F478252

General Info

Members Datasets Scaffolds Average Seq Length
736 204 1472 188

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10078722|Ga0070685_100787222
Length 180
Sequence MKLLFRIGGSVALAAATSGCSIGSMLGGGGKPPVTLVTLTPEAAEPASIQRSVAAGQVVTIETQYVANLTLVDMPARLFQGLLAETVRRTTNRVVLGPAQATLDPGLIVSGQLQHFGYDASTGQVVVTYDGSLSTAGGARVETRRFTATAPSDGTAASVGPALNRAANQVALDVAKWISS

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.2
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10078722 3300005466 Bacteria 1971
2 JGI24740J21852_10001171 3300001979 Bacteria 11836
3 JGI24740J21852_10078306 3300001979 Bacteria 870
4 JGI24735J21928_10007577 3300002067 Bacteria 3538
5 JGI24735J21928_10009893 3300002067 Bacteria 3054
6 JGI24738J21930_10001061 3300002075 Bacteria 7814
7 rootL2_10168002 3300003322 Bacteria 1070
8 Ga0070658_10000568 3300005327 Bacteria 32142
9 Ga0070658_10010954 3300005327 Bacteria 7267
10 Ga0070658_10028086 3300005327 Bacteria 4516
11 Ga0070658_10050148 3300005327 Bacteria 3383
12 Ga0070658_10061338 3300005327 Bacteria 3063
13 Ga0070658_10198790 3300005327 Bacteria 1691
14 Ga0070658_10432013 3300005327 Bacteria 1133
15 Ga0070658_10432014 3300005327 Bacteria 1133
16 Ga0070658_10957413 3300005327 Bacteria 744
17 Ga0070676_10089704 3300005328 Bacteria 1881
18 Ga0070676_10486902 3300005328 Bacteria 873
19 Ga0070676_10486903 3300005328 Unclassified 873
20 Ga0070683_100000241 3300005329 Bacteria 37547
21 Ga0070683_100098775 3300005329 Bacteria 2747
22 Ga0070690_100007962 3300005330 Bacteria 6083
23 Ga0070690_100061811 3300005330 Bacteria 2414
24 Ga0070690_100087675 3300005330 Unclassified 2044
25 Ga0070670_100011571 3300005331 Bacteria 7542
26 Ga0070670_100227299 3300005331 Bacteria 1624
27 Ga0070677_10051146 3300005333 Bacteria 1671
28 Ga0068869_100393323 3300005334 Bacteria 1138
29 Ga0070666_10000472 3300005335 Bacteria 24304
30 Ga0070666_10003199 3300005335 Bacteria 9957
31 Ga0070666_10009278 3300005335 Bacteria 6131
32 Ga0070680_100065178 3300005336 Bacteria 2985
33 Ga0070680_100075514 3300005336 Bacteria 2774
34 Ga0070682_100023389 3300005337 Bacteria 3668
35 Ga0070682_100096339 3300005337 Bacteria 1945
36 Ga0070682_100170795 3300005337 Bacteria 1511
37 Ga0068868_100009099 3300005338 Bacteria 7129
38 Ga0068868_100085472 3300005338 Bacteria 2535
39 Ga0068868_100758332 3300005338 Bacteria 872
40 Ga0068868_100774974 3300005338 Unclassified 863
41 Ga0070660_100000604 3300005339 Bacteria 23986
42 Ga0070660_100003603 3300005339 Bacteria 10695
43 Ga0070660_100060162 3300005339 Bacteria 2947
44 Ga0070660_100066136 3300005339 Bacteria 2813
45 Ga0070660_100073551 3300005339 Bacteria 2672
46 Ga0070660_100087239 3300005339 Bacteria 2456
47 Ga0070660_100108671 3300005339 Bacteria 2204
48 Ga0070660_100120539 3300005339 Bacteria 2093
49 Ga0070660_100126482 3300005339 Bacteria 2042
50 Ga0070660_100335636 3300005339 Bacteria 1243
51 Ga0070660_100345801 3300005339 Bacteria 1224
52 Ga0070660_100892947 3300005339 Unclassified 749
53 Ga0070691_10029984 3300005341 Bacteria 2546
54 Ga0070661_100000294 3300005344 Bacteria 40265
55 Ga0070661_100011812 3300005344 Bacteria 6094
56 Ga0070661_100016769 3300005344 Bacteria 5186
57 Ga0070661_100055491 3300005344 Bacteria 2901
58 Ga0070661_100085769 3300005344 Bacteria 2328
59 Ga0070661_100088531 3300005344 Bacteria 2291
60 Ga0070661_100575831 3300005344 Unclassified 908
61 Ga0070692_10027988 3300005345 Bacteria 2798
62 Ga0070692_10201636 3300005345 Bacteria 1166
63 Ga0070668_100251368 3300005347 Bacteria 1467
64 Ga0070668_100271316 3300005347 Bacteria 1414
65 Ga0070675_100330321 3300005354 Bacteria 1348
66 Ga0070671_100005854 3300005355 Bacteria 9793
67 Ga0070671_100013121 3300005355 Bacteria 6676
68 Ga0070671_100022825 3300005355 Bacteria 5112
69 Ga0070671_100029855 3300005355 Bacteria 4497
70 Ga0070671_100032873 3300005355 Bacteria 4288
71 Ga0070671_100042910 3300005355 Bacteria 3761
72 Ga0070671_100049250 3300005355 Bacteria 3505
73 Ga0070671_100375050 3300005355 Unclassified 1215
74 Ga0070671_100396780 3300005355 Bacteria 1180
75 Ga0070674_100018109 3300005356 Bacteria 4446
76 Ga0070674_100036727 3300005356 Bacteria 3291
77 Ga0070674_100045214 3300005356 Bacteria 3008
78 Ga0070674_100114771 3300005356 Bacteria 1984
79 Ga0070673_100012986 3300005364 Bacteria 5743
80 Ga0070673_100055338 3300005364 Bacteria 3125
81 Ga0070673_100057001 3300005364 Bacteria 3085
82 Ga0070673_100079675 3300005364 Bacteria 2652
83 Ga0070673_100085769 3300005364 Bacteria 2564
84 Ga0070673_100152033 3300005364 Bacteria 1961
85 Ga0070673_100359865 3300005364 Unclassified 1293
86 Ga0070659_100000420 3300005366 Bacteria 32217
87 Ga0070659_100009282 3300005366 Bacteria 7221
88 Ga0070659_100035630 3300005366 Bacteria 3875
89 Ga0070659_100038805 3300005366 Bacteria 3716
90 Ga0070659_100042708 3300005366 Bacteria 3544
91 Ga0070659_100078024 3300005366 Bacteria 2642
92 Ga0070659_100086181 3300005366 Bacteria 2513
93 Ga0070659_100199516 3300005366 Unclassified 1646
94 Ga0070659_100272858 3300005366 Bacteria 1406
95 Ga0070659_100435266 3300005366 Bacteria 1110
96 Ga0070667_100003379 3300005367 Bacteria 13608
97 Ga0070667_100008997 3300005367 Bacteria 8266
98 Ga0070667_100126517 3300005367 Bacteria 2227
99 Ga0070667_100186975 3300005367 Bacteria 1833
100 Ga0070667_100352937 3300005367 Bacteria 1332
101 Ga0070709_10036351 3300005434 Bacteria 2999
102 Ga0070709_10334426 3300005434 Bacteria 1115
103 Ga0070714_100011244 3300005435 Bacteria 7095
104 Ga0070714_100013652 3300005435 Bacteria 6514
105 Ga0070714_100068769 3300005435 Bacteria 3056
106 Ga0070714_100608702 3300005435 Unclassified 1049
107 Ga0070713_100047266 3300005436 Bacteria 3536
108 Ga0070663_100052774 3300005455 Bacteria 2900
109 Ga0070663_100053542 3300005455 Bacteria 2881
110 Ga0070663_100141950 3300005455 Bacteria 1834
111 Ga0070663_100331102 3300005455 Bacteria 1227
112 Ga0070663_100351809 3300005455 Bacteria 1193
113 Ga0070663_101084596 3300005455 Bacteria 699
114 Ga0070678_100204818 3300005456 Bacteria 1631
115 Ga0070662_100000122 3300005457 Bacteria 43731
116 Ga0070662_100142830 3300005457 Bacteria 1857
117 Ga0070662_100187776 3300005457 Bacteria 1632
118 Ga0070681_10010100 3300005458 Bacteria 9304
119 Ga0070681_10052123 3300005458 Bacteria 4081
120 Ga0070681_10170966 3300005458 Bacteria 2095
121 Ga0070681_10274950 3300005458 Unclassified 1595
122 Ga0070681_10876220 3300005458 Bacteria 816
123 Ga0068867_100231308 3300005459 Bacteria 1494
124 Ga0068867_100276016 3300005459 Bacteria 1376
125 Ga0070679_100003137 3300005530 Bacteria 15111
126 Ga0070679_100031455 3300005530 Bacteria 5242
127 Ga0070679_100070195 3300005530 Bacteria 3495
128 Ga0070679_100313663 3300005530 Bacteria 1518
129 Ga0070679_100778786 3300005530 Bacteria 900
130 Ga0070684_100031495 3300005535 Bacteria 4516
131 Ga0070684_100134839 3300005535 Bacteria 2229
132 Ga0070684_100423000 3300005535 Bacteria 1230
133 Ga0070684_100449542 3300005535 Bacteria 1191
134 Ga0070684_100613922 3300005535 Bacteria 1011
135 Ga0068853_100000170 3300005539 Bacteria 45176
136 Ga0068853_100038272 3300005539 Bacteria 4084
137 Ga0068853_100131673 3300005539 Bacteria 2239
138 Ga0068853_100200514 3300005539 Bacteria 1816
139 Ga0068853_100277866 3300005539 Unclassified 1543
140 Ga0070672_100123084 3300005543 Bacteria 2125
141 Ga0070672_100186649 3300005543 Unclassified 1729
142 Ga0070672_100299245 3300005543 Bacteria 1363
143 Ga0070672_100741699 3300005543 Bacteria 861
144 Ga0070693_100005669 3300005547 Bacteria 6024
145 Ga0070693_100145428 3300005547 Bacteria 1496
146 Ga0070693_100168637 3300005547 Bacteria 1400
147 Ga0070665_100013546 3300005548 Bacteria 8204
148 Ga0070665_100188679 3300005548 Bacteria 2062
149 Ga0070665_100234357 3300005548 Bacteria 1836
150 Ga0070665_100392173 3300005548 Bacteria 1396
151 Ga0070665_100434498 3300005548 Bacteria 1322
152 Ga0068855_100001041 3300005563 Bacteria 34479
153 Ga0068855_100093425 3300005563 Bacteria 3469
154 Ga0068855_100097570 3300005563 Bacteria 3385
155 Ga0068855_100267887 3300005563 Bacteria 1900
156 Ga0068855_100350062 3300005563 Bacteria 1627
157 Ga0068855_100401108 3300005563 Bacteria 1503
158 Ga0068855_100733902 3300005563 Bacteria 1054
159 Ga0070664_100000047 3300005564 Bacteria 73560
160 Ga0070664_100000738 3300005564 Bacteria 25207
161 Ga0070664_100001759 3300005564 Bacteria 17347
162 Ga0070664_100010225 3300005564 Bacteria 7609
163 Ga0070664_100016999 3300005564 Bacteria 5971
164 Ga0070664_100069060 3300005564 Bacteria 3022
165 Ga0070664_100248754 3300005564 Bacteria 1598
166 Ga0070664_100494426 3300005564 Unclassified 1127
167 Ga0070664_100656456 3300005564 Unclassified 975
168 Ga0068857_100011067 3300005577 Bacteria 7849
169 Ga0068857_100293406 3300005577 Bacteria 1498
170 Ga0068857_100317008 3300005577 Bacteria 1439
171 Ga0068854_100012416 3300005578 Bacteria 5577
172 Ga0068854_100073740 3300005578 Bacteria 2502
173 Ga0068854_100145983 3300005578 Bacteria 1820
174 Ga0068854_100401710 3300005578 Unclassified 1134
175 Ga0068854_100507180 3300005578 Unclassified 1017
176 Ga0068854_100821902 3300005578 Unclassified 811
177 Ga0068856_100000453 3300005614 Bacteria 45359
178 Ga0068856_100012339 3300005614 Bacteria 8275
179 Ga0068856_100020442 3300005614 Bacteria 6430
180 Ga0068856_100201326 3300005614 Bacteria 2005
181 Ga0068856_100302668 3300005614 Bacteria 1617
182 Ga0068856_100823162 3300005614 Bacteria 948
183 Ga0068852_100000613 3300005616 Bacteria 23393
184 Ga0068852_100001752 3300005616 Bacteria 14768
185 Ga0068852_100019880 3300005616 Bacteria 5327
186 Ga0068852_100038033 3300005616 Bacteria 4041
187 Ga0068852_100200825 3300005616 Bacteria 1887
188 Ga0068852_100216378 3300005616 Bacteria 1820
189 Ga0068852_100275962 3300005616 Bacteria 1619
190 Ga0068852_100331253 3300005616 Bacteria 1481
191 Ga0068852_100333565 3300005616 Bacteria 1476
192 Ga0068852_100418391 3300005616 Bacteria 1321
193 Ga0068852_100430162 3300005616 Bacteria 1303
194 Ga0068859_100078362 3300005617 Bacteria 3344
195 Ga0068859_100080939 3300005617 Bacteria 3289
196 Ga0068859_100641769 3300005617 Bacteria 1154
197 Ga0068864_100000644 3300005618 Bacteria 29347
198 Ga0068864_100002541 3300005618 Bacteria 15068
199 Ga0068864_100009730 3300005618 Bacteria 7930
200 Ga0068864_100048620 3300005618 Bacteria 3647
201 Ga0068864_100239182 3300005618 Bacteria 1682
202 Ga0068851_10028186 3300005834 Bacteria 2773
203 Ga0068851_10051458 3300005834 Bacteria 2093
204 Ga0068851_10094478 3300005834 Bacteria 1579
205 Ga0068851_10174729 3300005834 Unclassified 1187
206 Ga0068870_10472272 3300005840 Bacteria 831
207 Ga0068863_100004897 3300005841 Bacteria 13196
208 Ga0068863_100107734 3300005841 Bacteria 2652
209 Ga0068863_100219124 3300005841 Unclassified 1833
210 Ga0068858_100015928 3300005842 Bacteria 7064
211 Ga0068858_100022406 3300005842 Bacteria 5896
212 Ga0068858_100114539 3300005842 Bacteria 2519
213 Ga0068858_100121010 3300005842 Bacteria 2448
214 Ga0068858_100131847 3300005842 Bacteria 2344
215 Ga0068860_100086083 3300005843 Bacteria 2990
216 Ga0068860_100255835 3300005843 Bacteria 1706
217 Ga0068860_100434976 3300005843 Bacteria 1302
218 Ga0081539_10013550 3300005985 Bacteria 6132
219 Ga0070717_10029756 3300006028 Bacteria 4385
220 Ga0070717_10117723 3300006028 Bacteria 2273
221 Ga0070717_11096944 3300006028 Unclassified 725
222 Ga0070716_100560978 3300006173 Bacteria 853
223 Ga0070712_100128630 3300006175 Bacteria 1917
224 Ga0097621_100059705 3300006237 Bacteria 3123
225 Ga0097621_100766620 3300006237 Bacteria 892
226 Ga0068871_100015512 3300006358 Bacteria 5705
227 Ga0068871_100069204 3300006358 Bacteria 2898
228 Ga0068871_100132920 3300006358 Bacteria 2111
229 Ga0068871_100429028 3300006358 Bacteria 1182
230 Ga0068865_100010423 3300006881 Bacteria 5784
231 Ga0068865_100740654 3300006881 Bacteria 843
232 Ga0068865_100813981 3300006881 Unclassified 807
233 Ga0097620_100078360 3300006931 Bacteria 3344
234 Ga0097620_100080937 3300006931 Bacteria 3289
235 Ga0097620_100641857 3300006931 Bacteria 1154
236 Ga0105240_10072065 3300009093 Bacteria 4271
237 Ga0105245_10033757 3300009098 Bacteria 4535
238 Ga0105245_10052587 3300009098 Bacteria 3653
239 Ga0105243_10494323 3300009148 Bacteria 1158
240 Ga0105241_10080294 3300009174 Bacteria 2553
241 Ga0105242_10003230 3300009176 Bacteria 12707
242 Ga0105242_10162497 3300009176 Bacteria 1956
243 Ga0105248_10000682 3300009177 Bacteria 38390
244 Ga0105248_10000898 3300009177 Bacteria 33299
245 Ga0105248_10005021 3300009177 Bacteria 14611
246 Ga0105248_10018677 3300009177 Bacteria 7665
247 Ga0105248_10036058 3300009177 Bacteria 5532
248 Ga0105248_10102794 3300009177 Bacteria 3221
249 Ga0105248_10234261 3300009177 Bacteria 2067
250 Ga0105237_10077452 3300009545 Bacteria 3315
251 Ga0105249_10106311 3300009553 Bacteria 2648
252 Ga0105239_10187193 3300010375 Bacteria 2317
253 Ga0105239_10463044 3300010375 Bacteria 1439
254 Ga0105239_10887238 3300010375 Unclassified 1023
255 Ga0105246_10130082 3300011119 Bacteria 1879
256 Ga0157373_10045987 3300013100 Bacteria 3115
257 Ga0157373_10068965 3300013100 Bacteria 2500
258 Ga0157373_10086361 3300013100 Bacteria 2211
259 Ga0157371_10001385 3300013102 Bacteria 25379
260 Ga0157371_10007684 3300013102 Bacteria 8681
261 Ga0157371_10063648 3300013102 Bacteria 2614
262 Ga0157371_10189345 3300013102 Bacteria 1473
263 Ga0157371_10454512 3300013102 Bacteria 942
264 Ga0157370_10051466 3300013104 Bacteria 3934
265 Ga0157370_10096254 3300013104 Bacteria 2777
266 Ga0157370_10817400 3300013104 Bacteria 848
267 Ga0157369_10028823 3300013105 Bacteria 6141
268 Ga0157369_10085544 3300013105 Bacteria 3369
269 Ga0157369_10124680 3300013105 Bacteria 2732
270 Ga0157369_10162072 3300013105 Bacteria 2360
271 Ga0157369_10162276 3300013105 Bacteria 2359
272 Ga0157369_10353770 3300013105 Unclassified 1525
273 Ga0157374_10067530 3300013296 Bacteria 3362
274 Ga0157374_10071403 3300013296 Bacteria 3273
275 Ga0157374_10244562 3300013296 Bacteria 1765
276 Ga0157374_10406867 3300013296 Bacteria 1358
277 Ga0157378_10020021 3300013297 Bacteria 5883
278 Ga0157378_10206770 3300013297 Bacteria 1859
279 Ga0157378_11053201 3300013297 Bacteria 849
280 Ga0163162_10302263 3300013306 Bacteria 1732
281 Ga0157372_10094994 3300013307 Bacteria 3396
282 Ga0157372_10335613 3300013307 Bacteria 1761
283 Ga0157372_10707588 3300013307 Bacteria 1172
284 Ga0157375_10019577 3300013308 Bacteria 6160
285 Ga0157375_10109013 3300013308 Bacteria 2864
286 Ga0163163_10000458 3300014325 Bacteria 37229
287 Ga0163163_10004251 3300014325 Bacteria 12204
288 Ga0163163_10041991 3300014325 Bacteria 4476
289 Ga0157377_10033218 3300014745 Bacteria 2815
290 Ga0157377_10125642 3300014745 Unclassified 1560
291 Ga0157379_10007253 3300014968 Bacteria 9592
292 Ga0157379_10023295 3300014968 Bacteria 5493
293 Ga0157379_10043312 3300014968 Bacteria 4019
294 Ga0157376_10001987 3300014969 Bacteria 13686
295 Ga0157376_10218728 3300014969 Bacteria 1763
296 Ga0206353_10933061 3300020082 Bacteria 863
297 Ga0213876_10041518 3300021384 Bacteria 2430
298 Ga0213875_10015000 3300021388 Bacteria 3774
299 Ga0207656_10001141 3300025321 Bacteria 8734
300 Ga0207656_10020743 3300025321 Bacteria 2615
301 Ga0207656_10082831 3300025321 Bacteria 1445
302 Ga0207656_10130102 3300025321 Bacteria 1179
303 Ga0207682_10004479 3300025893 Bacteria 5829
304 Ga0207682_10026741 3300025893 Bacteria 2296
305 Ga0207642_10472588 3300025899 Bacteria 763
306 Ga0207688_10084986 3300025901 Bacteria 1812
307 Ga0207688_10518824 3300025901 Unclassified 747
308 Ga0207680_10000407 3300025903 Bacteria 20574
309 Ga0207680_10003594 3300025903 Bacteria 7285
310 Ga0207680_10136759 3300025903 Bacteria 1620
311 Ga0207680_10579019 3300025903 Bacteria 802
312 Ga0207647_10014129 3300025904 Bacteria 5514
313 Ga0207647_10022706 3300025904 Bacteria 4163
314 Ga0207647_10023926 3300025904 Bacteria 4033
315 Ga0207647_10027097 3300025904 Bacteria 3740
316 Ga0207647_10032897 3300025904 Bacteria 3326
317 Ga0207647_10056654 3300025904 Bacteria 2404
318 Ga0207647_10089674 3300025904 Bacteria 1835
319 Ga0207647_10204424 3300025904 Bacteria 1142
320 Ga0207699_10106226 3300025906 Bacteria 1791
321 Ga0207699_10218428 3300025906 Bacteria 1300
322 Ga0207645_10058982 3300025907 Bacteria 2451
323 Ga0207643_10066308 3300025908 Bacteria 2070
324 Ga0207705_10000728 3300025909 Bacteria 27105
325 Ga0207705_10003386 3300025909 Bacteria 12126
326 Ga0207705_10003556 3300025909 Bacteria 11863
327 Ga0207705_10014824 3300025909 Bacteria 5604
328 Ga0207705_10017139 3300025909 Bacteria 5190
329 Ga0207705_10025069 3300025909 Bacteria 4257
330 Ga0207705_10053678 3300025909 Bacteria 2904
331 Ga0207705_10092140 3300025909 Bacteria 2220
332 Ga0207705_10096243 3300025909 Bacteria 2173
333 Ga0207705_10112505 3300025909 Bacteria 2013
334 Ga0207705_10144742 3300025909 Bacteria 1777
335 Ga0207705_10194659 3300025909 Unclassified 1534
336 Ga0207705_10210827 3300025909 Bacteria 1473
337 Ga0207707_10144009 3300025912 Unclassified 2083
338 Ga0207707_10295347 3300025912 Unclassified 1402
339 Ga0207707_10725878 3300025912 Bacteria 833
340 Ga0207695_10050926 3300025913 Bacteria 4353
341 Ga0207671_10062463 3300025914 Bacteria 2766
342 Ga0207693_10023484 3300025915 Bacteria 4895
343 Ga0207660_10110218 3300025917 Bacteria 2070
344 Ga0207660_10120238 3300025917 Bacteria 1988
345 Ga0207660_10126064 3300025917 Bacteria 1944
346 Ga0207660_10512924 3300025917 Bacteria 973
347 Ga0207657_10000090 3300025919 Bacteria 86852
348 Ga0207657_10002591 3300025919 Bacteria 19567
349 Ga0207657_10003263 3300025919 Bacteria 17364
350 Ga0207657_10003734 3300025919 Bacteria 16181
351 Ga0207657_10006657 3300025919 Bacteria 11956
352 Ga0207657_10015366 3300025919 Bacteria 7419
353 Ga0207657_10051140 3300025919 Bacteria 3592
354 Ga0207657_10143004 3300025919 Bacteria 1953
355 Ga0207657_10153017 3300025919 Bacteria 1878
356 Ga0207657_10203708 3300025919 Bacteria 1591
357 Ga0207657_10224375 3300025919 Bacteria 1504
358 Ga0207657_10324816 3300025919 Unclassified 1216
359 Ga0207657_10535501 3300025919 Bacteria 916
360 Ga0207657_10540434 3300025919 Bacteria 911
361 Ga0207649_10000825 3300025920 Bacteria 19905
362 Ga0207649_10022504 3300025920 Bacteria 3642
363 Ga0207649_10036739 3300025920 Bacteria 2953
364 Ga0207649_10148000 3300025920 Bacteria 1614
365 Ga0207649_10400359 3300025920 Unclassified 1027
366 Ga0207649_10420838 3300025920 Unclassified 1003
367 Ga0207652_10007945 3300025921 Bacteria 8514
368 Ga0207652_10217389 3300025921 Bacteria 1722
369 Ga0207652_10266520 3300025921 Bacteria 1545
370 Ga0207652_10281230 3300025921 Bacteria 1501
371 Ga0207652_10419887 3300025921 Bacteria 1206
372 Ga0207652_10908843 3300025921 Bacteria 777
373 Ga0207694_10064505 3300025924 Bacteria 2854
374 Ga0207650_10015870 3300025925 Bacteria 5255
375 Ga0207650_10038067 3300025925 Bacteria 3509
376 Ga0207650_10119549 3300025925 Bacteria 2049
377 Ga0207650_10142933 3300025925 Bacteria 1882
378 Ga0207659_10059498 3300025926 Bacteria 2747
379 Ga0207659_10655834 3300025926 Bacteria 897
380 Ga0207687_10115967 3300025927 Bacteria 1996
381 Ga0207700_10093709 3300025928 Bacteria 2377
382 Ga0207700_10797425 3300025928 Bacteria 845
383 Ga0207664_10032489 3300025929 Bacteria 4000
384 Ga0207664_10082352 3300025929 Bacteria 2621
385 Ga0207664_10104550 3300025929 Bacteria 2345
386 Ga0207664_10323755 3300025929 Bacteria 1360
387 Ga0207664_10340250 3300025929 Bacteria 1326
388 Ga0207664_10701659 3300025929 Bacteria 910
389 Ga0207644_10000248 3300025931 Bacteria 36674
390 Ga0207644_10002311 3300025931 Bacteria 12356
391 Ga0207644_10005880 3300025931 Bacteria 7999
392 Ga0207644_10006947 3300025931 Bacteria 7370
393 Ga0207644_10015112 3300025931 Bacteria 5179
394 Ga0207644_10019678 3300025931 Bacteria 4583
395 Ga0207644_10059096 3300025931 Bacteria 2772
396 Ga0207644_10067867 3300025931 Bacteria 2600
397 Ga0207644_10317914 3300025931 Bacteria 1258
398 Ga0207690_10000214 3300025932 Bacteria 43972
399 Ga0207690_10015984 3300025932 Bacteria 4559
400 Ga0207690_10027788 3300025932 Bacteria 3578
401 Ga0207690_10029584 3300025932 Bacteria 3485
402 Ga0207690_10029744 3300025932 Bacteria 3476
403 Ga0207690_10037286 3300025932 Bacteria 3155
404 Ga0207690_10038508 3300025932 Bacteria 3112
405 Ga0207690_10040986 3300025932 Bacteria 3031
406 Ga0207690_10049323 3300025932 Bacteria 2806
407 Ga0207690_10155737 3300025932 Unclassified 1698
408 Ga0207690_10268552 3300025932 Bacteria 1324
409 Ga0207690_10344615 3300025932 Bacteria 1177
410 Ga0207706_10000110 3300025933 Bacteria 87522
411 Ga0207706_10004177 3300025933 Bacteria 13598
412 Ga0207706_10025655 3300025933 Bacteria 5280
413 Ga0207706_10040562 3300025933 Bacteria 4126
414 Ga0207706_10048371 3300025933 Bacteria 3761
415 Ga0207706_10121081 3300025933 Bacteria 2301
416 Ga0207706_10140662 3300025933 Bacteria 2123
417 Ga0207706_10166937 3300025933 Bacteria 1934
418 Ga0207706_10463159 3300025933 Bacteria 1096
419 Ga0207706_10836324 3300025933 Unclassified 780
420 Ga0207709_10170555 3300025935 Bacteria 1526
421 Ga0207669_10009874 3300025937 Bacteria 4568
422 Ga0207669_10010293 3300025937 Bacteria 4498
423 Ga0207669_10015370 3300025937 Bacteria 3859
424 Ga0207669_10047381 3300025937 Bacteria 2546
425 Ga0207669_10252077 3300025937 Bacteria 1315
426 Ga0207704_10029360 3300025938 Bacteria 3065
427 Ga0207704_10338421 3300025938 Unclassified 1167
428 Ga0207665_10648538 3300025939 Bacteria 827
429 Ga0207691_10002167 3300025940 Bacteria 19199
430 Ga0207691_10081893 3300025940 Bacteria 2900
431 Ga0207691_11053314 3300025940 Bacteria 678
432 Ga0207691_11053315 3300025940 Unclassified 678
433 Ga0207711_10000243 3300025941 Bacteria 58447
434 Ga0207711_10000748 3300025941 Bacteria 31824
435 Ga0207711_10003230 3300025941 Bacteria 14205
436 Ga0207711_10010236 3300025941 Bacteria 7785
437 Ga0207711_10014474 3300025941 Bacteria 6554
438 Ga0207711_10071272 3300025941 Bacteria 3015
439 Ga0207711_10186057 3300025941 Bacteria 1891
440 Ga0207711_10459883 3300025941 Unclassified 1185
441 Ga0207689_10055661 3300025942 Bacteria 3255
442 Ga0207661_10001899 3300025944 Bacteria 14341
443 Ga0207661_10018392 3300025944 Bacteria 5191
444 Ga0207661_10124344 3300025944 Bacteria 2201
445 Ga0207661_10268948 3300025944 Bacteria 1520
446 Ga0207661_10273807 3300025944 Bacteria 1507
447 Ga0207661_10606650 3300025944 Bacteria 1005
448 Ga0207661_11271965 3300025944 Bacteria 676
449 Ga0207679_10000473 3300025945 Bacteria 28250
450 Ga0207679_10000677 3300025945 Bacteria 22872
451 Ga0207679_10015839 3300025945 Bacteria 4995
452 Ga0207679_10046721 3300025945 Bacteria 3140
453 Ga0207679_10061390 3300025945 Bacteria 2798
454 Ga0207679_10097568 3300025945 Bacteria 2289
455 Ga0207679_10160118 3300025945 Bacteria 1842
456 Ga0207679_10204678 3300025945 Unclassified 1651
457 Ga0207679_10221051 3300025945 Bacteria 1593
458 Ga0207679_10493751 3300025945 Bacteria 1091
459 Ga0207667_10017180 3300025949 Bacteria 8155
460 Ga0207667_10019988 3300025949 Bacteria 7459
461 Ga0207667_10074066 3300025949 Bacteria 3537
462 Ga0207667_10172725 3300025949 Bacteria 2221
463 Ga0207667_10185512 3300025949 Bacteria 2135
464 Ga0207667_10314184 3300025949 Bacteria 1600
465 Ga0207667_10419170 3300025949 Bacteria 1362
466 Ga0207651_10001100 3300025960 Bacteria 12007
467 Ga0207651_10023388 3300025960 Bacteria 3800
468 Ga0207651_10051567 3300025960 Bacteria 2800
469 Ga0207651_10102072 3300025960 Bacteria 2131
470 Ga0207651_10445994 3300025960 Bacteria 1109
471 Ga0207651_10577698 3300025960 Bacteria 980
472 Ga0207712_10003447 3300025961 Bacteria 9993
473 Ga0207668_10175492 3300025972 Bacteria 1685
474 Ga0207640_10018708 3300025981 Bacteria 4077
475 Ga0207640_10027080 3300025981 Bacteria 3490
476 Ga0207640_10027232 3300025981 Bacteria 3480
477 Ga0207640_10123060 3300025981 Bacteria 1862
478 Ga0207658_10002237 3300025986 Bacteria 14358
479 Ga0207658_10040090 3300025986 Bacteria 3383
480 Ga0207658_10077627 3300025986 Bacteria 2534
481 Ga0207658_10090883 3300025986 Bacteria 2367
482 Ga0207677_10225681 3300026023 Bacteria 1505
483 Ga0207677_10967909 3300026023 Bacteria 770
484 Ga0207703_10001643 3300026035 Bacteria 20120
485 Ga0207703_10042034 3300026035 Bacteria 3664
486 Ga0207703_10047873 3300026035 Bacteria 3448
487 Ga0207703_10096612 3300026035 Bacteria 2495
488 Ga0207703_10740868 3300026035 Bacteria 936
489 Ga0207639_10000476 3300026041 Bacteria 27709
490 Ga0207639_10013731 3300026041 Bacteria 5679
491 Ga0207639_10096440 3300026041 Bacteria 2379
492 Ga0207639_10132808 3300026041 Bacteria 2063
493 Ga0207639_10166782 3300026041 Bacteria 1861
494 Ga0207639_10383075 3300026041 Bacteria 1263
495 Ga0207639_10560142 3300026041 Bacteria 1050
496 Ga0207678_10002136 3300026067 Bacteria 17908
497 Ga0207678_10003011 3300026067 Bacteria 15242
498 Ga0207678_10038546 3300026067 Bacteria 4152
499 Ga0207678_10063260 3300026067 Bacteria 3179
500 Ga0207678_10121045 3300026067 Bacteria 2233
501 Ga0207678_10157364 3300026067 Bacteria 1940
502 Ga0207702_10002037 3300026078 Bacteria 19578
503 Ga0207702_10019940 3300026078 Bacteria 5555
504 Ga0207702_10020753 3300026078 Bacteria 5433
505 Ga0207702_10131201 3300026078 Bacteria 2255
506 Ga0207702_10194293 3300026078 Bacteria 1877
507 Ga0207702_10246394 3300026078 Bacteria 1676
508 Ga0207702_10374692 3300026078 Unclassified 1367
509 Ga0207702_10863028 3300026078 Bacteria 896
510 Ga0207641_10039687 3300026088 Bacteria 3938
511 Ga0207641_10054903 3300026088 Bacteria 3382
512 Ga0207641_10071964 3300026088 Bacteria 2976
513 Ga0207641_10294210 3300026088 Bacteria 1531
514 Ga0207648_10001389 3300026089 Bacteria 26669
515 Ga0207648_10024810 3300026089 Bacteria 5348
516 Ga0207676_10005109 3300026095 Bacteria 9292
517 Ga0207676_10019368 3300026095 Bacteria 4964
518 Ga0207676_10024875 3300026095 Bacteria 4437
519 Ga0207676_10024936 3300026095 Bacteria 4433
520 Ga0207674_10002210 3300026116 Bacteria 24650
521 Ga0207674_10074478 3300026116 Bacteria 3407
522 Ga0207674_10530002 3300026116 Bacteria 1138
523 Ga0207674_11372277 3300026116 Unclassified 676
524 Ga0207683_10001782 3300026121 Bacteria 19055
525 Ga0207683_10033576 3300026121 Bacteria 4457
526 Ga0207683_10097743 3300026121 Bacteria 2619
527 Ga0207698_10000718 3300026142 Bacteria 19187
528 Ga0207698_10003140 3300026142 Bacteria 9903
529 Ga0207698_10003192 3300026142 Bacteria 9840
530 Ga0207698_10009773 3300026142 Bacteria 6126
531 Ga0207698_10018145 3300026142 Bacteria 4789
532 Ga0207698_10023906 3300026142 Bacteria 4278
533 Ga0207698_10037046 3300026142 Bacteria 3588
534 Ga0207698_10079232 3300026142 Bacteria 2641
535 Ga0207698_10143239 3300026142 Bacteria 2063
536 Ga0207698_10289664 3300026142 Bacteria 1519
537 Ga0207698_10314977 3300026142 Bacteria 1463
538 Ga0207698_10761450 3300026142 Bacteria 968
539 Ga0268266_10091099 3300028379 Bacteria 2673
540 Ga0268266_10385553 3300028379 Bacteria 1323
541 Ga0268264_10002566 3300028381 Bacteria 15920
542 Ga0268264_10145589 3300028381 Bacteria 2118
543 Ga0268264_10182268 3300028381 Bacteria 1908
544 Ga0307408_100155614 3300031548 Bacteria 1809
545 Ga0307405_10017516 3300031731 Bacteria 3932
546 Ga0307405_10039009 3300031731 Bacteria 2868
547 Ga0307413_10081754 3300031824 Bacteria 2072
548 Ga0307410_10269880 3300031852 Bacteria 1330
549 Ga0307406_10214414 3300031901 Bacteria 1426
550 Ga0307406_10710723 3300031901 Bacteria 840
551 Ga0307407_10008967 3300031903 Bacteria 4628
552 Ga0307407_10192961 3300031903 Bacteria 1359
553 Ga0307407_10542164 3300031903 Unclassified 859
554 Ga0307409_100001518 3300031995 Bacteria 11491
555 Ga0307409_100229660 3300031995 Bacteria 1681
556 Ga0307409_100483061 3300031995 Unclassified 1202
557 Ga0307416_100002542 3300032002 Bacteria 10508
558 Ga0307416_100009461 3300032002 Bacteria 6381
559 Ga0307416_100897542 3300032002 Bacteria 986
560 Ga0307414_10111836 3300032004 Bacteria 2081
561 Ga0307414_10153905 3300032004 Bacteria 1817
562 Ga0307411_10091839 3300032005 Bacteria 2122
563 Ga0307411_10351471 3300032005 Bacteria 1202
564 Ga0307415_100050291 3300032126 Bacteria 2823
565 Ga0307415_100098022 3300032126 Bacteria 2141
566 Ga0307415_100205372 3300032126 Bacteria 1567
567 Ga0307415_100486493 3300032126 Bacteria 1076
568 Ga0373938_0048129 3300034957 Unclassified 966
569 Ga0373960_0034713 3300035121 Bacteria 1428
570 Ga0373943_0001605 3300035170 Bacteria 10246
571 Ga0373946_0058657 3300035171 Bacteria 1631
572 Ga0373931_0085456 3300035691 Bacteria 1749
573 Ga0373947_0018414 3300035725 Bacteria 4018
574 Ga0373925_0022152 3300037068 Bacteria 4633
575 Ga0395899_0000523 3300037312 Bacteria 42229
576 Ga0395899_0000632 3300037312 Bacteria 36585
577 Ga0395899_0007989 3300037312 Bacteria 8149
578 Ga0395899_0038544 3300037312 Bacteria 3579
579 Ga0395899_0076433 3300037312 Bacteria 2444
580 Ga0395899_0166309 3300037312 Bacteria 1555
581 Ga0395899_0220343 3300037312 Bacteria 1314
582 Ga0395899_0412600 3300037312 Unclassified 891
583 Ga0395900_0000075 3300037418 Bacteria 183525
584 Ga0395900_0000289 3300037418 Bacteria 75525
585 Ga0395900_0011077 3300037418 Bacteria 9214
586 Ga0395900_0035222 3300037418 Bacteria 5156
587 Ga0395900_0064918 3300037418 Bacteria 3750
588 Ga0395900_0065001 3300037418 Bacteria 3747
589 Ga0395900_0078928 3300037418 Bacteria 3382
590 Ga0395900_0141315 3300037418 Bacteria 2465
591 Ga0395900_0156386 3300037418 Bacteria 2328
592 Ga0395900_0170722 3300037418 Bacteria 2214
593 Ga0395900_0476293 3300037418 Bacteria 1201
594 Ga0395900_0517728 3300037418 Bacteria 1141
595 Ga0395900_0533959 3300037418 Unclassified 1119
596 Ga0395900_0625035 3300037418 Bacteria 1015
597 Ga0395900_1502939 3300037418 Bacteria 585
598 Ga0395898_0000055 3300037466 Bacteria 278557
599 Ga0395898_0020969 3300037466 Bacteria 6630
600 Ga0395898_0061457 3300037466 Bacteria 3649
601 Ga0395898_0077821 3300037466 Bacteria 3201
602 Ga0395898_0090384 3300037466 Bacteria 2946
603 Ga0395898_0114801 3300037466 Bacteria 2580
604 Ga0395898_0120198 3300037466 Bacteria 2517
605 Ga0395898_0238244 3300037466 Bacteria 1735
606 Ga0395898_1023264 3300037466 Unclassified 761
607 Ga0395905_0000067 3300037471 Bacteria 181887
608 Ga0395905_0002039 3300037471 Bacteria 23073
609 Ga0395905_0010489 3300037471 Bacteria 9011
610 Ga0395905_0011936 3300037471 Bacteria 8375
611 Ga0395905_0011999 3300037471 Bacteria 8357
612 Ga0395905_0014418 3300037471 Bacteria 7548
613 Ga0395905_0018840 3300037471 Bacteria 6546
614 Ga0395905_0036309 3300037471 Bacteria 4628
615 Ga0395905_0042785 3300037471 Bacteria 4249
616 Ga0395905_0072662 3300037471 Bacteria 3225
617 Ga0395905_0073770 3300037471 Bacteria 3199
618 Ga0395905_0080121 3300037471 Bacteria 3060
619 Ga0395905_0165955 3300037471 Bacteria 2075
620 Ga0395905_0181067 3300037471 Bacteria 1978
621 Ga0395905_0193915 3300037471 Bacteria 1905
622 Ga0395905_0195066 3300037471 Bacteria 1899
623 Ga0395905_0195351 3300037471 Bacteria 1897
624 Ga0395905_0214226 3300037471 Bacteria 1804
625 Ga0395905_0256137 3300037471 Bacteria 1634
626 Ga0395905_0382411 3300037471 Bacteria 1301
627 Ga0395905_0506501 3300037471 Bacteria 1107
628 Ga0395905_0631118 3300037471 Bacteria 973
629 Ga0395905_0662514 3300037471 Bacteria 946
630 Ga0436364_1270187 3300037853 Bacteria 2005
631 Ga0436364_1481755 3300037853 Bacteria 15521
632 Ga0395901_0000477 3300038443 Bacteria 46511
633 Ga0395901_0000957 3300038443 Bacteria 31439
634 Ga0395901_0008459 3300038443 Bacteria 10399
635 Ga0395901_0009524 3300038443 Bacteria 9856
636 Ga0395901_0028807 3300038443 Bacteria 5713
637 Ga0395901_0030997 3300038443 Bacteria 5512
638 Ga0395901_0079906 3300038443 Bacteria 3414
639 Ga0395901_0147029 3300038443 Bacteria 2477
640 Ga0395901_0263495 3300038443 Bacteria 1793
641 Ga0395901_0285865 3300038443 Bacteria 1712
642 Ga0395901_0588891 3300038443 Unclassified 1123
643 Ga0395901_1217221 3300038443 Unclassified 718
644 Ga0436365_1490276 3300039437 Bacteria 16241
645 Ga0439465_0042710 3300041413 Bacteria 1470
646 Ga0439448_0012134 3300042005 Bacteria 2574
647 Ga0439432_011885 3300042006 Bacteria 2992
648 Ga0439458_0079562 3300042157 Bacteria 835
649 Ga0466966_0123747 3300044684 Bacteria 1587
650 Ga0466961_0050234 3300044693 Bacteria 2664
651 Ga0466961_0066833 3300044693 Bacteria 2283
652 Ga0466961_0510607 3300044693 Bacteria 725
653 Ga0466963_0067315 3300044694 Bacteria 2403
654 Ga0466963_0103987 3300044694 Bacteria 1945
655 Ga0466963_0230056 3300044694 Bacteria 1299
656 Ga0466971_0007339 3300044719 Bacteria 4797
657 Ga0466971_0079583 3300044719 Bacteria 1493
658 Ga0466971_0203876 3300044719 Bacteria 934
659 Ga0466957_0052688 3300044842 Bacteria 2478
660 Ga0466959_0071924 3300045049 Bacteria 2504
661 Ga0466959_0627689 3300045049 Bacteria 722
662 Ga0466958_0062801 3300045836 Bacteria 2265
663 Ga0466958_0164444 3300045836 Bacteria 1403
664 Ga0466967_0024962 3300045976 Bacteria 4921
665 Ga0466967_0076996 3300045976 Bacteria 3001
666 Ga0466967_0193349 3300045976 Bacteria 1924
667 Ga0466967_0291148 3300045976 Bacteria 1569
668 Ga0466967_0952258 3300045976 Bacteria 854
669 Ga0466967_1151494 3300045976 Unclassified 773
670 Ga0466967_1293982 3300045976 Unclassified 726
671 Ga0495585_0293934 3300046492 Bacteria 800
672 Ga0495642_0034857 3300046528 Unclassified 2029
673 Ga0495598_0022139 3300046537 Bacteria 1698
674 Ga0495621_0010038 3300046539 Bacteria 2890
675 Ga0495621_0128723 3300046539 Unclassified 983
676 Ga0495669_0051178 3300046684 Bacteria 1853
677 Ga0495669_0130784 3300046684 Bacteria 1181
678 Ga0495670_0022765 3300046691 Bacteria 3094
679 Ga0496100_0011510 3300048903 Bacteria 5038
680 Ga0496100_0204483 3300048903 Unclassified 1441
681 Ga0496100_0429164 3300048903 Unclassified 1010
682 Ga0496101_0014111 3300048904 Bacteria 5364
683 Ga0496101_0035256 3300048904 Bacteria 3538
684 Ga0496101_0064789 3300048904 Bacteria 2663
685 Ga0496101_0240471 3300048904 Bacteria 1409
686 Ga0496101_0246793 3300048904 Bacteria 1390
687 Ga0496102_0201143 3300048905 Bacteria 1878
688 Ga0496103_0011834 3300048906 Bacteria 5178
689 Ga0496104_0328713 3300048907 Unclassified 1442
690 Ga0496105_0050658 3300048908 Bacteria 3430
691 Ga0496105_0068514 3300048908 Bacteria 2932
692 Ga0496105_0110161 3300048908 Bacteria 2273
693 Ga0496105_0152531 3300048908 Bacteria 1899
694 Ga0496106_0012054 3300048909 Bacteria 6379
695 Ga0496106_0267589 3300048909 Bacteria 1368
696 Ga0496107_0001820 3300048910 Bacteria 13445
697 Ga0496107_0041072 3300048910 Bacteria 3321
698 Ga0496107_0064899 3300048910 Bacteria 2647
699 Ga0496107_0143913 3300048910 Bacteria 1762
700 Ga0496107_0282648 3300048910 Bacteria 1235
701 Ga0496108_0010144 3300048911 Bacteria 7644
702 Ga0496108_0023116 3300048911 Bacteria 5113
703 Ga0496108_0055186 3300048911 Bacteria 3335
704 Ga0496108_0077755 3300048911 Bacteria 2807
705 Ga0496109_0015364 3300048912 Bacteria 6670
706 Ga0496109_0018829 3300048912 Bacteria 6074
707 Ga0496109_0030628 3300048912 Bacteria 4822
708 Ga0496109_0055037 3300048912 Bacteria 3629
709 Ga0496109_0057079 3300048912 Bacteria 3562
710 Ga0496109_0216581 3300048912 Bacteria 1801
711 Ga0496109_0280483 3300048912 Bacteria 1570
712 Ga0496109_0661413 3300048912 Unclassified 982
713 Ga0496110_0001263 3300048913 Bacteria 18090
714 Ga0496110_0050884 3300048913 Bacteria 3639
715 Ga0496110_0066943 3300048913 Bacteria 3177
716 Ga0496110_0071446 3300048913 Bacteria 3077
717 Ga0496111_0000602 3300048914 Bacteria 18978
718 Ga0496111_0004038 3300048914 Bacteria 9214
719 Ga0496111_0018983 3300048914 Bacteria 4767
720 Ga0496111_0028402 3300048914 Bacteria 3964
721 Ga0496112_0002535 3300048915 Bacteria 14751
722 Ga0496112_0015813 3300048915 Bacteria 7050
723 Ga0496112_0053175 3300048915 Bacteria 3976
724 Ga0496112_0055729 3300048915 Bacteria 3888
725 Ga0496112_0191265 3300048915 Bacteria 2008
726 Ga0496112_1232561 3300048915 Bacteria 664
727 Ga0496113_0005632 3300048916 Bacteria 7838
728 Ga0496113_0012025 3300048916 Bacteria 5804
729 Ga0496113_0099402 3300048916 Bacteria 2253
730 Ga0496113_0170479 3300048916 Bacteria 1723
731 Ga0496113_0204477 3300048916 Unclassified 1570
732 Ga0501209_029801 3300049656 Bacteria 1375
733 Ga0501224_023795 3300049664 Bacteria 915
734 Ga0587078_025130 3300059646 Unclassified 775
735 Ga0466962_0036827 3300061719 Bacteria 2342
736 Ga0466962_0120911 3300061719 Bacteria 1264
737 Ga0070685_10078722
738 JGI24740J21852_10001171
739 JGI24740J21852_10078306
740 JGI24735J21928_10007577
741 JGI24735J21928_10009893
742 JGI24738J21930_10001061
743 rootL2_10168002
744 Ga0070658_10000568
745 Ga0070658_10010954
746 Ga0070658_10028086
747 Ga0070658_10050148
748 Ga0070658_10061338
749 Ga0070658_10198790
750 Ga0070658_10432013
751 Ga0070658_10432014
752 Ga0070658_10957413
753 Ga0070676_10089704
754 Ga0070676_10486902
755 Ga0070676_10486903
756 Ga0070683_100000241
757 Ga0070683_100098775
758 Ga0070690_100007962
759 Ga0070690_100061811
760 Ga0070690_100087675
761 Ga0070670_100011571
762 Ga0070670_100227299
763 Ga0070677_10051146
764 Ga0068869_100393323
765 Ga0070666_10000472
766 Ga0070666_10003199
767 Ga0070666_10009278
768 Ga0070680_100065178
769 Ga0070680_100075514
770 Ga0070682_100023389
771 Ga0070682_100096339
772 Ga0070682_100170795
773 Ga0068868_100009099
774 Ga0068868_100085472
775 Ga0068868_100758332
776 Ga0068868_100774974
777 Ga0070660_100000604
778 Ga0070660_100003603
779 Ga0070660_100060162
780 Ga0070660_100066136
781 Ga0070660_100073551
782 Ga0070660_100087239
783 Ga0070660_100108671
784 Ga0070660_100120539
785 Ga0070660_100126482
786 Ga0070660_100335636
787 Ga0070660_100345801
788 Ga0070660_100892947
789 Ga0070691_10029984
790 Ga0070661_100000294
791 Ga0070661_100011812
792 Ga0070661_100016769
793 Ga0070661_100055491
794 Ga0070661_100085769
795 Ga0070661_100088531
796 Ga0070661_100575831
797 Ga0070692_10027988
798 Ga0070692_10201636
799 Ga0070668_100251368
800 Ga0070668_100271316
801 Ga0070675_100330321
802 Ga0070671_100005854
803 Ga0070671_100013121
804 Ga0070671_100022825
805 Ga0070671_100029855
806 Ga0070671_100032873
807 Ga0070671_100042910
808 Ga0070671_100049250
809 Ga0070671_100375050
810 Ga0070671_100396780
811 Ga0070674_100018109
812 Ga0070674_100036727
813 Ga0070674_100045214
814 Ga0070674_100114771
815 Ga0070673_100012986
816 Ga0070673_100055338
817 Ga0070673_100057001
818 Ga0070673_100079675
819 Ga0070673_100085769
820 Ga0070673_100152033
821 Ga0070673_100359865
822 Ga0070659_100000420
823 Ga0070659_100009282
824 Ga0070659_100035630
825 Ga0070659_100038805
826 Ga0070659_100042708
827 Ga0070659_100078024
828 Ga0070659_100086181
829 Ga0070659_100199516
830 Ga0070659_100272858
831 Ga0070659_100435266
832 Ga0070667_100003379
833 Ga0070667_100008997
834 Ga0070667_100126517
835 Ga0070667_100186975
836 Ga0070667_100352937
837 Ga0070709_10036351
838 Ga0070709_10334426
839 Ga0070714_100011244
840 Ga0070714_100013652
841 Ga0070714_100068769
842 Ga0070714_100608702
843 Ga0070713_100047266
844 Ga0070663_100052774
845 Ga0070663_100053542
846 Ga0070663_100141950
847 Ga0070663_100331102
848 Ga0070663_100351809
849 Ga0070663_101084596
850 Ga0070678_100204818
851 Ga0070662_100000122
852 Ga0070662_100142830
853 Ga0070662_100187776
854 Ga0070681_10010100
855 Ga0070681_10052123
856 Ga0070681_10170966
857 Ga0070681_10274950
858 Ga0070681_10876220
859 Ga0068867_100231308
860 Ga0068867_100276016
861 Ga0070679_100003137
862 Ga0070679_100031455
863 Ga0070679_100070195
864 Ga0070679_100313663
865 Ga0070679_100778786
866 Ga0070684_100031495
867 Ga0070684_100134839
868 Ga0070684_100423000
869 Ga0070684_100449542
870 Ga0070684_100613922
871 Ga0068853_100000170
872 Ga0068853_100038272
873 Ga0068853_100131673
874 Ga0068853_100200514
875 Ga0068853_100277866
876 Ga0070672_100123084
877 Ga0070672_100186649
878 Ga0070672_100299245
879 Ga0070672_100741699
880 Ga0070693_100005669
881 Ga0070693_100145428
882 Ga0070693_100168637
883 Ga0070665_100013546
884 Ga0070665_100188679
885 Ga0070665_100234357
886 Ga0070665_100392173
887 Ga0070665_100434498
888 Ga0068855_100001041
889 Ga0068855_100093425
890 Ga0068855_100097570
891 Ga0068855_100267887
892 Ga0068855_100350062
893 Ga0068855_100401108
894 Ga0068855_100733902
895 Ga0070664_100000047
896 Ga0070664_100000738
897 Ga0070664_100001759
898 Ga0070664_100010225
899 Ga0070664_100016999
900 Ga0070664_100069060
901 Ga0070664_100248754
902 Ga0070664_100494426
903 Ga0070664_100656456
904 Ga0068857_100011067
905 Ga0068857_100293406
906 Ga0068857_100317008
907 Ga0068854_100012416
908 Ga0068854_100073740
909 Ga0068854_100145983
910 Ga0068854_100401710
911 Ga0068854_100507180
912 Ga0068854_100821902
913 Ga0068856_100000453
914 Ga0068856_100012339
915 Ga0068856_100020442
916 Ga0068856_100201326
917 Ga0068856_100302668
918 Ga0068856_100823162
919 Ga0068852_100000613
920 Ga0068852_100001752
921 Ga0068852_100019880
922 Ga0068852_100038033
923 Ga0068852_100200825
924 Ga0068852_100216378
925 Ga0068852_100275962
926 Ga0068852_100331253
927 Ga0068852_100333565
928 Ga0068852_100418391
929 Ga0068852_100430162
930 Ga0068859_100078362
931 Ga0068859_100080939
932 Ga0068859_100641769
933 Ga0068864_100000644
934 Ga0068864_100002541
935 Ga0068864_100009730
936 Ga0068864_100048620
937 Ga0068864_100239182
938 Ga0068851_10028186
939 Ga0068851_10051458
940 Ga0068851_10094478
941 Ga0068851_10174729
942 Ga0068870_10472272
943 Ga0068863_100004897
944 Ga0068863_100107734
945 Ga0068863_100219124
946 Ga0068858_100015928
947 Ga0068858_100022406
948 Ga0068858_100114539
949 Ga0068858_100121010
950 Ga0068858_100131847
951 Ga0068860_100086083
952 Ga0068860_100255835
953 Ga0068860_100434976
954 Ga0081539_10013550
955 Ga0070717_10029756
956 Ga0070717_10117723
957 Ga0070717_11096944
958 Ga0070716_100560978
959 Ga0070712_100128630
960 Ga0097621_100059705
961 Ga0097621_100766620
962 Ga0068871_100015512
963 Ga0068871_100069204
964 Ga0068871_100132920
965 Ga0068871_100429028
966 Ga0068865_100010423
967 Ga0068865_100740654
968 Ga0068865_100813981
969 Ga0097620_100078360
970 Ga0097620_100080937
971 Ga0097620_100641857
972 Ga0105240_10072065
973 Ga0105245_10033757
974 Ga0105245_10052587
975 Ga0105243_10494323
976 Ga0105241_10080294
977 Ga0105242_10003230
978 Ga0105242_10162497
979 Ga0105248_10000682
980 Ga0105248_10000898
981 Ga0105248_10005021
982 Ga0105248_10018677
983 Ga0105248_10036058
984 Ga0105248_10102794
985 Ga0105248_10234261
986 Ga0105237_10077452
987 Ga0105249_10106311
988 Ga0105239_10187193
989 Ga0105239_10463044
990 Ga0105239_10887238
991 Ga0105246_10130082
992 Ga0157373_10045987
993 Ga0157373_10068965
994 Ga0157373_10086361
995 Ga0157371_10001385
996 Ga0157371_10007684
997 Ga0157371_10063648
998 Ga0157371_10189345
999 Ga0157371_10454512
1000 Ga0157370_10051466
1001 Ga0157370_10096254
1002 Ga0157370_10817400
1003 Ga0157369_10028823
1004 Ga0157369_10085544
1005 Ga0157369_10124680
1006 Ga0157369_10162072
1007 Ga0157369_10162276
1008 Ga0157369_10353770
1009 Ga0157374_10067530
1010 Ga0157374_10071403
1011 Ga0157374_10244562
1012 Ga0157374_10406867
1013 Ga0157378_10020021
1014 Ga0157378_10206770
1015 Ga0157378_11053201
1016 Ga0163162_10302263
1017 Ga0157372_10094994
1018 Ga0157372_10335613
1019 Ga0157372_10707588
1020 Ga0157375_10019577
1021 Ga0157375_10109013
1022 Ga0163163_10000458
1023 Ga0163163_10004251
1024 Ga0163163_10041991
1025 Ga0157377_10033218
1026 Ga0157377_10125642
1027 Ga0157379_10007253
1028 Ga0157379_10023295
1029 Ga0157379_10043312
1030 Ga0157376_10001987
1031 Ga0157376_10218728
1032 Ga0206353_10933061
1033 Ga0213876_10041518
1034 Ga0213875_10015000
1035 Ga0207656_10001141
1036 Ga0207656_10020743
1037 Ga0207656_10082831
1038 Ga0207656_10130102
1039 Ga0207682_10004479
1040 Ga0207682_10026741
1041 Ga0207642_10472588
1042 Ga0207688_10084986
1043 Ga0207688_10518824
1044 Ga0207680_10000407
1045 Ga0207680_10003594
1046 Ga0207680_10136759
1047 Ga0207680_10579019
1048 Ga0207647_10014129
1049 Ga0207647_10022706
1050 Ga0207647_10023926
1051 Ga0207647_10027097
1052 Ga0207647_10032897
1053 Ga0207647_10056654
1054 Ga0207647_10089674
1055 Ga0207647_10204424
1056 Ga0207699_10106226
1057 Ga0207699_10218428
1058 Ga0207645_10058982
1059 Ga0207643_10066308
1060 Ga0207705_10000728
1061 Ga0207705_10003386
1062 Ga0207705_10003556
1063 Ga0207705_10014824
1064 Ga0207705_10017139
1065 Ga0207705_10025069
1066 Ga0207705_10053678
1067 Ga0207705_10092140
1068 Ga0207705_10096243
1069 Ga0207705_10112505
1070 Ga0207705_10144742
1071 Ga0207705_10194659
1072 Ga0207705_10210827
1073 Ga0207707_10144009
1074 Ga0207707_10295347
1075 Ga0207707_10725878
1076 Ga0207695_10050926
1077 Ga0207671_10062463
1078 Ga0207693_10023484
1079 Ga0207660_10110218
1080 Ga0207660_10120238
1081 Ga0207660_10126064
1082 Ga0207660_10512924
1083 Ga0207657_10000090
1084 Ga0207657_10002591
1085 Ga0207657_10003263
1086 Ga0207657_10003734
1087 Ga0207657_10006657
1088 Ga0207657_10015366
1089 Ga0207657_10051140
1090 Ga0207657_10143004
1091 Ga0207657_10153017
1092 Ga0207657_10203708
1093 Ga0207657_10224375
1094 Ga0207657_10324816
1095 Ga0207657_10535501
1096 Ga0207657_10540434
1097 Ga0207649_10000825
1098 Ga0207649_10022504
1099 Ga0207649_10036739
1100 Ga0207649_10148000
1101 Ga0207649_10400359
1102 Ga0207649_10420838
1103 Ga0207652_10007945
1104 Ga0207652_10217389
1105 Ga0207652_10266520
1106 Ga0207652_10281230
1107 Ga0207652_10419887
1108 Ga0207652_10908843
1109 Ga0207694_10064505
1110 Ga0207650_10015870
1111 Ga0207650_10038067
1112 Ga0207650_10119549
1113 Ga0207650_10142933
1114 Ga0207659_10059498
1115 Ga0207659_10655834
1116 Ga0207687_10115967
1117 Ga0207700_10093709
1118 Ga0207700_10797425
1119 Ga0207664_10032489
1120 Ga0207664_10082352
1121 Ga0207664_10104550
1122 Ga0207664_10323755
1123 Ga0207664_10340250
1124 Ga0207664_10701659
1125 Ga0207644_10000248
1126 Ga0207644_10002311
1127 Ga0207644_10005880
1128 Ga0207644_10006947
1129 Ga0207644_10015112
1130 Ga0207644_10019678
1131 Ga0207644_10059096
1132 Ga0207644_10067867
1133 Ga0207644_10317914
1134 Ga0207690_10000214
1135 Ga0207690_10015984
1136 Ga0207690_10027788
1137 Ga0207690_10029584
1138 Ga0207690_10029744
1139 Ga0207690_10037286
1140 Ga0207690_10038508
1141 Ga0207690_10040986
1142 Ga0207690_10049323
1143 Ga0207690_10155737
1144 Ga0207690_10268552
1145 Ga0207690_10344615
1146 Ga0207706_10000110
1147 Ga0207706_10004177
1148 Ga0207706_10025655
1149 Ga0207706_10040562
1150 Ga0207706_10048371
1151 Ga0207706_10121081
1152 Ga0207706_10140662
1153 Ga0207706_10166937
1154 Ga0207706_10463159
1155 Ga0207706_10836324
1156 Ga0207709_10170555
1157 Ga0207669_10009874
1158 Ga0207669_10010293
1159 Ga0207669_10015370
1160 Ga0207669_10047381
1161 Ga0207669_10252077
1162 Ga0207704_10029360
1163 Ga0207704_10338421
1164 Ga0207665_10648538
1165 Ga0207691_10002167
1166 Ga0207691_10081893
1167 Ga0207691_11053314
1168 Ga0207691_11053315
1169 Ga0207711_10000243
1170 Ga0207711_10000748
1171 Ga0207711_10003230
1172 Ga0207711_10010236
1173 Ga0207711_10014474
1174 Ga0207711_10071272
1175 Ga0207711_10186057
1176 Ga0207711_10459883
1177 Ga0207689_10055661
1178 Ga0207661_10001899
1179 Ga0207661_10018392
1180 Ga0207661_10124344
1181 Ga0207661_10268948
1182 Ga0207661_10273807
1183 Ga0207661_10606650
1184 Ga0207661_11271965
1185 Ga0207679_10000473
1186 Ga0207679_10000677
1187 Ga0207679_10015839
1188 Ga0207679_10046721
1189 Ga0207679_10061390
1190 Ga0207679_10097568
1191 Ga0207679_10160118
1192 Ga0207679_10204678
1193 Ga0207679_10221051
1194 Ga0207679_10493751
1195 Ga0207667_10017180
1196 Ga0207667_10019988
1197 Ga0207667_10074066
1198 Ga0207667_10172725
1199 Ga0207667_10185512
1200 Ga0207667_10314184
1201 Ga0207667_10419170
1202 Ga0207651_10001100
1203 Ga0207651_10023388
1204 Ga0207651_10051567
1205 Ga0207651_10102072
1206 Ga0207651_10445994
1207 Ga0207651_10577698
1208 Ga0207712_10003447
1209 Ga0207668_10175492
1210 Ga0207640_10018708
1211 Ga0207640_10027080
1212 Ga0207640_10027232
1213 Ga0207640_10123060
1214 Ga0207658_10002237
1215 Ga0207658_10040090
1216 Ga0207658_10077627
1217 Ga0207658_10090883
1218 Ga0207677_10225681
1219 Ga0207677_10967909
1220 Ga0207703_10001643
1221 Ga0207703_10042034
1222 Ga0207703_10047873
1223 Ga0207703_10096612
1224 Ga0207703_10740868
1225 Ga0207639_10000476
1226 Ga0207639_10013731
1227 Ga0207639_10096440
1228 Ga0207639_10132808
1229 Ga0207639_10166782
1230 Ga0207639_10383075
1231 Ga0207639_10560142
1232 Ga0207678_10002136
1233 Ga0207678_10003011
1234 Ga0207678_10038546
1235 Ga0207678_10063260
1236 Ga0207678_10121045
1237 Ga0207678_10157364
1238 Ga0207702_10002037
1239 Ga0207702_10019940
1240 Ga0207702_10020753
1241 Ga0207702_10131201
1242 Ga0207702_10194293
1243 Ga0207702_10246394
1244 Ga0207702_10374692
1245 Ga0207702_10863028
1246 Ga0207641_10039687
1247 Ga0207641_10054903
1248 Ga0207641_10071964
1249 Ga0207641_10294210
1250 Ga0207648_10001389
1251 Ga0207648_10024810
1252 Ga0207676_10005109
1253 Ga0207676_10019368
1254 Ga0207676_10024875
1255 Ga0207676_10024936
1256 Ga0207674_10002210
1257 Ga0207674_10074478
1258 Ga0207674_10530002
1259 Ga0207674_11372277
1260 Ga0207683_10001782
1261 Ga0207683_10033576
1262 Ga0207683_10097743
1263 Ga0207698_10000718
1264 Ga0207698_10003140
1265 Ga0207698_10003192
1266 Ga0207698_10009773
1267 Ga0207698_10018145
1268 Ga0207698_10023906
1269 Ga0207698_10037046
1270 Ga0207698_10079232
1271 Ga0207698_10143239
1272 Ga0207698_10289664
1273 Ga0207698_10314977
1274 Ga0207698_10761450
1275 Ga0268266_10091099
1276 Ga0268266_10385553
1277 Ga0268264_10002566
1278 Ga0268264_10145589
1279 Ga0268264_10182268
1280 Ga0307408_100155614
1281 Ga0307405_10017516
1282 Ga0307405_10039009
1283 Ga0307413_10081754
1284 Ga0307410_10269880
1285 Ga0307406_10214414
1286 Ga0307406_10710723
1287 Ga0307407_10008967
1288 Ga0307407_10192961
1289 Ga0307407_10542164
1290 Ga0307409_100001518
1291 Ga0307409_100229660
1292 Ga0307409_100483061
1293 Ga0307416_100002542
1294 Ga0307416_100009461
1295 Ga0307416_100897542
1296 Ga0307414_10111836
1297 Ga0307414_10153905
1298 Ga0307411_10091839
1299 Ga0307411_10351471
1300 Ga0307415_100050291
1301 Ga0307415_100098022
1302 Ga0307415_100205372
1303 Ga0307415_100486493
1304 Ga0373938_0048129
1305 Ga0373960_0034713
1306 Ga0373943_0001605
1307 Ga0373946_0058657
1308 Ga0373931_0085456
1309 Ga0373947_0018414
1310 Ga0373925_0022152
1311 Ga0395899_0000523
1312 Ga0395899_0000632
1313 Ga0395899_0007989
1314 Ga0395899_0038544
1315 Ga0395899_0076433
1316 Ga0395899_0166309
1317 Ga0395899_0220343
1318 Ga0395899_0412600
1319 Ga0395900_0000075
1320 Ga0395900_0000289
1321 Ga0395900_0011077
1322 Ga0395900_0035222
1323 Ga0395900_0064918
1324 Ga0395900_0065001
1325 Ga0395900_0078928
1326 Ga0395900_0141315
1327 Ga0395900_0156386
1328 Ga0395900_0170722
1329 Ga0395900_0476293
1330 Ga0395900_0517728
1331 Ga0395900_0533959
1332 Ga0395900_0625035
1333 Ga0395900_1502939
1334 Ga0395898_0000055
1335 Ga0395898_0020969
1336 Ga0395898_0061457
1337 Ga0395898_0077821
1338 Ga0395898_0090384
1339 Ga0395898_0114801
1340 Ga0395898_0120198
1341 Ga0395898_0238244
1342 Ga0395898_1023264
1343 Ga0395905_0000067
1344 Ga0395905_0002039
1345 Ga0395905_0010489
1346 Ga0395905_0011936
1347 Ga0395905_0011999
1348 Ga0395905_0014418
1349 Ga0395905_0018840
1350 Ga0395905_0036309
1351 Ga0395905_0042785
1352 Ga0395905_0072662
1353 Ga0395905_0073770
1354 Ga0395905_0080121
1355 Ga0395905_0165955
1356 Ga0395905_0181067
1357 Ga0395905_0193915
1358 Ga0395905_0195066
1359 Ga0395905_0195351
1360 Ga0395905_0214226
1361 Ga0395905_0256137
1362 Ga0395905_0382411
1363 Ga0395905_0506501
1364 Ga0395905_0631118
1365 Ga0395905_0662514
1366 Ga0436364_1270187
1367 Ga0436364_1481755
1368 Ga0395901_0000477
1369 Ga0395901_0000957
1370 Ga0395901_0008459
1371 Ga0395901_0009524
1372 Ga0395901_0028807
1373 Ga0395901_0030997
1374 Ga0395901_0079906
1375 Ga0395901_0147029
1376 Ga0395901_0263495
1377 Ga0395901_0285865
1378 Ga0395901_0588891
1379 Ga0395901_1217221
1380 Ga0436365_1490276
1381 Ga0439465_0042710
1382 Ga0439448_0012134
1383 Ga0439432_011885
1384 Ga0439458_0079562
1385 Ga0466966_0123747
1386 Ga0466961_0050234
1387 Ga0466961_0066833
1388 Ga0466961_0510607
1389 Ga0466963_0067315
1390 Ga0466963_0103987
1391 Ga0466963_0230056
1392 Ga0466971_0007339
1393 Ga0466971_0079583
1394 Ga0466971_0203876
1395 Ga0466957_0052688
1396 Ga0466959_0071924
1397 Ga0466959_0627689
1398 Ga0466958_0062801
1399 Ga0466958_0164444
1400 Ga0466967_0024962
1401 Ga0466967_0076996
1402 Ga0466967_0193349
1403 Ga0466967_0291148
1404 Ga0466967_0952258
1405 Ga0466967_1151494
1406 Ga0466967_1293982
1407 Ga0495585_0293934
1408 Ga0495642_0034857
1409 Ga0495598_0022139
1410 Ga0495621_0010038
1411 Ga0495621_0128723
1412 Ga0495669_0051178
1413 Ga0495669_0130784
1414 Ga0495670_0022765
1415 Ga0496100_0011510
1416 Ga0496100_0204483
1417 Ga0496100_0429164
1418 Ga0496101_0014111
1419 Ga0496101_0035256
1420 Ga0496101_0064789
1421 Ga0496101_0240471
1422 Ga0496101_0246793
1423 Ga0496102_0201143
1424 Ga0496103_0011834
1425 Ga0496104_0328713
1426 Ga0496105_0050658
1427 Ga0496105_0068514
1428 Ga0496105_0110161
1429 Ga0496105_0152531
1430 Ga0496106_0012054
1431 Ga0496106_0267589
1432 Ga0496107_0001820
1433 Ga0496107_0041072
1434 Ga0496107_0064899
1435 Ga0496107_0143913
1436 Ga0496107_0282648
1437 Ga0496108_0010144
1438 Ga0496108_0023116
1439 Ga0496108_0055186
1440 Ga0496108_0077755
1441 Ga0496109_0015364
1442 Ga0496109_0018829
1443 Ga0496109_0030628
1444 Ga0496109_0055037
1445 Ga0496109_0057079
1446 Ga0496109_0216581
1447 Ga0496109_0280483
1448 Ga0496109_0661413
1449 Ga0496110_0001263
1450 Ga0496110_0050884
1451 Ga0496110_0066943
1452 Ga0496110_0071446
1453 Ga0496111_0000602
1454 Ga0496111_0004038
1455 Ga0496111_0018983
1456 Ga0496111_0028402
1457 Ga0496112_0002535
1458 Ga0496112_0015813
1459 Ga0496112_0053175
1460 Ga0496112_0055729
1461 Ga0496112_0191265
1462 Ga0496112_1232561
1463 Ga0496113_0005632
1464 Ga0496113_0012025
1465 Ga0496113_0099402
1466 Ga0496113_0170479
1467 Ga0496113_0204477
1468 Ga0501209_029801
1469 Ga0501224_023795
1470 Ga0587078_025130
1471 Ga0466962_0036827
1472 Ga0466962_0120911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q2d-assembly1.cif.gz_A crystal structure of the e. coli pqic lipoprotein residues 17-187 0.8254 58 200
6gf7-assembly1.cif.gz_B molecular basis of egg coat filament cross-linking: zn-sad structure of the partially deglycosylated zp1 zp-n1 domain homodimer 0.8147 143 172
2iqi-assembly6.cif.gz_F crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 0.7994 33 202
6osx-assembly1.cif.gz_A crystal structure of uncharacterized protein ecl_02694 0.7743 31 203
2iqi-assembly8.cif.gz_H crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 0.7707 32 202
ID Description Score Start End Superfamily
af_Q7Z442_1985_2401_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8104 138 171 1.10.287.70
af_Q925U0_26_137_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.7872 143 176 2.60.40.3210
2iqiH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.7707 32 202 3.40.50.10610
af_X2JI61_169_596_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7667 138 170 1.10.287.70
af_X1WBN4_112_326_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.7611 144 171 2.60.40.1730
ID Description Score Start End GO Terms
AF-A0A7H0GAF2-F1-model_v4 deleted 0.9389 59 200
AF-A0A520HEK5-F1-model_v4 ABC transporter 0.9066 76 199
AF-A0A7H0GAF2-F1-model_v4 deleted 0.9021 59 200
AF-A0A7H0G1U1-F1-model_v4 deleted 0.9005 24 199
AF-A0A520HEK5-F1-model_v4 ABC transporter 0.8862 76 199

Map