048926 Bacteria 4448
271 Ga0496123_0060677 3300048926 Unclassified 2436
272 Ga0496123_0075764 3300048926 Bacteria 2074
273 Ga0496123_0078248 3300048926 Bacteria 2027
274 Ga0496123_0151983 3300048926 Bacteria 1247
275 Ga0496123_0157484 3300048926 Bacteria 1215
276 Ga0496124_0000754 3300048927 Bacteria 53087
277 Ga0496124_0009269 3300048927 Bacteria 10152
278 Ga0496124_0010940 3300048927 Bacteria 9126
279 Ga0496124_0023658 3300048927 Bacteria 5604
280 Ga0496124_0045540 3300048927 Bacteria 3760
281 Ga0496124_0046208 3300048927 Bacteria 3729
282 Ga0496124_0058703 3300048927 Bacteria 3234
283 Ga0496124_0066733 3300048927 Bacteria 2995
284 Ga0496125_0003934 3300048928 Bacteria 17522
285 Ga0496125_0008039 3300048928 Bacteria 11135
286 Ga0496125_0033114 3300048928 Bacteria 4579
287 Ga0496125_0033182 3300048928 Bacteria 4573
288 Ga0496125_0044769 3300048928 Bacteria 3735
289 Ga0496125_0060385 3300048928 Bacteria 3047
290 Ga0496126_0035189 3300048929 Bacteria 4696
291 Ga0496126_0044904 3300048929 Bacteria 4066
292 Ga0496126_0076010 3300048929 Bacteria 2980
293 Ga0496126_0136739 3300048929 Bacteria 2113
294 Ga0495678_007721 3300049459 Bacteria 5543
295 Ga0501031_0119735 3300049568 Bacteria 1720
296 Ga0501032_0089192 3300049569 Bacteria 2047
297 Ga0501034_0090559 3300049571 Bacteria 3056
298 Ga0501034_0235749 3300049571 Bacteria 1777
299 Ga0501034_0327223 3300049571 Bacteria 1464
300 Ga0501036_0046861 3300049572 Bacteria 3661
301 Ga0501036_0053359 3300049572 Bacteria 3424
302 Ga0501038_0050302 3300049574 Bacteria 3601
303 Ga0501038_0102587 3300049574 Bacteria 2380
304 Ga0501038_0231149 3300049574 Bacteria 1472
305 Ga0501039_0063136 3300049575 Bacteria 2870
306 Ga0501043_0215300 3300049579 Bacteria 1488
307 Ga0501047_0154547 3300049581 Bacteria 2168
308 Ga0501068_0106604 3300049584 Bacteria 1740
309 Ga0501068_0145634 3300049584 Bacteria 1487
310 Ga0501073_0220501 3300049589 Bacteria 1310
311 Ga0501080_0119746 3300049742 Bacteria 2440
312 Ga0501035_0294008 3300049822 Bacteria 1370
313 Ga0501044_0031367 3300049823 Bacteria 5594
314 Ga0501044_0038262 3300049823 Bacteria 5010
315 nmdc:mga07m45_120265_c1 3300050496 Bacteria 1516
316 nmdc:mga07m45_65365_c1 3300050496 Bacteria 2065
317 Ga0500610_0002510 3300053079 Bacteria 6798
318 Ga0500610_0012357 3300053079 Bacteria 3931
319 Ga0500578_0015228 3300053086 Bacteria 4942
320 Ga0500578_0048383 3300053086 Bacteria 2728
321 Ga0500557_014620 3300053105 Bacteria 2099
322 Ga0500594_0001230 3300053118 Bacteria 5534
323 Ga0500594_0005720 3300053118 Bacteria 2765
324 Ga0500618_004298 3300053125 Bacteria 4602
325 Ga0500652_096180 3300053131 Bacteria 1237
326 Ga0500658_0000868 3300053134 Bacteria 12408
327 Ga0500658_0003930 3300053134 Bacteria 5583
328 Ga0500658_0009779 3300053134 Bacteria 3535
329 Ga0500568_0001135 3300053139 Bacteria 17879
330 Ga0500568_0002000 3300053139 Bacteria 12420
331 Ga0500568_0002776 3300053139 Bacteria 10130
332 Ga0500616_0001260 3300053153 Bacteria 25329
333 Ga0500616_0004285 3300053153 Bacteria 10246
334 Ga0500616_0006858 3300053153 Bacteria 7355
335 Ga0500622_0000275 3300053156 Bacteria 52724
336 Ga0500622_0000322 3300053156 Bacteria 48225
337 Ga0500622_0013812 3300053156 Bacteria 4351
338 Ga0500633_0000482 3300053160 Bacteria 6351
339 Ga0500636_0001737 3300053177 Bacteria 11931
340 Ga0587093_004112 3300059478 Bacteria 1466
341 Ga0587070_013218 3300059491 Bacteria 1269
342 Ga0587085_006212 3300059506 Bacteria 1443
343 Ga0587088_003020 3300059508 Bacteria 1990
344 Ga0587060_003628 3300060243 Bacteria 1140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0327223 Ga0501034_0327223_622_1443 266
2 3300048929 Ga0496126_0035189 Ga0496126_0035189_23_910 290
3 3300003790 Ga0055528_1016790 Ga0055528_10167902 291
4 3300049568 Ga0501031_0119735 Ga0501031_0119735_246_1256 298
5 3300049569 Ga0501032_0089192 Ga0501032_0089192_293_1303 298
6 3300049571 Ga0501034_0090559 Ga0501034_0090559_579_1589 298
7 3300049572 Ga0501036_0053359 Ga0501036_0053359_643_1653 298
8 3300049574 Ga0501038_0050302 Ga0501038_0050302_339_1349 298
9 3300049581 Ga0501047_0154547 Ga0501047_0154547_960_1970 298
10 3300049584 Ga0501068_0145634 Ga0501068_0145634_204_1214 298
11 3300049742 Ga0501080_0119746 Ga0501080_0119746_1097_2107 298
12 3300049822 Ga0501035_0294008 Ga0501035_0294008_110_1120 298
13 3300049823 Ga0501044_0031367 Ga0501044_0031367_2261_3271 298
14 3300049571 Ga0501034_0235749 Ga0501034_0235749_14_1018 299
15 3300049572 Ga0501036_0046861 Ga0501036_0046861_1103_2107 299
16 3300049574 Ga0501038_0102587 Ga0501038_0102587_233_1237 299
17 3300049579 Ga0501043_0215300 Ga0501043_0215300_263_1267 299
18 3300049823 Ga0501044_0038262 Ga0501044_0038262_1717_2721 299
19 iso_pu_bacteria 2510917030 2511200244 310
20 3300003354 JGI25160J50197_1018656 JGI25160J50197_10186562 311
21 3300060243 Ga0587060_003628 Ga0587060_003628_97_1113 311
22 3300025303 Ga0209051_1000202 Ga0209051_1000202143 315
23 3300048905 Ga0496102_0078996 Ga0496102_0078996_915_2099 315
24 3300048907 Ga0496104_0010996 Ga0496104_0010996_1517_2701 315
25 3300048908 Ga0496105_0060976 Ga0496105_0060976_595_1779 315
26 3300048919 Ga0496116_0040962 Ga0496116_0040962_1362_2546 315
27 3300048922 Ga0496119_0043277 Ga0496119_0043277_1413_2597 315
28 3300048923 Ga0496120_0119588 Ga0496120_0119588_24_1208 315
29 3300048924 Ga0496121_0187741 Ga0496121_0187741_244_1428 315
30 3300048925 Ga0496122_0049954 Ga0496122_0049954_582_1766 315
31 3300048927 Ga0496124_0066733 Ga0496124_0066733_1317_2501 315
32 3300048928 Ga0496125_0060385 Ga0496125_0060385_1262_2446 315
33 3300048929 Ga0496126_0044904 Ga0496126_0044904_1152_2336 315
34 3300050496 nmdc:mga07m45_120265_c1 nmdc:mga07m45_120265_c1_195_1379 315
35 3300048919 Ga0496116_0001788 Ga0496116_0001788_3846_4841 316
36 3300048921 Ga0496118_0016976 Ga0496118_0016976_2408_3403 316
37 3300048926 Ga0496123_0151983 Ga0496123_0151983_87_1082 316
38 3300048927 Ga0496124_0058703 Ga0496124_0058703_1470_2465 316
39 3300048928 Ga0496125_0033182 Ga0496125_0033182_87_1082 316
40 3300025302 Ga0207426_1000283 Ga0207426_100028358 318
41 3300049584 Ga0501068_0106604 Ga0501068_0106604_747_1727 319
42 iso_pu_bacteria 2513237144 2513912452 319
43 3300002773 JGI25152J39213_1000656 JGI25152J39213_10006563 320
44 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002483 320
45 3300003187 JGI25151J46595_10000027 JGI25151J46595_10000027148 320
46 3300003215 JGI25153J46596_10000314 JGI25153J46596_100003149 320
47 3300025245 Ga0207425_1000043 Ga0207425_1000043146 320
48 3300025258 Ga0209129_1000072 Ga0209129_100007248 320
49 3300025294 Ga0209025_1000120 Ga0209025_100012048 320
50 3300025297 Ga0209758_1000111 Ga0209758_100011148 320
51 3300031731 Ga0307405_10000681 Ga0307405_100006815 320
52 3300002773 JGI25152J39213_1011454 JGI25152J39213_10114542 321
53 3300025294 Ga0209025_1008482 Ga0209025_10084821 321
54 3300025297 Ga0209758_1014650 Ga0209758_10146502 321
55 3300046519 Ga0495632_0004987 Ga0495632_0004987_7093_8112 321
56 3300009765 Ga0123341_1000037 Ga0123341_100003760 323
57 3300009766 Ga0123342_1005187 Ga0123342_100518711 323
58 3300025295 Ga0209564_1026496 Ga0209564_10264961 323
59 3300031456 Ga0307513_10004545 Ga0307513_1000454518 323
60 3300048921 Ga0496118_0030382 Ga0496118_0030382_1216_2244 323
61 3300049589 Ga0501073_0220501 Ga0501073_0220501_229_1278 323
62 3300006177 Ga0075362_10052322 Ga0075362_100523222 324
63 3300002773 JGI25152J39213_1002065 JGI25152J39213_10020652 325
64 3300003187 JGI25151J46595_10005729 JGI25151J46595_100057294 325
65 3300003771 Ga0055526_1001540 Ga0055526_100154013 325
66 3300025245 Ga0207425_1025014 Ga0207425_10250141 325
67 3300025258 Ga0209129_1000069 Ga0209129_100006991 325
68 3300025258 Ga0209129_1009522 Ga0209129_10095222 325
69 3300025273 Ga0209673_1000317 Ga0209673_100031784 325
70 3300025273 Ga0209673_1005745 Ga0209673_10057454 325
71 3300025294 Ga0209025_1001567 Ga0209025_10015677 325
72 3300025295 Ga0209564_1000362 Ga0209564_100036286 325
73 3300025299 Ga0209256_1006317 Ga0209256_10063174 325
74 3300046460 Ga0495638_0139488 Ga0495638_0139488_164_1216 325
75 3300046512 Ga0495610_0012107 Ga0495610_0012107_661_1713 325
76 3300046660 Ga0495625_0065123 Ga0495625_0065123_558_1610 325
77 3300053086 Ga0500578_0015228 Ga0500578_0015228_1964_3016 325
78 3300053134 Ga0500658_0003930 Ga0500658_0003930_2605_3657 325
79 3300009765 Ga0123341_1000048 Ga0123341_100004842 326
80 3300009766 Ga0123342_1021801 Ga0123342_10218014 326
81 3300046492 Ga0495585_0007465 Ga0495585_0007465_1702_2733 326
82 3300046506 Ga0495583_0001269 Ga0495583_0001269_16999_18030 326
83 3300046660 Ga0495625_0099598 Ga0495625_0099598_828_1889 326
84 3300047469 Ga0495673_0052967 Ga0495673_0052967_504_1535 326
85 iso_pu_bacteria 2643221599 2644007862 326
86 iso_pu_bacteria 2643221643 2644242436 326
87 3300048916 Ga0496113_0236639 Ga0496113_0236639_442_1440 327
88 3300048920 Ga0496117_0123443 Ga0496117_0123443_219_1262 327
89 3300048921 Ga0496118_0032840 Ga0496118_0032840_2311_3354 327
90 3300048928 Ga0496125_0033114 Ga0496125_0033114_2939_3976 327
91 iso_pu_bacteria 2582581299 2585231556 327
92 iso_pu_bacteria 2585427594 2585847278 327
93 3300002739 JGI25158J39367_1000088 JGI25158J39367_100008819 328
94 3300002987 JGI25159J45721_1000909 JGI25159J45721_100090913 328
95 3300003374 JGI25161J50226_1000414 JGI25161J50226_10004145 328
96 3300004625 Ga0055543_1000219 Ga0055543_100021952 328
97 3300009766 Ga0123342_1000455 Ga0123342_10004555 328
98 3300025208 Ga0209436_100020 Ga0209436_10002088 328
99 3300025273 Ga0209673_1019520 Ga0209673_10195201 328
100 3300025284 Ga0209130_1000004 Ga0209130_1000004333 328
101 3300025297 Ga0209758_1000540 Ga0209758_100054053 328
102 3300025297 Ga0209758_1013859 Ga0209758_10138593 328
103 3300025302 Ga0207426_1000003 Ga0207426_1000003394 328
104 3300025303 Ga0209051_1009762 Ga0209051_10097625 328
105 3300025303 Ga0209051_1024882 Ga0209051_10248821 328
106 3300041907 Ga0452268_40479 Ga0452268_40479_69_1133 328
107 3300046515 Ga0495620_0031550 Ga0495620_0031550_38_1060 328
108 3300046518 Ga0495631_0042865 Ga0495631_0042865_610_1674 328
109 3300047447 Ga0495685_046363 Ga0495685_046363_231_1295 328
110 3300047472 Ga0495686_0019595 Ga0495686_0019595_1957_3021 328
111 3300048091 Ga0495626_0057778 Ga0495626_0057778_455_1492 328
112 3300053134 Ga0500658_0009779 Ga0500658_0009779_515_1579 328
113 3300053156 Ga0500622_0000275 Ga0500622_0000275_2481_3518 328
114 3300059491 Ga0587070_013218 Ga0587070_013218_97_1134 328
115 iso_pu_bacteria 2923556063 2923557633 328
116 3300003792 Ga0055540_1013250 Ga0055540_10132501 329
117 3300012485 Ga0157325_1000754 Ga0157325_10007541 329
118 3300025245 Ga0207425_1002955 Ga0207425_10029553 329
119 3300025258 Ga0209129_1004442 Ga0209129_10044422 329
120 3300025294 Ga0209025_1019927 Ga0209025_10199274 329
121 3300025297 Ga0209758_1006944 Ga0209758_10069445 329
122 3300041413 Ga0439465_0012653 Ga0439465_0012653_735_1805 329
123 3300046460 Ga0495638_0000353 Ga0495638_0000353_47973_48983 329
124 3300046474 Ga0495605_0003774 Ga0495605_0003774_3224_4234 329
125 3300046512 Ga0495610_0015370 Ga0495610_0015370_1792_2859 329
126 3300046518 Ga0495631_0001310 Ga0495631_0001310_7303_8313 329
127 3300046542 Ga0495597_0025813 Ga0495597_0025813_482_1546 329
128 3300046660 Ga0495625_0002820 Ga0495625_0002820_6259_7269 329
129 3300046692 Ga0495671_0067202 Ga0495671_0067202_585_1595 329
130 3300046810 Ga0495660_0027516 Ga0495660_0027516_596_1606 329
131 3300049459 Ga0495678_007721 Ga0495678_007721_3445_4455 329
132 3300053079 Ga0500610_0012357 Ga0500610_0012357_216_1226 329
133 3300053086 Ga0500578_0048383 Ga0500578_0048383_961_1971 329
134 3300053105 Ga0500557_014620 Ga0500557_014620_713_1723 329
135 3300053118 Ga0500594_0001230 Ga0500594_0001230_3438_4448 329
136 3300053131 Ga0500652_096180 Ga0500652_096180_215_1225 329
137 3300053153 Ga0500616_0006858 Ga0500616_0006858_1634_2698 329
138 3300053156 Ga0500622_0013812 Ga0500622_0013812_3117_4184 329
139 iso_pu_bacteria 2582581294 2585202120 329
140 iso_pu_bacteria 2643221634 2644196453 329
141 iso_pu_bacteria 3005452660 3005453382 329
142 3300002739 JGI25158J39367_1001004 JGI25158J39367_10010044 330
143 3300002773 JGI25152J39213_1000386 JGI25152J39213_100038631 330
144 3300002774 JGI25150J39212_1000031 JGI25150J39212_100003159 330
145 3300002987 JGI25159J45721_1007364 JGI25159J45721_10073641 330
146 3300003187 JGI25151J46595_10000062 JGI25151J46595_1000006265 330
147 3300003215 JGI25153J46596_10001838 JGI25153J46596_1000183810 330
148 3300003215 JGI25153J46596_10005759 JGI25153J46596_100057596 330
149 3300003374 JGI25161J50226_1000050 JGI25161J50226_100005067 330
150 3300003771 Ga0055526_1002823 Ga0055526_10028239 330
151 3300003775 Ga0055524_1013827 Ga0055524_10138272 330
152 3300003790 Ga0055528_1009860 Ga0055528_10098601 330
153 3300003792 Ga0055540_1024321 Ga0055540_10243211 330
154 3300004625 Ga0055543_1000023 Ga0055543_10000234 330
155 3300005337 Ga0070682_100154604 Ga0070682_1001546041 330
156 3300025208 Ga0209436_100031 Ga0209436_10003139 330
157 3300025245 Ga0207425_1000031 Ga0207425_1000031181 330
158 3300025258 Ga0209129_1000053 Ga0209129_1000053182 330
159 3300025258 Ga0209129_1007279 Ga0209129_10072793 330
160 3300025273 Ga0209673_1000285 Ga0209673_100028581 330
161 3300025273 Ga0209673_1003220 Ga0209673_10032206 330
162 3300025273 Ga0209673_1005815 Ga0209673_10058156 330
163 3300025284 Ga0209130_1000031 Ga0209130_100003134 330
164 3300025294 Ga0209025_1000087 Ga0209025_1000087181 330
165 3300025295 Ga0209564_1000586 Ga0209564_100058618 330
166 3300025297 Ga0209758_1000081 Ga0209758_1000081181 330
167 3300025297 Ga0209758_1012676 Ga0209758_10126763 330
168 3300025299 Ga0209256_1005668 Ga0209256_10056681 330
169 3300025302 Ga0207426_1000042 Ga0207426_1000042376 330
170 3300025303 Ga0209051_1006142 Ga0209051_10061425 330
171 3300046519 Ga0495632_0006839 Ga0495632_0006839_30_1061 330
172 3300048909 Ga0496106_0000288 Ga0496106_0000288_9010_10077 330
173 3300048919 Ga0496116_0002110 Ga0496116_0002110_5513_6547 330
174 3300048921 Ga0496118_0050979 Ga0496118_0050979_172_1206 330
175 3300048924 Ga0496121_0017825 Ga0496121_0017825_5391_6425 330
176 3300048926 Ga0496123_0014859 Ga0496123_0014859_100_1134 330
177 3300059478 Ga0587093_004112 Ga0587093_004112_293_1351 330
178 3300059506 Ga0587085_006212 Ga0587085_006212_280_1350 330
179 3300059508 Ga0587088_003020 Ga0587088_003020_101_1168 330
180 iso_pu_bacteria 2510917028 2511182799 330
181 iso_pu_bacteria 2582581304 2585256674 330
182 iso_pu_bacteria 2582581867 2585402815 330
183 iso_pu_bacteria 2585427590 2585823522 330
184 iso_pu_bacteria 2643221643 2644238014 330
185 iso_pu_bacteria 2738541293 2738802102 330
186 3300003162 Ga0006778J45830_1021670 Ga0006778J45830_10216701 331
187 3300003163 Ga0006759J45824_1057086 Ga0006759J45824_10570861 331
188 3300003300 Ga0006758J48902_1005534 Ga0006758J48902_10055341 331
189 3300003578 Ga0006562J51391_1001846 Ga0006562J51391_10018461 331
190 3300003693 Ga0032354_1013707 Ga0032354_10137071 331
191 3300031731 Ga0307405_10000891 Ga0307405_1000089110 331
192 3300048927 Ga0496124_0045540 Ga0496124_0045540_1724_2767 331
193 3300053177 Ga0500636_0001737 Ga0500636_0001737_8533_9642 331
194 iso_pu_bacteria 2509276021 2509387778 331
195 iso_pu_bacteria 2513237085 2513577401 331
196 iso_pu_bacteria 2513237085 2513580779 331
197 iso_pu_bacteria 2515154134 2515740403 331
198 iso_pu_bacteria 2516653085 2517075408 331
199 iso_pu_bacteria 2517093000 2517093997 331
200 iso_pu_bacteria 2529292951 2530645635 331
201 iso_pu_bacteria 2582581294 2585203017 331
202 iso_pu_bacteria 2585427526 2585527905 331
203 iso_pu_bacteria 2585427528 2585541491 331
204 iso_pu_bacteria 2585427593 2585839376 331
205 iso_pu_bacteria 2721755556 2723025996 331
206 iso_pu_bacteria 2721755556 2723027039 331
207 iso_pu_bacteria 2721755684 2723559540 331
208 iso_pu_bacteria 2721755684 2723560651 331
209 iso_pu_bacteria 2721755823 2724109266 331
210 iso_pu_bacteria 2728369352 2730106932 331
211 iso_pu_bacteria 2728369352 2730107975 331
212 iso_pu_bacteria 2738541333 2739035837 331
213 iso_pu_bacteria 2791355263 2793339863 331
214 iso_pu_bacteria 2791355266 2793358853 331
215 iso_pu_bacteria 2802429633 2806046984 331
216 iso_pu_bacteria 2802429634 2806052567 331
217 iso_pu_bacteria 2802429635 2806058662 331
218 iso_pu_bacteria 2802429636 2806067570 331
219 iso_pu_bacteria 2802429637 2806073921 331
220 iso_pu_bacteria 2838048938 2838049293 331
221 iso_pu_bacteria 2838061910 2838063261 331
222 iso_pu_bacteria 2838061910 2838065707 331
223 iso_pu_bacteria 2838686498 2838688676 331
224 iso_pu_bacteria 2838729681 2838730971 331
225 iso_pu_bacteria 2838742623 2838744135 331
226 iso_pu_bacteria 2841851746 2841856816 331
227 iso_pu_bacteria 2842156927 2842159986 331
228 iso_pu_bacteria 2842163707 2842168228 331
229 iso_pu_bacteria 2842180545 2842183397 331
230 iso_pu_bacteria 2842229732 2842235002 331
231 iso_pu_bacteria 2842243621 2842245599 331
232 iso_pu_bacteria 2842257432 2842259751 331
233 iso_pu_bacteria 2842271015 2842274590 331
234 iso_pu_bacteria 2842304105 2842306834 331
235 iso_pu_bacteria 2842311132 2842314514 331
236 iso_pu_bacteria 2842447887 2842450672 331
237 iso_pu_bacteria 2842447887 2842453430 331
238 iso_pu_bacteria 2844454524 2844455193 331
239 iso_pu_bacteria 2933570622 2933573052 331
240 iso_pu_bacteria 2935901341 2935904198 331
241 iso_pu_bacteria 2996887358 2996891516 331
242 iso_pu_bacteria 8005307578 8005309106 331
243 iso_pu_bacteria 8005321885 8005326043 331
244 iso_pu_bacteria 8005497431 8005500435 331
245 iso_pu_bacteria 8005556819 8005558984 331
246 iso_pu_bacteria 8005563573 8005570378 331
247 iso_pu_bacteria 8005570704 8005572622 331
248 iso_pu_bacteria 8005668836 8005670685 331
249 iso_pu_bacteria 8005668836 8005671853 331
250 iso_pu_bacteria 8018163183 8018169099 331
251 iso_pu_bacteria 8023680758 8023687018 331
252 3300009765 Ga0123341_1000059 Ga0123341_100005943 332
253 3300009766 Ga0123342_1012803 Ga0123342_10128037 332
254 3300046512 Ga0495610_0005470 Ga0495610_0005470_7904_8953 332
255 3300046691 Ga0495670_0020237 Ga0495670_0020237_1934_2965 332
256 3300049575 Ga0501039_0063136 Ga0501039_0063136_1290_2309 332
257 3300049823 Ga0501044_0038262 Ga0501044_0038262_3053_4072 332
258 3300053139 Ga0500568_0001135 Ga0500568_0001135_7958_8977 332
259 3300053153 Ga0500616_0004285 Ga0500616_0004285_8379_9398 332
260 iso_pu_bacteria 2509276021 2509392549 332
261 iso_pu_bacteria 2513237084 2513569078 332
262 iso_pu_bacteria 2513237138 2513865682 332
263 iso_pu_bacteria 2515154113 2515635988 332
264 iso_pu_bacteria 2517093000 2517095281 332
265 iso_pu_bacteria 2517287029 2517405811 332
266 iso_pu_bacteria 2517287029 2517406888 332
267 iso_pu_bacteria 2519899620 2520375310 332
268 iso_pu_bacteria 2519899620 2520375942 332
269 iso_pu_bacteria 2582581298 2585222399 332
270 iso_pu_bacteria 2585427528 2585537649 332
271 iso_pu_bacteria 2585427529 2585544649 332
272 iso_pu_bacteria 2585427593 2585835599 332
273 iso_pu_bacteria 2718217927 2719385892 332
274 iso_pu_bacteria 2718218423 2721399671 332
275 iso_pu_bacteria 2721755809 2724038484 332
276 iso_pu_bacteria 2738541333 2739036612 332
277 iso_pu_bacteria 2791355263 2793341628 332
278 iso_pu_bacteria 2802429633 2806046162 332
279 iso_pu_bacteria 2802429634 2806054542 332
280 iso_pu_bacteria 2802429635 2806060546 332
281 iso_pu_bacteria 2802429636 2806064996 332
282 iso_pu_bacteria 2802429637 2806072255 332
283 iso_pu_bacteria 2842395702 2842398790 332
284 iso_pu_bacteria 2842409023 2842409228 332
285 iso_pu_bacteria 2919100787 2919102972 332
286 iso_pu_bacteria 2996893221 2996894061 332
287 iso_pu_bacteria 2996893221 2996896580 332
288 iso_pu_bacteria 3005445848 3005447642 332
289 iso_pu_bacteria 3005445848 3005450890 332
290 iso_pu_bacteria 8005275841 8005280673 332
291 iso_pu_bacteria 8005382845 8005386064 332
292 iso_pu_bacteria 8005382845 8005388430 332
293 iso_pu_bacteria 8005430974 8005435914 332
294 iso_pu_bacteria 8005542996 8005544288 332
295 iso_pu_bacteria 8005570704 8005574347 332
296 iso_pu_bacteria 8005695170 8005699903 332
297 3300041491 Ga0451833_0979623 Ga0451833_0979623_1107_2147 333
298 3300041496 Ga0451839_0349739 Ga0451839_0349739_90_1130 333
299 3300041503 Ga0451847_0113323 Ga0451847_0113323_122_1162 333
300 3300041507 Ga0451851_0614241 Ga0451851_0614241_1213_2253 333
301 3300046460 Ga0495638_0001134 Ga0495638_0001134_15327_16340 333
302 3300046518 Ga0495631_0003060 Ga0495631_0003060_6313_7326 333
303 3300046538 Ga0495609_0058361 Ga0495609_0058361_613_1626 333
304 3300046616 Ga0495668_0003677 Ga0495668_0003677_6146_7159 333
305 3300046648 Ga0495611_0004410 Ga0495611_0004410_4952_5965 333
306 3300046660 Ga0495625_0025672 Ga0495625_0025672_511_1524 333
307 3300046691 Ga0495670_0008835 Ga0495670_0008835_3837_4850 333
308 3300047320 Ga0495672_0018588 Ga0495672_0018588_165_1178 333
309 3300048090 Ga0495615_0026076 Ga0495615_0026076_125_1222 333
310 3300048927 Ga0496124_0010940 Ga0496124_0010940_5837_6976 333
311 3300053079 Ga0500610_0002510 Ga0500610_0002510_264_1277 333
312 3300053118 Ga0500594_0005720 Ga0500594_0005720_1715_2728 333
313 3300053139 Ga0500568_0002000 Ga0500568_0002000_6930_7943 333
314 3300053153 Ga0500616_0001260 Ga0500616_0001260_16699_17712 333
315 iso_pu_bacteria 2718217997 2719664554 333
316 iso_pu_bacteria 2718218199 2720490974 333
317 iso_pu_bacteria 2841864319 2841865541 333
318 3300003771 Ga0055526_1018234 Ga0055526_10182343 334
319 3300003790 Ga0055528_1001073 Ga0055528_100107317 334
320 3300003792 Ga0055540_1000453 Ga0055540_10004533 334
321 3300025273 Ga0209673_1000060 Ga0209673_1000060186 334
322 3300025273 Ga0209673_1000649 Ga0209673_100064944 334
323 3300025273 Ga0209673_1001100 Ga0209673_100110017 334
324 3300025273 Ga0209673_1003212 Ga0209673_10032123 334
325 3300025295 Ga0209564_1000116 Ga0209564_1000116186 334
326 3300025295 Ga0209564_1001142 Ga0209564_100114217 334
327 3300025297 Ga0209758_1004285 Ga0209758_10042852 334
328 3300025299 Ga0209256_1003087 Ga0209256_100308713 334
329 3300025303 Ga0209051_1000371 Ga0209051_100037119 334
330 3300025304 Ga0209257_1005871 Ga0209257_10058716 334
331 3300041413 Ga0439465_0032250 Ga0439465_0032250_420_1463 334
332 3300041492 Ga0451835_0354976 Ga0451835_0354976_113_1156 334
333 3300046507 Ga0495606_0111401 Ga0495606_0111401_280_1323 334
334 3300046515 Ga0495620_0065125 Ga0495620_0065125_134_1177 334
335 3300046522 Ga0495643_0031365 Ga0495643_0031365_1212_2255 334
336 3300046524 Ga0495648_0185637 Ga0495648_0185637_28_1041 334
337 3300047443 Ga0495687_066560 Ga0495687_066560_73_1116 334
338 3300053125 Ga0500618_004298 Ga0500618_004298_414_1427 334
339 3300053134 Ga0500658_0000868 Ga0500658_0000868_4638_5681 334
340 iso_pu_bacteria 2509276033 2509443376 334
341 iso_pu_bacteria 2513237088 2513596187 334
342 iso_pu_bacteria 2513237093 2513629968 334
343 iso_pu_bacteria 2515075009 2515111225 334
344 iso_pu_bacteria 2515075009 2515112393 334
345 iso_pu_bacteria 2515154113 2515632745 334
346 iso_pu_bacteria 2515154114 2515639893 334
347 iso_pu_bacteria 2516653077 2517036125 334
348 iso_pu_bacteria 2534681796 2535515657 334
349 iso_pu_bacteria 2791355259 2793312364 334
350 iso_pu_bacteria 2841864319 2841864426 334
351 iso_pu_bacteria 2936375103 2936376422 334
352 iso_pu_bacteria 8005376324 8005379338 334
353 iso_pu_bacteria 8005460587 8005461867 334
354 iso_pu_bacteria 8005460587 8005463064 334
355 iso_pu_bacteria 8057874678 8057874946 334
356 3300025294 Ga0209025_1039490 Ga0209025_10394901 335
357 iso_pu_bacteria 2585427590 2585822747 335
358 3300048909 Ga0496106_0000825 Ga0496106_0000825_166_1179 336
359 iso_pu_bacteria 2510065019 2510132241 336
360 iso_pu_bacteria 2510065019 2510133428 336
361 iso_pu_bacteria 2513237103 2513708608 336
362 iso_pu_bacteria 2513237103 2513709265 336
363 iso_pu_bacteria 2582581867 2585400188 336
364 iso_pu_bacteria 2615840624 2616292360 336
365 iso_pu_bacteria 2615840624 2616296697 336
366 iso_pu_bacteria 2718217882 2719181283 336
367 iso_pu_bacteria 2718217882 2719182575 336
368 iso_pu_bacteria 2718218009 2719732032 336
369 iso_pu_bacteria 2718218009 2719733294 336
370 iso_pu_bacteria 2718218363 2721147377 336
371 iso_pu_bacteria 2718218363 2721148688 336
372 iso_pu_bacteria 2718218365 2721158911 336
373 iso_pu_bacteria 2718218365 2721160074 336
374 iso_pu_bacteria 2718218366 2721164295 336
375 iso_pu_bacteria 2718218366 2721165502 336
376 iso_pu_bacteria 2721755514 2722840465 336
377 iso_pu_bacteria 2721755514 2722841672 336
378 iso_pu_bacteria 2721755810 2724044788 336
379 iso_pu_bacteria 2721755810 2724046050 336
380 iso_pu_bacteria 2721755823 2724110299 336
381 iso_pu_bacteria 2728369365 2730164520 336
382 iso_pu_bacteria 2728369365 2730165810 336
383 iso_pu_bacteria 2728369397 2730298543 336
384 iso_pu_bacteria 2728369397 2730299706 336
385 iso_pu_bacteria 2765235942 2766067439 336
386 iso_pu_bacteria 2765235942 2766067662 336
387 iso_pu_bacteria 2791355256 2793294787 336
388 iso_pu_bacteria 2791355256 2793296143 336
389 iso_pu_bacteria 2791355262 2793333558 336
390 iso_pu_bacteria 2791355262 2793335947 336
391 iso_pu_bacteria 2791355265 2793352966 336
392 iso_pu_bacteria 2791355265 2793353510 336
393 iso_pu_bacteria 2791355266 2793361061 336
394 iso_pu_bacteria 2802429605 2805925805 336
395 iso_pu_bacteria 2802429605 2805926635 336
396 iso_pu_bacteria 2802429606 2805933471 336
397 iso_pu_bacteria 2802429606 2805937489 336
398 iso_pu_bacteria 2838016132 2838017225 336
399 iso_pu_bacteria 2838016132 2838021367 336
400 iso_pu_bacteria 2838022645 2838023254 336
401 iso_pu_bacteria 2838022645 2838026313 336
402 iso_pu_bacteria 2838042994 2838046997 336
403 iso_pu_bacteria 2838668709 2838670788 336
404 iso_pu_bacteria 2838668709 2838671926 336
405 iso_pu_bacteria 2838680041 2838682105 336
406 iso_pu_bacteria 2838694306 2838696677 336
407 iso_pu_bacteria 2838701080 2838703159 336
408 iso_pu_bacteria 2838701080 2838704794 336
409 iso_pu_bacteria 2838707686 2838710084 336
410 iso_pu_bacteria 2842077413 2842078257 336
411 iso_pu_bacteria 2842110456 2842114292 336
412 iso_pu_bacteria 2842110456 2842117628 336
413 iso_pu_bacteria 2842118031 2842119235 336
414 iso_pu_bacteria 2842146304 2842147617 336
415 iso_pu_bacteria 2842146304 2842148466 336
416 iso_pu_bacteria 2842192696 2842194411 336
417 iso_pu_bacteria 2842192696 2842197891 336
418 iso_pu_bacteria 2842198810 2842199682 336
419 iso_pu_bacteria 2842198810 2842201754 336
420 iso_pu_bacteria 2842205361 2842205933 336
421 iso_pu_bacteria 2842205361 2842207759 336
422 iso_pu_bacteria 2842217011 2842217361 336
423 iso_pu_bacteria 2842237096 2842239496 336
424 iso_pu_bacteria 2842250916 2842252683 336
425 iso_pu_bacteria 2842250916 2842254474 336
426 iso_pu_bacteria 2842278818 2842279390 336
427 iso_pu_bacteria 2842278818 2842281446 336
428 iso_pu_bacteria 2842285085 2842286039 336
429 iso_pu_bacteria 2842291075 2842291919 336
430 iso_pu_bacteria 2842311132 2842314338 336
431 iso_pu_bacteria 2842317721 2842317807 336
432 iso_pu_bacteria 2842317721 2842318711 336
433 iso_pu_bacteria 2842341865 2842343662 336
434 iso_pu_bacteria 2842341865 2842345224 336
435 iso_pu_bacteria 2842363717 2842364668 336
436 iso_pu_bacteria 2842363717 2842365182 336
437 iso_pu_bacteria 2842370503 2842372672 336
438 iso_pu_bacteria 2842377471 2842378315 336
439 iso_pu_bacteria 2842384541 2842385744 336
440 iso_pu_bacteria 2842402390 2842403399 336
441 iso_pu_bacteria 2842402390 2842404443 336
442 iso_pu_bacteria 2842409023 2842410872 336
443 iso_pu_bacteria 2842415677 2842415882 336
444 iso_pu_bacteria 2842415677 2842417672 336
445 iso_pu_bacteria 2842489311 2842490126 336
446 iso_pu_bacteria 2842489311 2842493699 336
447 iso_pu_bacteria 2842495871 2842496078 336
448 iso_pu_bacteria 2842495871 2842497346 336
449 iso_pu_bacteria 2857516855 2857520351 336
450 iso_pu_bacteria 2857516855 2857523673 336
451 iso_pu_bacteria 2933586486 2933590387 336
452 iso_pu_bacteria 2933586486 2933593702 336
453 iso_pu_bacteria 2935894831 2935897468 336
454 iso_pu_bacteria 2936367885 2936368186 336
455 iso_pu_bacteria 2936367885 2936372581 336
456 iso_pu_bacteria 2936375103 2936381421 336
457 iso_pu_bacteria 639633055 639647376 336
458 iso_pu_bacteria 639633055 639648652 336
459 iso_pu_bacteria 8005258706 8005261742 336
460 iso_pu_bacteria 8005289223 8005292733 336
461 iso_pu_bacteria 8005289223 8005293196 336
462 iso_pu_bacteria 8005301065 8005302660 336
463 iso_pu_bacteria 8005301065 8005304506 336
464 iso_pu_bacteria 8005376324 8005376673 336
465 iso_pu_bacteria 8005619151 8005620464 336
466 iso_pu_bacteria 8005619151 8005621811 336
467 iso_pu_bacteria 8005688590 8005690927 336
468 iso_pu_bacteria 8005688590 8005694675 336
469 iso_pu_bacteria 8018127388 8018130017 336
470 iso_pu_bacteria 8018127388 8018131243 336
471 iso_pu_bacteria 8024479707 8024481044 336
472 iso_pu_bacteria 8024479707 8024483425 336
473 iso_pu_bacteria 8024501048 8024501539 336
474 iso_pu_bacteria 8024501048 8024503310 336
475 iso_pu_bacteria 8056382006 8056384817 336
476 iso_pu_bacteria 8056382006 8056387936 336
477 3300003771 Ga0055526_1012450 Ga0055526_10124503 337
478 3300003771 Ga0055526_1015046 Ga0055526_10150463 337
479 3300003771 Ga0055526_1017752 Ga0055526_10177521 337
480 3300003775 Ga0055524_1014863 Ga0055524_10148633 337
481 3300025295 Ga0209564_1003779 Ga0209564_10037794 337
482 3300025299 Ga0209256_1003709 Ga0209256_100370915 337
483 iso_pu_bacteria 2510917030 2511195408 337
484 iso_pu_bacteria 2513237138 2513868310 337
485 iso_pu_bacteria 2582581294 2585204556 337
486 iso_pu_bacteria 2582581298 2585224484 337
487 iso_pu_bacteria 2585427529 2585546605 337
488 iso_pu_bacteria 2718217997 2719665706 337
489 iso_pu_bacteria 2718218199 2720492126 337
490 iso_pu_bacteria 2718218232 2720612336 337
491 iso_pu_bacteria 2838048938 2838053462 337
492 iso_pu_bacteria 2838680041 2838681279 337
493 iso_pu_bacteria 2838694306 2838694686 337
494 iso_pu_bacteria 2838707686 2838708064 337
495 iso_pu_bacteria 2842077413 2842080705 337
496 iso_pu_bacteria 2842118031 2842121324 337
497 iso_pu_bacteria 2842237096 2842237475 337
498 iso_pu_bacteria 2842264693 2842265942 337
499 iso_pu_bacteria 2842264693 2842270153 337
500 iso_pu_bacteria 2842291075 2842294361 337
501 iso_pu_bacteria 2842370503 2842371742 337
502 iso_pu_bacteria 2842377471 2842380759 337
503 iso_pu_bacteria 2842384541 2842387830 337
504 iso_pu_bacteria 2842428310 2842429421 337
505 iso_pu_bacteria 2842428310 2842433975 337
506 iso_pu_bacteria 2842434925 2842436034 337
507 iso_pu_bacteria 2842434925 2842440351 337
508 iso_pu_bacteria 2842441272 2842442381 337
509 iso_pu_bacteria 2842441272 2842446890 337
510 iso_pu_bacteria 2842462802 2842463842 337
511 iso_pu_bacteria 2842462802 2842468394 337
512 iso_pu_bacteria 2842469257 2842470363 337
513 iso_pu_bacteria 2842469257 2842474912 337
514 iso_pu_bacteria 2919100787 2919103769 337
515 iso_pu_bacteria 2919100787 2919106769 337
516 iso_pu_bacteria 2923556063 2923561063 337
517 iso_pu_bacteria 2935894831 2935895208 337
518 iso_pu_bacteria 8005430974 8005432203 337
519 iso_pu_bacteria 8005542996 8005546180 337
520 3300049574 Ga0501038_0231149 Ga0501038_0231149_61_1158 338
521 3300002773 JGI25152J39213_1008892 JGI25152J39213_10088922 339
522 3300003775 Ga0055524_1007348 Ga0055524_10073481 339
523 3300025258 Ga0209129_1001497 Ga0209129_10014973 339
524 3300025299 Ga0209256_1002737 Ga0209256_10027372 339
525 3300048925 Ga0496122_0089231 Ga0496122_0089231_535_1620 339
526 iso_pu_bacteria 2582581304 2585259250 339
527 iso_pu_bacteria 2738541293 2738803373 339
528 3300025297 Ga0209758_1000564 Ga0209758_100056412 340
529 3300047443 Ga0495687_051299 Ga0495687_051299_671_1729 340
530 3300048919 Ga0496116_0008219 Ga0496116_0008219_7978_9009 340
531 3300048919 Ga0496116_0010086 Ga0496116_0010086_2016_3044 340
532 3300048920 Ga0496117_0014680 Ga0496117_0014680_1844_2872 340
533 3300048924 Ga0496121_0140635 Ga0496121_0140635_579_1607 340
534 3300048925 Ga0496122_0014461 Ga0496122_0014461_6245_7273 340
535 3300048926 Ga0496123_0157484 Ga0496123_0157484_101_1129 340
536 3300048927 Ga0496124_0000754 Ga0496124_0000754_20143_21171 340
537 3300048928 Ga0496125_0008039 Ga0496125_0008039_9520_10599 340
538 iso_pu_bacteria 2513237088 2513596995 340
539 iso_pu_bacteria 2582581294 2585204633 340
540 iso_pu_bacteria 2585427594 2585847539 340
541 iso_pu_bacteria 2643221599 2644003042 340
542 iso_pu_bacteria 2738541293 2738803252 340
543 iso_pu_bacteria 2996887358 2996892655 340
544 iso_pu_bacteria 3005452660 3005455179 340
545 iso_pu_bacteria 8005258706 8005264718 340
546 iso_pu_bacteria 8005321885 8005327182 340
547 3300025303 Ga0209051_1004341 Ga0209051_10043416 341
548 3300048905 Ga0496102_0215961 Ga0496102_0215961_89_1126 341
549 3300048909 Ga0496106_0000050 Ga0496106_0000050_35049_36092 341
550 3300048927 Ga0496124_0023658 Ga0496124_0023658_1763_2797 341
551 3300053139 Ga0500568_0002776 Ga0500568_0002776_3597_4676 341
552 iso_pu_bacteria 2534681796 2535517364 341
553 iso_pu_bacteria 2517287029 2517410334 342
554 3300002773 JGI25152J39213_1000001 JGI25152J39213_100000193 343
555 3300002773 JGI25152J39213_1000015 JGI25152J39213_100001515 343
556 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007139 343
557 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013140 343
558 3300006353 Ga0075370_10067930 Ga0075370_100679302 343
559 3300025245 Ga0207425_1000032 Ga0207425_1000032136 343
560 3300025258 Ga0209129_1000056 Ga0209129_1000056136 343
561 3300025273 Ga0209673_1013936 Ga0209673_10139363 343
562 3300025294 Ga0209025_1000090 Ga0209025_1000090136 343
563 3300025297 Ga0209758_1000084 Ga0209758_1000084136 343
564 3300048904 Ga0496101_0072200 Ga0496101_0072200_887_1918 343
565 3300048920 Ga0496117_0062952 Ga0496117_0062952_897_1928 343
566 3300048921 Ga0496118_0053540 Ga0496118_0053540_1245_2276 343
567 3300048924 Ga0496121_0094386 Ga0496121_0094386_276_1307 343
568 3300048925 Ga0496122_0060405 Ga0496122_0060405_327_1358 343
569 3300048926 Ga0496123_0025560 Ga0496123_0025560_1456_2487 343
570 3300048926 Ga0496123_0060677 Ga0496123_0060677_1147_2178 343
571 3300048927 Ga0496124_0046208 Ga0496124_0046208_1265_2296 343
572 3300048928 Ga0496125_0044769 Ga0496125_0044769_743_1774 343
573 3300048929 Ga0496126_0136739 Ga0496126_0136739_1066_2097 343
574 3300050496 nmdc:mga07m45_65365_c1 nmdc:mga07m45_65365_c1_87_1118 343
575 iso_pu_bacteria 2513237093 2513631341 343
576 iso_pu_bacteria 2516653085 2517077820 343
577 iso_pu_bacteria 2519899620 2520377915 343
578 iso_pu_bacteria 2582581298 2585220931 343
579 iso_pu_bacteria 2585427526 2585529102 343
580 iso_pu_bacteria 2585427529 2585549969 343
581 iso_pu_bacteria 2615840624 2616295533 343
582 iso_pu_bacteria 2718217997 2719666887 343
583 iso_pu_bacteria 2718218199 2720493307 343
584 iso_pu_bacteria 2718218232 2720614782 343
585 iso_pu_bacteria 2718218233 2720621554 343
586 iso_pu_bacteria 2718218235 2720632882 343
587 iso_pu_bacteria 2718218269 2720776606 343
588 iso_pu_bacteria 2721755556 2723028194 343
589 iso_pu_bacteria 2721755684 2723561825 343
590 iso_pu_bacteria 2721755685 2723568454 343
591 iso_pu_bacteria 2721755819 2724091213 343
592 iso_pu_bacteria 2721755822 2724105719 343
593 iso_pu_bacteria 2721755823 2724111548 343
594 iso_pu_bacteria 2724679232 2725945491 343
595 iso_pu_bacteria 2728369352 2730109130 343
596 iso_pu_bacteria 2765235942 2766065345 343
597 iso_pu_bacteria 2791355260 2793319743 343
598 iso_pu_bacteria 2791355261 2793327751 343
599 iso_pu_bacteria 2791355265 2793353672 343
600 iso_pu_bacteria 2791355266 2793359725 343
601 iso_pu_bacteria 2791355267 2793369477 343
602 iso_pu_bacteria 2802429605 2805930520 343
603 iso_pu_bacteria 2838016132 2838019083 343
604 iso_pu_bacteria 2838048938 2838051199 343
605 iso_pu_bacteria 2838061910 2838063825 343
606 iso_pu_bacteria 2838068647 2838073308 343
607 iso_pu_bacteria 2838668709 2838671167 343
608 iso_pu_bacteria 2838680041 2838684984 343
609 iso_pu_bacteria 2838686498 2838691346 343
610 iso_pu_bacteria 2838694306 2838699179 343
611 iso_pu_bacteria 2838701080 2838703653 343
612 iso_pu_bacteria 2838707686 2838712660 343
613 iso_pu_bacteria 2838729681 2838733305 343
614 iso_pu_bacteria 2838742623 2838746123 343
615 iso_pu_bacteria 2841851746 2841853835 343
616 iso_pu_bacteria 2842077413 2842082137 343
617 iso_pu_bacteria 2842110456 2842113459 343
618 iso_pu_bacteria 2842118031 2842123059 343
619 iso_pu_bacteria 2842146304 2842149345 343
620 iso_pu_bacteria 2842156927 2842162158 343
621 iso_pu_bacteria 2842180545 2842185084 343
622 iso_pu_bacteria 2842217011 2842220103 343
623 iso_pu_bacteria 2842229732 2842233522 343
624 iso_pu_bacteria 2842237096 2842242038 343
625 iso_pu_bacteria 2842243621 2842247615 343
626 iso_pu_bacteria 2842250916 2842254017 343
627 iso_pu_bacteria 2842257432 2842262117 343
628 iso_pu_bacteria 2842271015 2842275820 343
629 iso_pu_bacteria 2842291075 2842296137 343
630 iso_pu_bacteria 2842304105 2842308196 343
631 iso_pu_bacteria 2842317721 2842321418 343
632 iso_pu_bacteria 2842341865 2842342268 343
633 iso_pu_bacteria 2842370503 2842375662 343
634 iso_pu_bacteria 2842377471 2842382536 343
635 iso_pu_bacteria 2842384541 2842389937 343
636 iso_pu_bacteria 2842422224 2842426943 343
637 iso_pu_bacteria 2842447887 2842451006 343
638 iso_pu_bacteria 2842489311 2842493247 343
639 iso_pu_bacteria 2842495871 2842499184 343
640 iso_pu_bacteria 2844454524 2844457520 343
641 iso_pu_bacteria 2857516855 2857518927 343
642 iso_pu_bacteria 2933570622 2933574645 343
643 iso_pu_bacteria 2933586486 2933589251 343
644 iso_pu_bacteria 2933599457 2933603562 343
645 iso_pu_bacteria 2935894831 2935899759 343
646 iso_pu_bacteria 3005445848 3005446699 343
647 iso_pu_bacteria 8005282627 8005288964 343
648 iso_pu_bacteria 8005376324 8005382815 343
649 iso_pu_bacteria 8005382845 8005383866 343
650 iso_pu_bacteria 8005395548 8005401191 343
651 iso_pu_bacteria 8005430974 8005434144 343
652 iso_pu_bacteria 8005497431 8005501639 343
653 iso_pu_bacteria 8005556819 8005558407 343
654 iso_pu_bacteria 8005563573 8005566749 343
655 iso_pu_bacteria 8005619151 8005622995 343
656 iso_pu_bacteria 8005626139 8005631702 343
657 iso_pu_bacteria 8005668836 8005673061 343
658 iso_pu_bacteria 8018127388 8018133639 343
659 iso_pu_bacteria 8018163183 8018170193 343
660 iso_pu_bacteria 8024479707 8024481921 343
661 iso_pu_bacteria 8056375014 8056381558 343
662 iso_pu_bacteria 8056382006 8056386991 343
663 3300009177 Ga0105248_10541938 Ga0105248_105419381 344
664 3300025258 Ga0209129_1002707 Ga0209129_10027072 344
665 3300025299 Ga0209256_1017253 Ga0209256_10172531 344
666 3300025302 Ga0207426_1000447 Ga0207426_100044738 344
667 3300026067 Ga0207678_10047376 Ga0207678_100473762 344
668 3300031911 Ga0307412_10000824 Ga0307412_1000082413 344
669 3300009011 Ga0105251_10056933 Ga0105251_100569331 345
670 3300011119 Ga0105246_10330809 Ga0105246_103308091 345
671 3300025258 Ga0209129_1000621 Ga0209129_100062125 345
672 3300025273 Ga0209673_1014725 Ga0209673_10147252 345
673 3300025295 Ga0209564_1023598 Ga0209564_10235981 345
674 3300025299 Ga0209256_1010144 Ga0209256_10101446 345
675 3300025302 Ga0207426_1005487 Ga0207426_10054876 345
676 3300048907 Ga0496104_0018074 Ga0496104_0018074_4497_5546 345
677 3300048908 Ga0496105_0011321 Ga0496105_0011321_4632_5681 345
678 3300048910 Ga0496107_0151999 Ga0496107_0151999_118_1167 345
679 3300048914 Ga0496111_0050338 Ga0496111_0050338_1160_2209 345
680 3300048917 Ga0496114_0298047 Ga0496114_0298047_297_1346 345
681 3300048924 Ga0496121_0176342 Ga0496121_0176342_356_1405 345
682 3300048926 Ga0496123_0078248 Ga0496123_0078248_634_1683 345
683 3300048929 Ga0496126_0076010 Ga0496126_0076010_957_2006 345
684 iso_pu_bacteria 2718217882 2719184982 345
685 iso_pu_bacteria 2718218009 2719729002 345
686 iso_pu_bacteria 2718218363 2721144693 345
687 iso_pu_bacteria 2721755810 2724042027 345
688 iso_pu_bacteria 2728369365 2730161097 345
689 3300002773 JGI25152J39213_1000302 JGI25152J39213_100030224 346
690 3300002774 JGI25150J39212_1000010 JGI25150J39212_100001082 346
691 3300003187 JGI25151J46595_10000026 JGI25151J46595_1000002662 346
692 3300003215 JGI25153J46596_10005339 JGI25153J46596_100053396 346
693 3300025245 Ga0207425_1000010 Ga0207425_1000010411 346
694 3300025258 Ga0209129_1000099 Ga0209129_100009991 346
695 3300025273 Ga0209673_1008506 Ga0209673_10085063 346
696 3300025294 Ga0209025_1000022 Ga0209025_1000022172 346
697 3300025297 Ga0209758_1000086 Ga0209758_100008687 346
698 3300031911 Ga0307412_10004226 Ga0307412_1000422610 346
699 3300048919 Ga0496116_0001100 Ga0496116_0001100_30378_31433 346
700 3300048919 Ga0496116_0012902 Ga0496116_0012902_808_1863 346
701 3300048920 Ga0496117_0003689 Ga0496117_0003689_15766_16821 346
702 3300048924 Ga0496121_0067597 Ga0496121_0067597_892_1947 346
703 3300048925 Ga0496122_0008679 Ga0496122_0008679_9802_10857 346
704 3300048926 Ga0496123_0075764 Ga0496123_0075764_92_1147 346
705 3300048927 Ga0496124_0009269 Ga0496124_0009269_928_1983 346
706 3300048928 Ga0496125_0003934 Ga0496125_0003934_15570_16625 346
707 3300002739 JGI25158J39367_1000020 JGI25158J39367_100002041 347
708 3300002739 JGI25158J39367_1000059 JGI25158J39367_10000599 347
709 3300002987 JGI25159J45721_1000504 JGI25159J45721_100050418 347
710 3300002987 JGI25159J45721_1000852 JGI25159J45721_10008528 347
711 3300003215 JGI25153J46596_10005698 JGI25153J46596_100056985 347
712 3300003354 JGI25160J50197_1004086 JGI25160J50197_10040866 347
713 3300003374 JGI25161J50226_1000123 JGI25161J50226_100012318 347
714 3300003374 JGI25161J50226_1000133 JGI25161J50226_10001339 347
715 3300003771 Ga0055526_1004479 Ga0055526_10044798 347
716 3300003775 Ga0055524_1010315 Ga0055524_10103155 347
717 3300003775 Ga0055524_1017897 Ga0055524_10178973 347
718 3300003792 Ga0055540_1006779 Ga0055540_10067792 347
719 3300004625 Ga0055543_1000048 Ga0055543_100004859 347
720 3300004625 Ga0055543_1000116 Ga0055543_100011666 347
721 3300005262 Ga0065165_1012372 Ga0065165_10123723 347
722 3300005337 Ga0070682_100178822 Ga0070682_1001788222 347
723 3300025208 Ga0209436_100064 Ga0209436_10006453 347
724 3300025208 Ga0209436_100066 Ga0209436_10006647 347
725 3300025258 Ga0209129_1003512 Ga0209129_10035122 347
726 3300025273 Ga0209673_1005122 Ga0209673_10051226 347
727 3300025284 Ga0209130_1000006 Ga0209130_1000006595 347
728 3300025284 Ga0209130_1000022 Ga0209130_100002239 347
729 3300025295 Ga0209564_1000399 Ga0209564_100039941 347
730 3300025295 Ga0209564_1001217 Ga0209564_10012176 347
731 3300025299 Ga0209256_1001699 Ga0209256_100169911 347
732 3300025299 Ga0209256_1010196 Ga0209256_10101963 347
733 3300025302 Ga0207426_1000005 Ga0207426_1000005207 347
734 3300025302 Ga0207426_1000106 Ga0207426_1000106172 347
735 3300025304 Ga0209257_1015876 Ga0209257_10158762 347
736 3300053156 Ga0500622_0000322 Ga0500622_0000322_6415_7467 347
737 3300053160 Ga0500633_0000482 Ga0500633_0000482_4290_5333 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02530

Porin_2

Porin subfamily

83

401

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eus-assembly2.cif.gz_E crystal structure of the outer membrane channel dcap of acinetobacter baumannii 0.7478 46 347
6ehe-assembly1.cif.gz_A omptdeltal8 (loop l8 deletion mutant of ompt), an outer membrane protein of vibrio cholerae 0.7465 54 347
6ehf-assembly1.cif.gz_A ompt (in-vitro folded), an outer membrane protein vibrio cholerae (trimer form) 0.745 55 347
2xe3-assembly1.cif.gz_A ompc28 0.7274 46 347
6ehe-assembly1.cif.gz_A omptdeltal8 (loop l8 deletion mutant of ompt), an outer membrane protein of vibrio cholerae 0.7258 54 347
ID Description Score Start End Superfamily
af_Q9M2W6_94_225_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.8299 204 326 2.40.160.10
af_Q9W252_3_407_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7184 95 138 3.40.50.300
af_P42591_40_355_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.7069 50 345 2.40.160.10
af_Q54CS9_3_300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7038 95 144 3.40.50.300
4auiC00 Mainly Beta;Beta Barrel;Porin;Porin 0.6946 57 347 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A7W6YPQ5-F1-model_v4 deleted 0.9754 238 347
AF-K0VNG9-F1-model_v4 Porin 0.9607 105 347 GO:0006811
GO:0009279
GO:0015288
GO:0046930
AF-A0A7W6YPQ5-F1-model_v4 deleted 0.9498 238 347
AF-K0VNG9-F1-model_v4 Porin 0.9493 105 347 GO:0006811
GO:0009279
GO:0015288
GO:0046930
AF-A0A4R9PWV6-F1-model_v4 Porin 0.9184 169 282 GO:0006811
GO:0009279
GO:0015288
GO:0046930

Feature Viewer

pLDDT pTM Quality
85.28 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map