F478182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 207 | 735 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100048939|Ga0070714_1000489394 |
| Length | 387 |
| Sequence | VRGFTRALTLASLALLAACATKPVTQRVAPLPTPGAVVPTTARNAVEAGIKVDQPHVLGADEAGRALAAFRASCPALNARKDTSGLTQAGDWRSLCAQAAVLDPAFAPGFFYYDFDWVRVGDGRAFATGYYEPEIAGSRTPQPGYVPIYRVPPDLVRCTKPDGTTGRGRIDETGTCVLYYTRGEIDQGALNGKGLEIAWAKDPVELFFAEIQGSALVRFDDGSVMQIGYAGQNGRDYVAIGRLLRDRGILPPGGANMQTIKDWIRANPEQGQELMRENLSYVFFKEIPGSGPLGSLGVSITPHTTVAADPNFVPLGAPIYLHDADRKEVDGPWVAQDVGGAIKGPNRFDTYWGAGPEAVAIAGGMSASGDALILLPKGVAARALPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 168 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 169 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 170 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 205 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.99 |
| Rhizosphere | 93.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000380 | 3300001990 | Bacteria | 15123 |
| 2 | JGI24737J22298_10000450 | 3300001990 | Bacteria | 14136 |
| 3 | JGI24737J22298_10005651 | 3300001990 | Bacteria | 4305 |
| 4 | JGI24738J21930_10000111 | 3300002075 | Bacteria | 19088 |
| 5 | Ga0070658_10000950 | 3300005327 | Bacteria | 24773 |
| 6 | Ga0070658_10004834 | 3300005327 | Bacteria | 10977 |
| 7 | Ga0070658_10008348 | 3300005327 | Bacteria | 8330 |
| 8 | Ga0070658_10086254 | 3300005327 | Bacteria | 2582 |
| 9 | Ga0070658_10193367 | 3300005327 | Bacteria | 1715 |
| 10 | Ga0070658_10219493 | 3300005327 | Bacteria | 1607 |
| 11 | Ga0070658_10255510 | 3300005327 | Bacteria | 1487 |
| 12 | Ga0070658_10331020 | 3300005327 | Bacteria | 1301 |
| 13 | Ga0070676_10010940 | 3300005328 | Bacteria | 4930 |
| 14 | Ga0070683_100001317 | 3300005329 | Bacteria | 18886 |
| 15 | Ga0070683_100002246 | 3300005329 | Bacteria | 15318 |
| 16 | Ga0070690_100001325 | 3300005330 | Bacteria | 12882 |
| 17 | Ga0070690_100005407 | 3300005330 | Bacteria | 7171 |
| 18 | Ga0070690_100064445 | 3300005330 | Bacteria | 2367 |
| 19 | Ga0070670_100027284 | 3300005331 | Bacteria | 4912 |
| 20 | Ga0070670_100028402 | 3300005331 | Bacteria | 4814 |
| 21 | Ga0070670_100038464 | 3300005331 | Bacteria | 4114 |
| 22 | Ga0070677_10000999 | 3300005333 | Bacteria | 9157 |
| 23 | Ga0068869_100062579 | 3300005334 | Bacteria | 2732 |
| 24 | Ga0068869_100089202 | 3300005334 | Bacteria | 2315 |
| 25 | Ga0070666_10000451 | 3300005335 | Bacteria | 24994 |
| 26 | Ga0070666_10001909 | 3300005335 | Bacteria | 12666 |
| 27 | Ga0070666_10005798 | 3300005335 | Bacteria | 7590 |
| 28 | Ga0070666_10007600 | 3300005335 | Bacteria | 6686 |
| 29 | Ga0070666_10029477 | 3300005335 | Bacteria | 3608 |
| 30 | Ga0070666_10043591 | 3300005335 | Bacteria | 3004 |
| 31 | Ga0070680_100004263 | 3300005336 | Bacteria | 10737 |
| 32 | Ga0070682_100004206 | 3300005337 | Bacteria | 7987 |
| 33 | Ga0068868_100007475 | 3300005338 | Bacteria | 7782 |
| 34 | Ga0068868_100017471 | 3300005338 | Bacteria | 5346 |
| 35 | Ga0068868_100029630 | 3300005338 | Bacteria | 4192 |
| 36 | Ga0070660_100000260 | 3300005339 | Bacteria | 34947 |
| 37 | Ga0070660_100006513 | 3300005339 | Bacteria | 8099 |
| 38 | Ga0070660_100017486 | 3300005339 | Bacteria | 5228 |
| 39 | Ga0070660_100022082 | 3300005339 | Bacteria | 4702 |
| 40 | Ga0070660_100187038 | 3300005339 | Bacteria | 1677 |
| 41 | Ga0070691_10005847 | 3300005341 | Bacteria | 5611 |
| 42 | Ga0070661_100000246 | 3300005344 | Bacteria | 44536 |
| 43 | Ga0070661_100026287 | 3300005344 | Bacteria | 4185 |
| 44 | Ga0070661_100027296 | 3300005344 | Bacteria | 4109 |
| 45 | Ga0070661_100095311 | 3300005344 | Bacteria | 2207 |
| 46 | Ga0070661_100149375 | 3300005344 | Bacteria | 1765 |
| 47 | Ga0070661_100211041 | 3300005344 | Bacteria | 1486 |
| 48 | Ga0070668_100154036 | 3300005347 | Bacteria | 1861 |
| 49 | Ga0070669_100101424 | 3300005353 | Bacteria | 2172 |
| 50 | Ga0070675_100004653 | 3300005354 | Bacteria | 10479 |
| 51 | Ga0070675_100026701 | 3300005354 | Bacteria | 4634 |
| 52 | Ga0070675_100049464 | 3300005354 | Bacteria | 3450 |
| 53 | Ga0070671_100004406 | 3300005355 | Bacteria | 11129 |
| 54 | Ga0070671_100004514 | 3300005355 | Bacteria | 11016 |
| 55 | Ga0070671_100004935 | 3300005355 | Bacteria | 10611 |
| 56 | Ga0070671_100011508 | 3300005355 | Bacteria | 7113 |
| 57 | Ga0070671_100014729 | 3300005355 | Bacteria | 6321 |
| 58 | Ga0070671_100039305 | 3300005355 | Bacteria | 3928 |
| 59 | Ga0070671_100058126 | 3300005355 | Bacteria | 3219 |
| 60 | Ga0070671_100065621 | 3300005355 | Bacteria | 3024 |
| 61 | Ga0070671_100112215 | 3300005355 | Bacteria | 2290 |
| 62 | Ga0070674_100002641 | 3300005356 | Bacteria | 9913 |
| 63 | Ga0070674_100011545 | 3300005356 | Bacteria | 5384 |
| 64 | Ga0070673_100007637 | 3300005364 | Bacteria | 7155 |
| 65 | Ga0070673_100056512 | 3300005364 | Bacteria | 3097 |
| 66 | Ga0070673_100065813 | 3300005364 | Bacteria | 2893 |
| 67 | Ga0070673_100130371 | 3300005364 | Bacteria | 2108 |
| 68 | Ga0070673_100283432 | 3300005364 | Bacteria | 1454 |
| 69 | Ga0070659_100000195 | 3300005366 | Bacteria | 46642 |
| 70 | Ga0070659_100001058 | 3300005366 | Bacteria | 20125 |
| 71 | Ga0070659_100004420 | 3300005366 | Bacteria | 10039 |
| 72 | Ga0070659_100011181 | 3300005366 | Bacteria | 6633 |
| 73 | Ga0070659_100094138 | 3300005366 | Bacteria | 2405 |
| 74 | Ga0070659_100138708 | 3300005366 | Bacteria | 1979 |
| 75 | Ga0070659_100146749 | 3300005366 | Bacteria | 1922 |
| 76 | Ga0070667_100003455 | 3300005367 | Bacteria | 13460 |
| 77 | Ga0070667_100004244 | 3300005367 | Bacteria | 12102 |
| 78 | Ga0070667_100007636 | 3300005367 | Bacteria | 8971 |
| 79 | Ga0070667_100015921 | 3300005367 | Bacteria | 6222 |
| 80 | Ga0070667_100016732 | 3300005367 | Bacteria | 6070 |
| 81 | Ga0070667_100211125 | 3300005367 | Unclassified | 1725 |
| 82 | Ga0070714_100047178 | 3300005435 | Bacteria | 3658 |
| 83 | Ga0070714_100048939 | 3300005435 | Bacteria | 3597 |
| 84 | Ga0070713_100017293 | 3300005436 | Bacteria | 5449 |
| 85 | Ga0070713_100076786 | 3300005436 | Bacteria | 2838 |
| 86 | Ga0070713_100097020 | 3300005436 | Bacteria | 2546 |
| 87 | Ga0070694_100060286 | 3300005444 | Bacteria | 2587 |
| 88 | Ga0070663_100006460 | 3300005455 | Bacteria | 7055 |
| 89 | Ga0070663_100018346 | 3300005455 | Bacteria | 4586 |
| 90 | Ga0070663_100028142 | 3300005455 | Bacteria | 3823 |
| 91 | Ga0070663_100032667 | 3300005455 | Bacteria | 3589 |
| 92 | Ga0070663_100158174 | 3300005455 | Bacteria | 1743 |
| 93 | Ga0070678_100001087 | 3300005456 | Bacteria | 14237 |
| 94 | Ga0070678_100005149 | 3300005456 | Bacteria | 7513 |
| 95 | Ga0070678_100029442 | 3300005456 | Bacteria | 3759 |
| 96 | Ga0070678_100031765 | 3300005456 | Bacteria | 3647 |
| 97 | Ga0070678_100137975 | 3300005456 | Bacteria | 1947 |
| 98 | Ga0070662_100000047 | 3300005457 | Bacteria | 66967 |
| 99 | Ga0070662_100002537 | 3300005457 | Bacteria | 11260 |
| 100 | Ga0070662_100008482 | 3300005457 | Bacteria | 6706 |
| 101 | Ga0070662_100010844 | 3300005457 | Bacteria | 6001 |
| 102 | Ga0070662_100139834 | 3300005457 | Unclassified | 1875 |
| 103 | Ga0070662_100169339 | 3300005457 | Bacteria | 1714 |
| 104 | Ga0070681_10063843 | 3300005458 | Bacteria | 3655 |
| 105 | Ga0070681_10113333 | 3300005458 | Bacteria | 2651 |
| 106 | Ga0068867_100031841 | 3300005459 | Bacteria | 3810 |
| 107 | Ga0070684_100009105 | 3300005535 | Bacteria | 7807 |
| 108 | Ga0068853_100000033 | 3300005539 | Bacteria | 113700 |
| 109 | Ga0068853_100052656 | 3300005539 | Bacteria | 3505 |
| 110 | Ga0068853_100060015 | 3300005539 | Bacteria | 3285 |
| 111 | Ga0068853_100072022 | 3300005539 | Bacteria | 3011 |
| 112 | Ga0068853_100239193 | 3300005539 | Bacteria | 1663 |
| 113 | Ga0070672_100002154 | 3300005543 | Bacteria | 12429 |
| 114 | Ga0070672_100003490 | 3300005543 | Bacteria | 10188 |
| 115 | Ga0070672_100041357 | 3300005543 | Bacteria | 3543 |
| 116 | Ga0070672_100166404 | 3300005543 | Bacteria | 1832 |
| 117 | Ga0070672_100209281 | 3300005543 | Bacteria | 1633 |
| 118 | Ga0070686_100002623 | 3300005544 | Bacteria | 9916 |
| 119 | Ga0070693_100011462 | 3300005547 | Bacteria | 4466 |
| 120 | Ga0070665_100011256 | 3300005548 | Bacteria | 9048 |
| 121 | Ga0070665_100012043 | 3300005548 | Bacteria | 8724 |
| 122 | Ga0070665_100039523 | 3300005548 | Bacteria | 4743 |
| 123 | Ga0070704_100226972 | 3300005549 | Bacteria | 1521 |
| 124 | Ga0068855_100000531 | 3300005563 | Bacteria | 46681 |
| 125 | Ga0068855_100035354 | 3300005563 | Bacteria | 5952 |
| 126 | Ga0068855_100160182 | 3300005563 | Bacteria | 2555 |
| 127 | Ga0068855_100283969 | 3300005563 | Bacteria | 1837 |
| 128 | Ga0070664_100000242 | 3300005564 | Bacteria | 39241 |
| 129 | Ga0070664_100002634 | 3300005564 | Bacteria | 14470 |
| 130 | Ga0070664_100012535 | 3300005564 | Bacteria | 6896 |
| 131 | Ga0070664_100014968 | 3300005564 | Bacteria | 6330 |
| 132 | Ga0070664_100022958 | 3300005564 | Bacteria | 5147 |
| 133 | Ga0070664_100047963 | 3300005564 | Bacteria | 3610 |
| 134 | Ga0070664_100088858 | 3300005564 | Bacteria | 2672 |
| 135 | Ga0070664_100283695 | 3300005564 | Bacteria | 1494 |
| 136 | Ga0068857_100008864 | 3300005577 | Bacteria | 8714 |
| 137 | Ga0068857_100009098 | 3300005577 | Bacteria | 8617 |
| 138 | Ga0068857_100045474 | 3300005577 | Bacteria | 3895 |
| 139 | Ga0068857_100097814 | 3300005577 | Bacteria | 2632 |
| 140 | Ga0068857_100292367 | 3300005577 | Bacteria | 1500 |
| 141 | Ga0068854_100031056 | 3300005578 | Bacteria | 3710 |
| 142 | Ga0068854_100041012 | 3300005578 | Bacteria | 3269 |
| 143 | Ga0068854_100083449 | 3300005578 | Bacteria | 2363 |
| 144 | Ga0068854_100126169 | 3300005578 | Bacteria | 1949 |
| 145 | Ga0068854_100140556 | 3300005578 | Bacteria | 1852 |
| 146 | Ga0068856_100000162 | 3300005614 | Bacteria | 69640 |
| 147 | Ga0068856_100050939 | 3300005614 | Bacteria | 4082 |
| 148 | Ga0068856_100066587 | 3300005614 | Bacteria | 3559 |
| 149 | Ga0068852_100002549 | 3300005616 | Bacteria | 12555 |
| 150 | Ga0068852_100010717 | 3300005616 | Bacteria | 6864 |
| 151 | Ga0068852_100013293 | 3300005616 | Bacteria | 6297 |
| 152 | Ga0068852_100024314 | 3300005616 | Bacteria | 4894 |
| 153 | Ga0068852_100050120 | 3300005616 | Bacteria | 3576 |
| 154 | Ga0068852_100073146 | 3300005616 | Bacteria | 3015 |
| 155 | Ga0068852_100083964 | 3300005616 | Bacteria | 2833 |
| 156 | Ga0068859_100061949 | 3300005617 | Bacteria | 3770 |
| 157 | Ga0068859_100063134 | 3300005617 | Bacteria | 3735 |
| 158 | Ga0068859_100067894 | 3300005617 | Bacteria | 3601 |
| 159 | Ga0068859_100088327 | 3300005617 | Bacteria | 3149 |
| 160 | Ga0068859_100275797 | 3300005617 | Bacteria | 1774 |
| 161 | Ga0068864_100001290 | 3300005618 | Bacteria | 20864 |
| 162 | Ga0068864_100004851 | 3300005618 | Bacteria | 11014 |
| 163 | Ga0068864_100005693 | 3300005618 | Bacteria | 10216 |
| 164 | Ga0068864_100012661 | 3300005618 | Bacteria | 6975 |
| 165 | Ga0068864_100013936 | 3300005618 | Bacteria | 6663 |
| 166 | Ga0068864_100103308 | 3300005618 | Bacteria | 2530 |
| 167 | Ga0068864_100162974 | 3300005618 | Bacteria | 2028 |
| 168 | Ga0068866_10002827 | 3300005718 | Bacteria | 7155 |
| 169 | Ga0068861_100004768 | 3300005719 | Bacteria | 9116 |
| 170 | Ga0068851_10023139 | 3300005834 | Bacteria | 3034 |
| 171 | Ga0068851_10024179 | 3300005834 | Bacteria | 2973 |
| 172 | Ga0068863_100006129 | 3300005841 | Bacteria | 11792 |
| 173 | Ga0068863_100020055 | 3300005841 | Bacteria | 6395 |
| 174 | Ga0068863_100032850 | 3300005841 | Bacteria | 4944 |
| 175 | Ga0068863_100082035 | 3300005841 | Bacteria | 3055 |
| 176 | Ga0068863_100187812 | 3300005841 | Bacteria | 1985 |
| 177 | Ga0068858_100008141 | 3300005842 | Bacteria | 10078 |
| 178 | Ga0068858_100014242 | 3300005842 | Bacteria | 7498 |
| 179 | Ga0068858_100029353 | 3300005842 | Bacteria | 5106 |
| 180 | Ga0068858_100051595 | 3300005842 | Bacteria | 3805 |
| 181 | Ga0068858_100115449 | 3300005842 | Bacteria | 2509 |
| 182 | Ga0068858_100156202 | 3300005842 | Bacteria | 2146 |
| 183 | Ga0068860_100019113 | 3300005843 | Bacteria | 6653 |
| 184 | Ga0068860_100088338 | 3300005843 | Bacteria | 2951 |
| 185 | Ga0068860_100211198 | 3300005843 | Bacteria | 1883 |
| 186 | Ga0068862_100005443 | 3300005844 | Bacteria | 10639 |
| 187 | Ga0068862_100009248 | 3300005844 | Bacteria | 8159 |
| 188 | Ga0068862_100105117 | 3300005844 | Bacteria | 2474 |
| 189 | Ga0081539_10016891 | 3300005985 | Bacteria | 5173 |
| 190 | Ga0081539_10041191 | 3300005985 | Bacteria | 2702 |
| 191 | Ga0070717_10024236 | 3300006028 | Bacteria | 4816 |
| 192 | Ga0097621_100254467 | 3300006237 | Bacteria | 1539 |
| 193 | Ga0068871_100010640 | 3300006358 | Bacteria | 6724 |
| 194 | Ga0068871_100020356 | 3300006358 | Bacteria | 5081 |
| 195 | Ga0075428_100078249 | 3300006844 | Bacteria | 3610 |
| 196 | Ga0075431_100033856 | 3300006847 | Bacteria | 5265 |
| 197 | Ga0097620_100061945 | 3300006931 | Bacteria | 3770 |
| 198 | Ga0097620_100063133 | 3300006931 | Bacteria | 3735 |
| 199 | Ga0097620_100067896 | 3300006931 | Bacteria | 3601 |
| 200 | Ga0097620_100088321 | 3300006931 | Bacteria | 3149 |
| 201 | Ga0097620_100275812 | 3300006931 | Bacteria | 1774 |
| 202 | Ga0105251_10047806 | 3300009011 | Bacteria | 2054 |
| 203 | Ga0105240_10047741 | 3300009093 | Bacteria | 5416 |
| 204 | Ga0105240_10078388 | 3300009093 | Bacteria | 4068 |
| 205 | Ga0111539_10031153 | 3300009094 | Bacteria | 6481 |
| 206 | Ga0111539_10213844 | 3300009094 | Bacteria | 2246 |
| 207 | Ga0105247_10264193 | 3300009101 | Bacteria | 1181 |
| 208 | Ga0105243_10238459 | 3300009148 | Bacteria | 1617 |
| 209 | Ga0105243_10298768 | 3300009148 | Bacteria | 1458 |
| 210 | Ga0105241_10291951 | 3300009174 | Bacteria | 1396 |
| 211 | Ga0105242_10000993 | 3300009176 | Bacteria | 22209 |
| 212 | Ga0105248_10004029 | 3300009177 | Bacteria | 16252 |
| 213 | Ga0105248_10004871 | 3300009177 | Bacteria | 14855 |
| 214 | Ga0105248_10013832 | 3300009177 | Bacteria | 8878 |
| 215 | Ga0105248_10013847 | 3300009177 | Bacteria | 8873 |
| 216 | Ga0105248_10013976 | 3300009177 | Bacteria | 8832 |
| 217 | Ga0105248_10081096 | 3300009177 | Bacteria | 3647 |
| 218 | Ga0105248_10098492 | 3300009177 | Bacteria | 3294 |
| 219 | Ga0105248_10100198 | 3300009177 | Bacteria | 3264 |
| 220 | Ga0105248_10271859 | 3300009177 | Bacteria | 1908 |
| 221 | Ga0105248_10725781 | 3300009177 | Bacteria | 1121 |
| 222 | Ga0105237_10072879 | 3300009545 | Bacteria | 3427 |
| 223 | Ga0105237_10166447 | 3300009545 | Bacteria | 2204 |
| 224 | Ga0105238_10007506 | 3300009551 | Bacteria | 10924 |
| 225 | Ga0105238_10014359 | 3300009551 | Bacteria | 8006 |
| 226 | Ga0105249_10010129 | 3300009553 | Bacteria | 8276 |
| 227 | Ga0105249_10193504 | 3300009553 | Bacteria | 1986 |
| 228 | Ga0105246_10018923 | 3300011119 | Bacteria | 4393 |
| 229 | Ga0157373_10202143 | 3300013100 | Bacteria | 1401 |
| 230 | Ga0157371_10043367 | 3300013102 | Bacteria | 3204 |
| 231 | Ga0157371_10044544 | 3300013102 | Bacteria | 3159 |
| 232 | Ga0157371_10086739 | 3300013102 | Bacteria | 2217 |
| 233 | Ga0157371_10169779 | 3300013102 | Bacteria | 1558 |
| 234 | Ga0157370_10002976 | 3300013104 | Bacteria | 20144 |
| 235 | Ga0157370_10004977 | 3300013104 | Bacteria | 15039 |
| 236 | Ga0157370_10011611 | 3300013104 | Bacteria | 9195 |
| 237 | Ga0157370_10017359 | 3300013104 | Bacteria | 7264 |
| 238 | Ga0157370_10018643 | 3300013104 | Bacteria | 6977 |
| 239 | Ga0157369_10011956 | 3300013105 | Bacteria | 9859 |
| 240 | Ga0157369_10029017 | 3300013105 | Bacteria | 6118 |
| 241 | Ga0157369_10058498 | 3300013105 | Bacteria | 4158 |
| 242 | Ga0157369_10097381 | 3300013105 | Bacteria | 3138 |
| 243 | Ga0157369_10502382 | 3300013105 | Bacteria | 1254 |
| 244 | Ga0157374_10054329 | 3300013296 | Bacteria | 3736 |
| 245 | Ga0157374_10056936 | 3300013296 | Bacteria | 3651 |
| 246 | Ga0157374_10072681 | 3300013296 | Bacteria | 3245 |
| 247 | Ga0157374_10126159 | 3300013296 | Bacteria | 2474 |
| 248 | Ga0157378_10010569 | 3300013297 | Bacteria | 8068 |
| 249 | Ga0163162_10040346 | 3300013306 | Bacteria | 4668 |
| 250 | Ga0163162_10137775 | 3300013306 | Bacteria | 2552 |
| 251 | Ga0163162_10217821 | 3300013306 | Bacteria | 2039 |
| 252 | Ga0157372_10034037 | 3300013307 | Bacteria | 5598 |
| 253 | Ga0157372_10137932 | 3300013307 | Bacteria | 2810 |
| 254 | Ga0157375_10008191 | 3300013308 | Bacteria | 9153 |
| 255 | Ga0157375_10024631 | 3300013308 | Bacteria | 5574 |
| 256 | Ga0163163_10014997 | 3300014325 | Bacteria | 7143 |
| 257 | Ga0163163_10021539 | 3300014325 | Bacteria | 6086 |
| 258 | Ga0163163_10023776 | 3300014325 | Bacteria | 5822 |
| 259 | Ga0157380_10001263 | 3300014326 | Bacteria | 16409 |
| 260 | Ga0157380_10005051 | 3300014326 | Bacteria | 9205 |
| 261 | Ga0157380_10257164 | 3300014326 | Bacteria | 1584 |
| 262 | Ga0157379_10023074 | 3300014968 | Bacteria | 5517 |
| 263 | Ga0157379_10056703 | 3300014968 | Bacteria | 3500 |
| 264 | Ga0157376_10002890 | 3300014969 | Bacteria | 11773 |
| 265 | Ga0163161_10017298 | 3300017792 | Bacteria | 5044 |
| 266 | Ga0163161_10034360 | 3300017792 | Bacteria | 3627 |
| 267 | Ga0197907_10556007 | 3300020069 | Bacteria | 2478 |
| 268 | Ga0206356_11135239 | 3300020070 | Bacteria | 2059 |
| 269 | Ga0213875_10011468 | 3300021388 | Bacteria | 4407 |
| 270 | Ga0207697_10005052 | 3300025315 | Bacteria | 6180 |
| 271 | Ga0207656_10016728 | 3300025321 | Bacteria | 2859 |
| 272 | Ga0207656_10040839 | 3300025321 | Bacteria | 1968 |
| 273 | Ga0207682_10001693 | 3300025893 | Bacteria | 10102 |
| 274 | Ga0207688_10003267 | 3300025901 | Bacteria | 8855 |
| 275 | Ga0207688_10079099 | 3300025901 | Bacteria | 1875 |
| 276 | Ga0207680_10000681 | 3300025903 | Bacteria | 16056 |
| 277 | Ga0207680_10001102 | 3300025903 | Bacteria | 12737 |
| 278 | Ga0207680_10013048 | 3300025903 | Bacteria | 4253 |
| 279 | Ga0207680_10018349 | 3300025903 | Bacteria | 3717 |
| 280 | Ga0207680_10023816 | 3300025903 | Bacteria | 3350 |
| 281 | Ga0207680_10170749 | 3300025903 | Bacteria | 1465 |
| 282 | Ga0207647_10012589 | 3300025904 | Bacteria | 5883 |
| 283 | Ga0207645_10011685 | 3300025907 | Bacteria | 5986 |
| 284 | Ga0207645_10026481 | 3300025907 | Bacteria | 3746 |
| 285 | Ga0207645_10029423 | 3300025907 | Bacteria | 3542 |
| 286 | Ga0207645_10057981 | 3300025907 | Bacteria | 2472 |
| 287 | Ga0207645_10071189 | 3300025907 | Bacteria | 2225 |
| 288 | Ga0207645_10074680 | 3300025907 | Bacteria | 2170 |
| 289 | Ga0207705_10000062 | 3300025909 | Bacteria | 149432 |
| 290 | Ga0207705_10006023 | 3300025909 | Bacteria | 9020 |
| 291 | Ga0207705_10011342 | 3300025909 | Bacteria | 6454 |
| 292 | Ga0207705_10025698 | 3300025909 | Bacteria | 4201 |
| 293 | Ga0207705_10035958 | 3300025909 | Bacteria | 3545 |
| 294 | Ga0207705_10039435 | 3300025909 | Bacteria | 3385 |
| 295 | Ga0207705_10076232 | 3300025909 | Bacteria | 2437 |
| 296 | Ga0207705_10192486 | 3300025909 | Bacteria | 1543 |
| 297 | Ga0207707_10025005 | 3300025912 | Bacteria | 5225 |
| 298 | Ga0207660_10015525 | 3300025917 | Bacteria | 5028 |
| 299 | Ga0207660_10039636 | 3300025917 | Bacteria | 3294 |
| 300 | Ga0207657_10000403 | 3300025919 | Bacteria | 45863 |
| 301 | Ga0207657_10001024 | 3300025919 | Bacteria | 29655 |
| 302 | Ga0207657_10002291 | 3300025919 | Bacteria | 20732 |
| 303 | Ga0207657_10002900 | 3300025919 | Bacteria | 18411 |
| 304 | Ga0207657_10006293 | 3300025919 | Bacteria | 12337 |
| 305 | Ga0207657_10011918 | 3300025919 | Bacteria | 8603 |
| 306 | Ga0207657_10014704 | 3300025919 | Bacteria | 7622 |
| 307 | Ga0207657_10015026 | 3300025919 | Bacteria | 7518 |
| 308 | Ga0207657_10022931 | 3300025919 | Bacteria | 5825 |
| 309 | Ga0207657_10027580 | 3300025919 | Bacteria | 5200 |
| 310 | Ga0207657_10033062 | 3300025919 | Bacteria | 4666 |
| 311 | Ga0207657_10042043 | 3300025919 | Bacteria | 4036 |
| 312 | Ga0207657_10049387 | 3300025919 | Bacteria | 3666 |
| 313 | Ga0207649_10000230 | 3300025920 | Bacteria | 45560 |
| 314 | Ga0207649_10007546 | 3300025920 | Bacteria | 5913 |
| 315 | Ga0207649_10018682 | 3300025920 | Bacteria | 3948 |
| 316 | Ga0207649_10025315 | 3300025920 | Bacteria | 3458 |
| 317 | Ga0207652_10007390 | 3300025921 | Bacteria | 8857 |
| 318 | Ga0207652_10061785 | 3300025921 | Bacteria | 3236 |
| 319 | Ga0207652_10221817 | 3300025921 | Bacteria | 1704 |
| 320 | Ga0207694_10008340 | 3300025924 | Bacteria | 7834 |
| 321 | Ga0207650_10003054 | 3300025925 | Bacteria | 11531 |
| 322 | Ga0207650_10003838 | 3300025925 | Bacteria | 10272 |
| 323 | Ga0207650_10203172 | 3300025925 | Bacteria | 1588 |
| 324 | Ga0207650_10279417 | 3300025925 | Bacteria | 1359 |
| 325 | Ga0207659_10019935 | 3300025926 | Bacteria | 4424 |
| 326 | Ga0207659_10315937 | 3300025926 | Bacteria | 1287 |
| 327 | Ga0207700_10013879 | 3300025928 | Bacteria | 5261 |
| 328 | Ga0207700_10058519 | 3300025928 | Bacteria | 2911 |
| 329 | Ga0207664_10021302 | 3300025929 | Bacteria | 4817 |
| 330 | Ga0207664_10024314 | 3300025929 | Bacteria | 4552 |
| 331 | Ga0207664_10041131 | 3300025929 | Bacteria | 3600 |
| 332 | Ga0207664_10136390 | 3300025929 | Bacteria | 2071 |
| 333 | Ga0207644_10000695 | 3300025931 | Bacteria | 21288 |
| 334 | Ga0207644_10001502 | 3300025931 | Bacteria | 15032 |
| 335 | Ga0207644_10003518 | 3300025931 | Bacteria | 10140 |
| 336 | Ga0207644_10004832 | 3300025931 | Bacteria | 8771 |
| 337 | Ga0207644_10018366 | 3300025931 | Bacteria | 4730 |
| 338 | Ga0207644_10020310 | 3300025931 | Bacteria | 4516 |
| 339 | Ga0207644_10022968 | 3300025931 | Bacteria | 4266 |
| 340 | Ga0207644_10030225 | 3300025931 | Bacteria | 3765 |
| 341 | Ga0207690_10000155 | 3300025932 | Bacteria | 53735 |
| 342 | Ga0207690_10001173 | 3300025932 | Bacteria | 16570 |
| 343 | Ga0207690_10008367 | 3300025932 | Bacteria | 6141 |
| 344 | Ga0207690_10031693 | 3300025932 | Bacteria | 3385 |
| 345 | Ga0207690_10065964 | 3300025932 | Bacteria | 2477 |
| 346 | Ga0207690_10076812 | 3300025932 | Bacteria | 2320 |
| 347 | Ga0207690_10107897 | 3300025932 | Bacteria | 2000 |
| 348 | Ga0207690_10152858 | 3300025932 | Bacteria | 1712 |
| 349 | Ga0207706_10000342 | 3300025933 | Bacteria | 50517 |
| 350 | Ga0207706_10000434 | 3300025933 | Bacteria | 44818 |
| 351 | Ga0207706_10004157 | 3300025933 | Bacteria | 13642 |
| 352 | Ga0207706_10007033 | 3300025933 | Bacteria | 10403 |
| 353 | Ga0207706_10007778 | 3300025933 | Bacteria | 9895 |
| 354 | Ga0207706_10009816 | 3300025933 | Bacteria | 8782 |
| 355 | Ga0207706_10020906 | 3300025933 | Bacteria | 5876 |
| 356 | Ga0207706_10031673 | 3300025933 | Bacteria | 4709 |
| 357 | Ga0207706_10035989 | 3300025933 | Bacteria | 4399 |
| 358 | Ga0207706_10106492 | 3300025933 | Bacteria | 2467 |
| 359 | Ga0207706_10228078 | 3300025933 | Bacteria | 1630 |
| 360 | Ga0207706_10282834 | 3300025933 | Bacteria | 1446 |
| 361 | Ga0207686_10033458 | 3300025934 | Bacteria | 3069 |
| 362 | Ga0207669_10004765 | 3300025937 | Bacteria | 6012 |
| 363 | Ga0207669_10008574 | 3300025937 | Bacteria | 4808 |
| 364 | Ga0207669_10014453 | 3300025937 | Bacteria | 3956 |
| 365 | Ga0207669_10027204 | 3300025937 | Bacteria | 3127 |
| 366 | Ga0207669_10054465 | 3300025937 | Bacteria | 2416 |
| 367 | Ga0207704_10042159 | 3300025938 | Bacteria | 2684 |
| 368 | Ga0207691_10000852 | 3300025940 | Bacteria | 30260 |
| 369 | Ga0207691_10001147 | 3300025940 | Bacteria | 26294 |
| 370 | Ga0207691_10001370 | 3300025940 | Bacteria | 24300 |
| 371 | Ga0207691_10052542 | 3300025940 | Bacteria | 3721 |
| 372 | Ga0207691_10072249 | 3300025940 | Bacteria | 3112 |
| 373 | Ga0207691_10078368 | 3300025940 | Bacteria | 2975 |
| 374 | Ga0207691_10093178 | 3300025940 | Bacteria | 2698 |
| 375 | Ga0207691_10159858 | 3300025940 | Bacteria | 1977 |
| 376 | Ga0207691_10208012 | 3300025940 | Bacteria | 1701 |
| 377 | Ga0207691_10355062 | 3300025940 | Bacteria | 1254 |
| 378 | Ga0207711_10003628 | 3300025941 | Bacteria | 13348 |
| 379 | Ga0207711_10003771 | 3300025941 | Bacteria | 13052 |
| 380 | Ga0207711_10003910 | 3300025941 | Bacteria | 12816 |
| 381 | Ga0207711_10003912 | 3300025941 | Bacteria | 12815 |
| 382 | Ga0207711_10004265 | 3300025941 | Bacteria | 12216 |
| 383 | Ga0207711_10017606 | 3300025941 | Bacteria | 5935 |
| 384 | Ga0207711_10022793 | 3300025941 | Bacteria | 5239 |
| 385 | Ga0207711_10025078 | 3300025941 | Bacteria | 5002 |
| 386 | Ga0207711_10037257 | 3300025941 | Bacteria | 4130 |
| 387 | Ga0207711_10037884 | 3300025941 | Bacteria | 4098 |
| 388 | Ga0207711_10127572 | 3300025941 | Bacteria | 2277 |
| 389 | Ga0207689_10010558 | 3300025942 | Bacteria | 7951 |
| 390 | Ga0207689_10030990 | 3300025942 | Bacteria | 4455 |
| 391 | Ga0207661_10022219 | 3300025944 | Bacteria | 4772 |
| 392 | Ga0207661_10047354 | 3300025944 | Bacteria | 3412 |
| 393 | Ga0207679_10000213 | 3300025945 | Bacteria | 45916 |
| 394 | Ga0207679_10026680 | 3300025945 | Bacteria | 3986 |
| 395 | Ga0207679_10029532 | 3300025945 | Bacteria | 3818 |
| 396 | Ga0207679_10055859 | 3300025945 | Bacteria | 2913 |
| 397 | Ga0207679_10113614 | 3300025945 | Bacteria | 2142 |
| 398 | Ga0207667_10001300 | 3300025949 | Bacteria | 31316 |
| 399 | Ga0207667_10027212 | 3300025949 | Bacteria | 6230 |
| 400 | Ga0207667_10070189 | 3300025949 | Bacteria | 3646 |
| 401 | Ga0207667_10462385 | 3300025949 | Bacteria | 1289 |
| 402 | Ga0207651_10004940 | 3300025960 | Bacteria | 6806 |
| 403 | Ga0207651_10029871 | 3300025960 | Bacteria | 3461 |
| 404 | Ga0207651_10037678 | 3300025960 | Bacteria | 3170 |
| 405 | Ga0207651_10178164 | 3300025960 | Bacteria | 1683 |
| 406 | Ga0207651_10248492 | 3300025960 | Bacteria | 1454 |
| 407 | Ga0207712_10006581 | 3300025961 | Bacteria | 7332 |
| 408 | Ga0207712_10008327 | 3300025961 | Bacteria | 6555 |
| 409 | Ga0207712_10209462 | 3300025961 | Bacteria | 1551 |
| 410 | Ga0207668_10002049 | 3300025972 | Bacteria | 11759 |
| 411 | Ga0207668_10064739 | 3300025972 | Bacteria | 2585 |
| 412 | Ga0207668_10268168 | 3300025972 | Bacteria | 1394 |
| 413 | Ga0207640_10010153 | 3300025981 | Bacteria | 5294 |
| 414 | Ga0207640_10040461 | 3300025981 | Bacteria | 2957 |
| 415 | Ga0207658_10003315 | 3300025986 | Bacteria | 11429 |
| 416 | Ga0207658_10007346 | 3300025986 | Bacteria | 7510 |
| 417 | Ga0207658_10008048 | 3300025986 | Bacteria | 7182 |
| 418 | Ga0207658_10015299 | 3300025986 | Bacteria | 5263 |
| 419 | Ga0207658_10083280 | 3300025986 | Bacteria | 2458 |
| 420 | Ga0207658_10087172 | 3300025986 | Bacteria | 2410 |
| 421 | Ga0207658_10095860 | 3300025986 | Bacteria | 2312 |
| 422 | Ga0207658_10175899 | 3300025986 | Bacteria | 1767 |
| 423 | Ga0207677_10002552 | 3300026023 | Bacteria | 9562 |
| 424 | Ga0207677_10042672 | 3300026023 | Bacteria | 3009 |
| 425 | Ga0207677_10087902 | 3300026023 | Bacteria | 2252 |
| 426 | Ga0207703_10002473 | 3300026035 | Bacteria | 16026 |
| 427 | Ga0207703_10007329 | 3300026035 | Bacteria | 8769 |
| 428 | Ga0207703_10026010 | 3300026035 | Bacteria | 4606 |
| 429 | Ga0207703_10076991 | 3300026035 | Bacteria | 2768 |
| 430 | Ga0207639_10000347 | 3300026041 | Bacteria | 32007 |
| 431 | Ga0207639_10092037 | 3300026041 | Bacteria | 2429 |
| 432 | Ga0207639_10093431 | 3300026041 | Bacteria | 2412 |
| 433 | Ga0207639_10198791 | 3300026041 | Bacteria | 1718 |
| 434 | Ga0207678_10009957 | 3300026067 | Bacteria | 8340 |
| 435 | Ga0207678_10014935 | 3300026067 | Bacteria | 6832 |
| 436 | Ga0207678_10015700 | 3300026067 | Bacteria | 6655 |
| 437 | Ga0207678_10035314 | 3300026067 | Bacteria | 4353 |
| 438 | Ga0207678_10048157 | 3300026067 | Bacteria | 3684 |
| 439 | Ga0207678_10048351 | 3300026067 | Bacteria | 3677 |
| 440 | Ga0207678_10090664 | 3300026067 | Bacteria | 2613 |
| 441 | Ga0207678_10180317 | 3300026067 | Bacteria | 1804 |
| 442 | Ga0207702_10000496 | 3300026078 | Bacteria | 44248 |
| 443 | Ga0207702_10015606 | 3300026078 | Bacteria | 6287 |
| 444 | Ga0207702_10022763 | 3300026078 | Bacteria | 5198 |
| 445 | Ga0207702_10031699 | 3300026078 | Bacteria | 4407 |
| 446 | Ga0207702_10227644 | 3300026078 | Bacteria | 1741 |
| 447 | Ga0207641_10005331 | 3300026088 | Bacteria | 10984 |
| 448 | Ga0207641_10016993 | 3300026088 | Bacteria | 5956 |
| 449 | Ga0207641_10021361 | 3300026088 | Bacteria | 5320 |
| 450 | Ga0207641_10068451 | 3300026088 | Bacteria | 3044 |
| 451 | Ga0207648_10004524 | 3300026089 | Bacteria | 14251 |
| 452 | Ga0207648_10004762 | 3300026089 | Bacteria | 13858 |
| 453 | Ga0207676_10005936 | 3300026095 | Bacteria | 8618 |
| 454 | Ga0207676_10012995 | 3300026095 | Bacteria | 5978 |
| 455 | Ga0207676_10023746 | 3300026095 | Bacteria | 4529 |
| 456 | Ga0207676_10047469 | 3300026095 | Bacteria | 3328 |
| 457 | Ga0207676_10059590 | 3300026095 | Bacteria | 3015 |
| 458 | Ga0207676_10085957 | 3300026095 | Bacteria | 2568 |
| 459 | Ga0207676_10086094 | 3300026095 | Bacteria | 2566 |
| 460 | Ga0207676_10292296 | 3300026095 | Bacteria | 1484 |
| 461 | Ga0207676_10313384 | 3300026095 | Bacteria | 1437 |
| 462 | Ga0207674_10000291 | 3300026116 | Bacteria | 63446 |
| 463 | Ga0207674_10000527 | 3300026116 | Bacteria | 50282 |
| 464 | Ga0207674_10000580 | 3300026116 | Bacteria | 48154 |
| 465 | Ga0207674_10004077 | 3300026116 | Bacteria | 17703 |
| 466 | Ga0207674_10016922 | 3300026116 | Bacteria | 7964 |
| 467 | Ga0207674_10067314 | 3300026116 | Bacteria | 3606 |
| 468 | Ga0207675_100006808 | 3300026118 | Bacteria | 10823 |
| 469 | Ga0207683_10001764 | 3300026121 | Bacteria | 19147 |
| 470 | Ga0207683_10005055 | 3300026121 | Bacteria | 11320 |
| 471 | Ga0207683_10006197 | 3300026121 | Bacteria | 10251 |
| 472 | Ga0207683_10013603 | 3300026121 | Bacteria | 6941 |
| 473 | Ga0207683_10026173 | 3300026121 | Bacteria | 5035 |
| 474 | Ga0207683_10135312 | 3300026121 | Bacteria | 2218 |
| 475 | Ga0207698_10000815 | 3300026142 | Bacteria | 18122 |
| 476 | Ga0207698_10003377 | 3300026142 | Bacteria | 9614 |
| 477 | Ga0207698_10005196 | 3300026142 | Bacteria | 8004 |
| 478 | Ga0207698_10008160 | 3300026142 | Bacteria | 6602 |
| 479 | Ga0268266_10005814 | 3300028379 | Bacteria | 11417 |
| 480 | Ga0268266_10017076 | 3300028379 | Bacteria | 6197 |
| 481 | Ga0268266_10042006 | 3300028379 | Bacteria | 3904 |
| 482 | Ga0268265_10004795 | 3300028380 | Bacteria | 9321 |
| 483 | Ga0268265_10008727 | 3300028380 | Bacteria | 6853 |
| 484 | Ga0268265_10015327 | 3300028380 | Bacteria | 5243 |
| 485 | Ga0268265_10024003 | 3300028380 | Bacteria | 4307 |
| 486 | Ga0268265_10041475 | 3300028380 | Bacteria | 3407 |
| 487 | Ga0268264_10024352 | 3300028381 | Bacteria | 4942 |
| 488 | Ga0268264_10062654 | 3300028381 | Bacteria | 3124 |
| 489 | Ga0268264_10100992 | 3300028381 | Bacteria | 2507 |
| 490 | Ga0307408_100011699 | 3300031548 | Bacteria | 5802 |
| 491 | Ga0307408_100018322 | 3300031548 | Bacteria | 4697 |
| 492 | Ga0307408_100020083 | 3300031548 | Bacteria | 4503 |
| 493 | Ga0307408_100097161 | 3300031548 | Bacteria | 2237 |
| 494 | Ga0307405_10021078 | 3300031731 | Bacteria | 3658 |
| 495 | Ga0307405_10078346 | 3300031731 | Bacteria | 2150 |
| 496 | Ga0307405_10125226 | 3300031731 | Bacteria | 1765 |
| 497 | Ga0307405_10137963 | 3300031731 | Bacteria | 1696 |
| 498 | Ga0307413_10001062 | 3300031824 | Bacteria | 9990 |
| 499 | Ga0307413_10002669 | 3300031824 | Bacteria | 7310 |
| 500 | Ga0307413_10029266 | 3300031824 | Bacteria | 3079 |
| 501 | Ga0307413_10067411 | 3300031824 | Bacteria | 2237 |
| 502 | Ga0307413_10074461 | 3300031824 | Bacteria | 2150 |
| 503 | Ga0307410_10001721 | 3300031852 | Bacteria | 10105 |
| 504 | Ga0307410_10035650 | 3300031852 | Bacteria | 3233 |
| 505 | Ga0307410_10082460 | 3300031852 | Bacteria | 2262 |
| 506 | Ga0307410_10144018 | 3300031852 | Bacteria | 1766 |
| 507 | Ga0307406_10022496 | 3300031901 | Bacteria | 3740 |
| 508 | Ga0307406_10046387 | 3300031901 | Bacteria | 2734 |
| 509 | Ga0307406_10071477 | 3300031901 | Bacteria | 2274 |
| 510 | Ga0307406_10133771 | 3300031901 | Bacteria | 1744 |
| 511 | Ga0307407_10006774 | 3300031903 | Bacteria | 5130 |
| 512 | Ga0307407_10062513 | 3300031903 | Bacteria | 2180 |
| 513 | Ga0307412_10009623 | 3300031911 | Bacteria | 5552 |
| 514 | Ga0307412_10033032 | 3300031911 | Bacteria | 3284 |
| 515 | Ga0307412_10133415 | 3300031911 | Bacteria | 1807 |
| 516 | Ga0307409_100019838 | 3300031995 | Bacteria | 4565 |
| 517 | Ga0307409_100068196 | 3300031995 | Bacteria | 2812 |
| 518 | Ga0307409_100106366 | 3300031995 | Bacteria | 2341 |
| 519 | Ga0307409_100189958 | 3300031995 | Bacteria | 1827 |
| 520 | Ga0307409_100205501 | 3300031995 | Bacteria | 1765 |
| 521 | Ga0307416_100002829 | 3300032002 | Bacteria | 10094 |
| 522 | Ga0307416_100019713 | 3300032002 | Bacteria | 4790 |
| 523 | Ga0307416_100069269 | 3300032002 | Bacteria | 2919 |
| 524 | Ga0307416_100104607 | 3300032002 | Bacteria | 2475 |
| 525 | Ga0307416_100194829 | 3300032002 | Bacteria | 1915 |
| 526 | Ga0307416_100499462 | 3300032002 | Bacteria | 1280 |
| 527 | Ga0307414_10027648 | 3300032004 | Bacteria | 3668 |
| 528 | Ga0307414_10049155 | 3300032004 | Bacteria | 2914 |
| 529 | Ga0307414_10077496 | 3300032004 | Bacteria | 2420 |
| 530 | Ga0307414_10124538 | 3300032004 | Bacteria | 1988 |
| 531 | Ga0307414_10217674 | 3300032004 | Bacteria | 1565 |
| 532 | Ga0307414_10245416 | 3300032004 | Bacteria | 1485 |
| 533 | Ga0307411_10001070 | 3300032005 | Bacteria | 10622 |
| 534 | Ga0307411_10002357 | 3300032005 | Bacteria | 8306 |
| 535 | Ga0307411_10010399 | 3300032005 | Bacteria | 4957 |
| 536 | Ga0307411_10012286 | 3300032005 | Bacteria | 4664 |
| 537 | Ga0307411_10012578 | 3300032005 | Bacteria | 4627 |
| 538 | Ga0307411_10019918 | 3300032005 | Bacteria | 3888 |
| 539 | Ga0307411_10023867 | 3300032005 | Bacteria | 3633 |
| 540 | Ga0307411_10029372 | 3300032005 | Bacteria | 3356 |
| 541 | Ga0307411_10034033 | 3300032005 | Bacteria | 3166 |
| 542 | Ga0307411_10039289 | 3300032005 | Bacteria | 2992 |
| 543 | Ga0307411_10066948 | 3300032005 | Bacteria | 2415 |
| 544 | Ga0307411_10145936 | 3300032005 | Bacteria | 1751 |
| 545 | Ga0307411_10147301 | 3300032005 | Bacteria | 1744 |
| 546 | Ga0307415_100007081 | 3300032126 | Bacteria | 6106 |
| 547 | Ga0307415_100015345 | 3300032126 | Bacteria | 4533 |
| 548 | Ga0307415_100050323 | 3300032126 | Bacteria | 2822 |
| 549 | Ga0307415_100065850 | 3300032126 | Bacteria | 2526 |
| 550 | Ga0307415_100075489 | 3300032126 | Bacteria | 2385 |
| 551 | Ga0373935_0002619 | 3300035692 | Bacteria | 10343 |
| 552 | Ga0373935_0240928 | 3300035692 | Bacteria | 1263 |
| 553 | Ga0395899_0000225 | 3300037312 | Bacteria | 76673 |
| 554 | Ga0395899_0005006 | 3300037312 | Bacteria | 10310 |
| 555 | Ga0395899_0005072 | 3300037312 | Bacteria | 10246 |
| 556 | Ga0395899_0012804 | 3300037312 | Bacteria | 6427 |
| 557 | Ga0395899_0025569 | 3300037312 | Bacteria | 4456 |
| 558 | Ga0395899_0035725 | 3300037312 | Bacteria | 3729 |
| 559 | Ga0395899_0040918 | 3300037312 | Bacteria | 3465 |
| 560 | Ga0395899_0098928 | 3300037312 | Bacteria | 2108 |
| 561 | Ga0395899_0148385 | 3300037312 | Bacteria | 1663 |
| 562 | Ga0395899_0183492 | 3300037312 | Bacteria | 1467 |
| 563 | Ga0395900_0000667 | 3300037418 | Bacteria | 45770 |
| 564 | Ga0395900_0002993 | 3300037418 | Bacteria | 18388 |
| 565 | Ga0395900_0006074 | 3300037418 | Bacteria | 12597 |
| 566 | Ga0395900_0008623 | 3300037418 | Bacteria | 10477 |
| 567 | Ga0395900_0009437 | 3300037418 | Bacteria | 10001 |
| 568 | Ga0395900_0016804 | 3300037418 | Bacteria | 7464 |
| 569 | Ga0395900_0026764 | 3300037418 | Bacteria | 5903 |
| 570 | Ga0395900_0049235 | 3300037418 | Bacteria | 4341 |
| 571 | Ga0395900_0062933 | 3300037418 | Bacteria | 3813 |
| 572 | Ga0395900_0121936 | 3300037418 | Bacteria | 2674 |
| 573 | Ga0395900_0160920 | 3300037418 | Bacteria | 2290 |
| 574 | Ga0395900_0171327 | 3300037418 | Bacteria | 2209 |
| 575 | Ga0395900_0208850 | 3300037418 | Bacteria | 1972 |
| 576 | Ga0395900_0302267 | 3300037418 | Unclassified | 1586 |
| 577 | Ga0395900_0499018 | 3300037418 | Bacteria | 1168 |
| 578 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 579 | Ga0395898_0004704 | 3300037466 | Bacteria | 14856 |
| 580 | Ga0395898_0009837 | 3300037466 | Bacteria | 10019 |
| 581 | Ga0395898_0024035 | 3300037466 | Bacteria | 6149 |
| 582 | Ga0395898_0038179 | 3300037466 | Bacteria | 4762 |
| 583 | Ga0395898_0053101 | 3300037466 | Bacteria | 3958 |
| 584 | Ga0395898_0080411 | 3300037466 | Bacteria | 3143 |
| 585 | Ga0395898_0150568 | 3300037466 | Bacteria | 2226 |
| 586 | Ga0395898_0154859 | 3300037466 | Bacteria | 2192 |
| 587 | Ga0395898_0291047 | 3300037466 | Bacteria | 1558 |
| 588 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 589 | Ga0395905_0001635 | 3300037471 | Bacteria | 26576 |
| 590 | Ga0395905_0003067 | 3300037471 | Bacteria | 18078 |
| 591 | Ga0395905_0003264 | 3300037471 | Bacteria | 17442 |
| 592 | Ga0395905_0007828 | 3300037471 | Bacteria | 10588 |
| 593 | Ga0395905_0011066 | 3300037471 | Bacteria | 8733 |
| 594 | Ga0395905_0011111 | 3300037471 | Bacteria | 8708 |
| 595 | Ga0395905_0022927 | 3300037471 | Bacteria | 5900 |
| 596 | Ga0395905_0027023 | 3300037471 | Bacteria | 5411 |
| 597 | Ga0395905_0073349 | 3300037471 | Bacteria | 3208 |
| 598 | Ga0395905_0150559 | 3300037471 | Bacteria | 2189 |
| 599 | Ga0395905_0192366 | 3300037471 | Bacteria | 1914 |
| 600 | Ga0395905_0251614 | 3300037471 | Bacteria | 1650 |
| 601 | Ga0395905_0279384 | 3300037471 | Unclassified | 1556 |
| 602 | Ga0395905_0282021 | 3300037471 | Bacteria | 1547 |
| 603 | Ga0395905_0379372 | 3300037471 | Bacteria | 1307 |
| 604 | Ga0395905_0489808 | 3300037471 | Bacteria | 1129 |
| 605 | Ga0436364_0996148 | 3300037853 | Bacteria | 15568 |
| 606 | Ga0395901_0000329 | 3300038443 | Bacteria | 58460 |
| 607 | Ga0395901_0004318 | 3300038443 | Bacteria | 14350 |
| 608 | Ga0395901_0006151 | 3300038443 | Bacteria | 12162 |
| 609 | Ga0395901_0006951 | 3300038443 | Bacteria | 11432 |
| 610 | Ga0395901_0010278 | 3300038443 | Bacteria | 9480 |
| 611 | Ga0395901_0016246 | 3300038443 | Bacteria | 7582 |
| 612 | Ga0395901_0042350 | 3300038443 | Bacteria | 4720 |
| 613 | Ga0395901_0064624 | 3300038443 | Bacteria | 3809 |
| 614 | Ga0395901_0069957 | 3300038443 | Bacteria | 3656 |
| 615 | Ga0395901_0075005 | 3300038443 | Bacteria | 3528 |
| 616 | Ga0395901_0103501 | 3300038443 | Bacteria | 2987 |
| 617 | Ga0395901_0124765 | 3300038443 | Bacteria | 2705 |
| 618 | Ga0395901_0178628 | 3300038443 | Bacteria | 2226 |
| 619 | Ga0395901_0355885 | 3300038443 | Bacteria | 1510 |
| 620 | Ga0395901_0417439 | 3300038443 | Bacteria | 1376 |
| 621 | Ga0395901_0656416 | 3300038443 | Bacteria | 1051 |
| 622 | Ga0436365_0802722 | 3300039437 | Bacteria | 9190 |
| 623 | Ga0439448_0000637 | 3300042005 | Bacteria | 8284 |
| 624 | Ga0439458_0000016 | 3300042157 | Bacteria | 26319 |
| 625 | Ga0466969_0011193 | 3300044656 | Bacteria | 4750 |
| 626 | Ga0466965_0205648 | 3300044683 | Bacteria | 1045 |
| 627 | Ga0466966_0013208 | 3300044684 | Bacteria | 5468 |
| 628 | Ga0466961_0018514 | 3300044693 | Bacteria | 4481 |
| 629 | Ga0466961_0102886 | 3300044693 | Unclassified | 1798 |
| 630 | Ga0466963_0013250 | 3300044694 | Bacteria | 5060 |
| 631 | Ga0466963_0081359 | 3300044694 | Bacteria | 2193 |
| 632 | Ga0466964_0002041 | 3300044706 | Bacteria | 7103 |
| 633 | Ga0466964_0005969 | 3300044706 | Bacteria | 4538 |
| 634 | Ga0466964_0038247 | 3300044706 | Bacteria | 1929 |
| 635 | Ga0466971_0024715 | 3300044719 | Bacteria | 2680 |
| 636 | Ga0466971_0096837 | 3300044719 | Bacteria | 1354 |
| 637 | Ga0466971_0100158 | 3300044719 | Bacteria | 1331 |
| 638 | Ga0466968_0004014 | 3300044735 | Bacteria | 5469 |
| 639 | Ga0466970_0009178 | 3300044765 | Bacteria | 4988 |
| 640 | Ga0466970_0091847 | 3300044765 | Bacteria | 1648 |
| 641 | Ga0466957_0001921 | 3300044842 | Bacteria | 11036 |
| 642 | Ga0466957_0011549 | 3300044842 | Bacteria | 5101 |
| 643 | Ga0466957_0149371 | 3300044842 | Bacteria | 1510 |
| 644 | Ga0466957_0150634 | 3300044842 | Bacteria | 1504 |
| 645 | Ga0466960_0026512 | 3300044901 | Bacteria | 2633 |
| 646 | Ga0466959_0020664 | 3300045049 | Bacteria | 4851 |
| 647 | Ga0466959_0052885 | 3300045049 | Bacteria | 2972 |
| 648 | Ga0466959_0095993 | 3300045049 | Bacteria | 2126 |
| 649 | Ga0466959_0252823 | 3300045049 | Bacteria | 1215 |
| 650 | Ga0466959_0274831 | 3300045049 | Bacteria | 1157 |
| 651 | Ga0466958_0000295 | 3300045836 | Bacteria | 19538 |
| 652 | Ga0466958_0002038 | 3300045836 | Bacteria | 9979 |
| 653 | Ga0466958_0032577 | 3300045836 | Bacteria | 3101 |
| 654 | Ga0466958_0045016 | 3300045836 | Bacteria | 2661 |
| 655 | Ga0466967_0005395 | 3300045976 | Bacteria | 8854 |
| 656 | Ga0466967_0007335 | 3300045976 | Bacteria | 7942 |
| 657 | Ga0466967_0008133 | 3300045976 | Bacteria | 7655 |
| 658 | Ga0466967_0022827 | 3300045976 | Bacteria | 5115 |
| 659 | Ga0466967_0073433 | 3300045976 | Bacteria | 3069 |
| 660 | Ga0466967_0075060 | 3300045976 | Bacteria | 3038 |
| 661 | Ga0466967_0123773 | 3300045976 | Bacteria | 2393 |
| 662 | Ga0466967_0216416 | 3300045976 | Bacteria | 1818 |
| 663 | Ga0466967_0407350 | 3300045976 | Bacteria | 1324 |
| 664 | Ga0495629_0196770 | 3300046459 | Unclassified | 1394 |
| 665 | Ga0495610_0060171 | 3300046512 | Bacteria | 1810 |
| 666 | Ga0495663_0005944 | 3300046525 | Bacteria | 3377 |
| 667 | Ga0495598_0006086 | 3300046537 | Bacteria | 2708 |
| 668 | Ga0495598_0073591 | 3300046537 | Bacteria | 1081 |
| 669 | Ga0495621_0000149 | 3300046539 | Bacteria | 15217 |
| 670 | Ga0495621_0005701 | 3300046539 | Bacteria | 3597 |
| 671 | Ga0495621_0079821 | 3300046539 | Bacteria | 1218 |
| 672 | Ga0495659_0041946 | 3300046664 | Bacteria | 1636 |
| 673 | Ga0495669_0014073 | 3300046684 | Bacteria | 3418 |
| 674 | Ga0495669_0045620 | 3300046684 | Bacteria | 1955 |
| 675 | Ga0495669_0064163 | 3300046684 | Bacteria | 1667 |
| 676 | Ga0495670_0001654 | 3300046691 | Bacteria | 10923 |
| 677 | Ga0495670_0010361 | 3300046691 | Bacteria | 4580 |
| 678 | Ga0495670_0012515 | 3300046691 | Bacteria | 4175 |
| 679 | Ga0495670_0014986 | 3300046691 | Bacteria | 3815 |
| 680 | Ga0495670_0090239 | 3300046691 | Bacteria | 1568 |
| 681 | Ga0495670_0175144 | 3300046691 | Bacteria | 1131 |
| 682 | Ga0495677_0049712 | 3300047445 | Unclassified | 1542 |
| 683 | Ga0495677_0069015 | 3300047445 | Bacteria | 1316 |
| 684 | Ga0496100_0000581 | 3300048903 | Bacteria | 17237 |
| 685 | Ga0496101_0007992 | 3300048904 | Bacteria | 6893 |
| 686 | Ga0496102_0270262 | 3300048905 | Bacteria | 1603 |
| 687 | Ga0496102_0282302 | 3300048905 | Bacteria | 1565 |
| 688 | Ga0496103_0043312 | 3300048906 | Bacteria | 2771 |
| 689 | Ga0496103_0183757 | 3300048906 | Bacteria | 1344 |
| 690 | Ga0496104_0059996 | 3300048907 | Bacteria | 3603 |
| 691 | Ga0496105_0012290 | 3300048908 | Bacteria | 6780 |
| 692 | Ga0496105_0052613 | 3300048908 | Bacteria | 3364 |
| 693 | Ga0496106_0016741 | 3300048909 | Bacteria | 5425 |
| 694 | Ga0496106_0021199 | 3300048909 | Bacteria | 4824 |
| 695 | Ga0496107_0002436 | 3300048910 | Bacteria | 12049 |
| 696 | Ga0496107_0005092 | 3300048910 | Bacteria | 8960 |
| 697 | Ga0496107_0008596 | 3300048910 | Bacteria | 7069 |
| 698 | Ga0496107_0059320 | 3300048910 | Bacteria | 2769 |
| 699 | Ga0496107_0084054 | 3300048910 | Unclassified | 2322 |
| 700 | Ga0496108_0004564 | 3300048911 | Bacteria | 11158 |
| 701 | Ga0496108_0006742 | 3300048911 | Bacteria | 9299 |
| 702 | Ga0496108_0008862 | 3300048911 | Bacteria | 8153 |
| 703 | Ga0496108_0011381 | 3300048911 | Bacteria | 7231 |
| 704 | Ga0496108_0111999 | 3300048911 | Bacteria | 2334 |
| 705 | Ga0496109_0066459 | 3300048912 | Bacteria | 3301 |
| 706 | Ga0496109_0067752 | 3300048912 | Bacteria | 3270 |
| 707 | Ga0496109_0159326 | 3300048912 | Bacteria | 2114 |
| 708 | Ga0496110_0004364 | 3300048913 | Bacteria | 10950 |
| 709 | Ga0496110_0007127 | 3300048913 | Bacteria | 8900 |
| 710 | Ga0496110_0009337 | 3300048913 | Bacteria | 7935 |
| 711 | Ga0496111_0003961 | 3300048914 | Bacteria | 9289 |
| 712 | Ga0496111_0021015 | 3300048914 | Bacteria | 4551 |
| 713 | Ga0496111_0057480 | 3300048914 | Bacteria | 2816 |
| 714 | Ga0496111_0057825 | 3300048914 | Bacteria | 2807 |
| 715 | Ga0496112_0010358 | 3300048915 | Bacteria | 8454 |
| 716 | Ga0496112_0013820 | 3300048915 | Bacteria | 7468 |
| 717 | Ga0496112_0014432 | 3300048915 | Bacteria | 7329 |
| 718 | Ga0496112_0025959 | 3300048915 | Bacteria | 5630 |
| 719 | Ga0496112_0105724 | 3300048915 | Bacteria | 2784 |
| 720 | Ga0496112_0190349 | 3300048915 | Unclassified | 2014 |
| 721 | Ga0496113_0010547 | 3300048916 | Bacteria | 6112 |
| 722 | Ga0496113_0199711 | 3300048916 | Bacteria | 1589 |
| 723 | Ga0496114_0000131 | 3300048917 | Bacteria | 54315 |
| 724 | Ga0496114_0044424 | 3300048917 | Bacteria | 3686 |
| 725 | Ga0496114_0151961 | 3300048917 | Bacteria | 2009 |
| 726 | Ga0496115_0001982 | 3300048918 | Bacteria | 14619 |
| 727 | Ga0496115_0019427 | 3300048918 | Bacteria | 5229 |
| 728 | Ga0501074_0033320 | 3300049590 | Bacteria | 3733 |
| 729 | Ga0501233_040922 | 3300049668 | Bacteria | 1089 |
| 730 | Ga0501225_0015983 | 3300049705 | Bacteria | 2086 |
| 731 | nmdc:mga06r32_22563_c1 | 3300050510 | Bacteria | 5820 |
| 732 | nmdc:mga08y16_312874_c1 | 3300050511 | Bacteria | 1617 |
| 733 | Ga0466962_0016490 | 3300061719 | Bacteria | 3563 |
| 734 | Ga0466962_0028622 | 3300061719 | Bacteria | 2668 |
| 735 | Ga0466962_0084563 | 3300061719 | Bacteria | 1518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10126159 | Ga0157374_101261591 | 298 |
| 2 | 3300025940 | Ga0207691_10355062 | Ga0207691_103550621 | 298 |
| 3 | 3300046684 | Ga0495669_0064163 | Ga0495669_0064163_682_1644 | 298 |
| 4 | 3300048910 | Ga0496107_0084054 | Ga0496107_0084054_758_1720 | 298 |
| 5 | 3300048915 | Ga0496112_0190349 | Ga0496112_0190349_17_979 | 298 |
| 6 | 3300048918 | Ga0496115_0001982 | Ga0496115_0001982_7575_8537 | 298 |
| 7 | 3300047445 | Ga0495677_0049712 | Ga0495677_0049712_195_1127 | 299 |
| 8 | 3300005458 | Ga0070681_10113333 | Ga0070681_101133331 | 301 |
| 9 | 3300037418 | Ga0395900_0026764 | Ga0395900_0026764_1850_2758 | 301 |
| 10 | 3300037471 | Ga0395905_0251614 | Ga0395905_0251614_350_1258 | 301 |
| 11 | 3300025938 | Ga0207704_10042159 | Ga0207704_100421592 | 302 |
| 12 | 3300025933 | Ga0207706_10007778 | Ga0207706_100077788 | 304 |
| 13 | 3300037466 | Ga0395898_0154859 | Ga0395898_0154859_951_1874 | 306 |
| 14 | 3300038443 | Ga0395901_0124765 | Ga0395901_0124765_638_1561 | 306 |
| 15 | 3300046684 | Ga0495669_0014073 | Ga0495669_0014073_789_1982 | 306 |
| 16 | 3300005355 | Ga0070671_100112215 | Ga0070671_1001122152 | 307 |
| 17 | 3300005457 | Ga0070662_100002537 | Ga0070662_1000025373 | 307 |
| 18 | 3300017792 | Ga0163161_10034360 | Ga0163161_100343603 | 307 |
| 19 | 3300005543 | Ga0070672_100209281 | Ga0070672_1002092812 | 309 |
| 20 | 3300005564 | Ga0070664_100283695 | Ga0070664_1002836951 | 309 |
| 21 | 3300014326 | Ga0157380_10001263 | Ga0157380_1000126314 | 309 |
| 22 | 3300025940 | Ga0207691_10208012 | Ga0207691_102080122 | 309 |
| 23 | 3300031852 | Ga0307410_10082460 | Ga0307410_100824601 | 309 |
| 24 | 3300046537 | Ga0495598_0006086 | Ga0495598_0006086_582_1514 | 309 |
| 25 | 3300046539 | Ga0495621_0000149 | Ga0495621_0000149_13743_14675 | 309 |
| 26 | 3300046684 | Ga0495669_0045620 | Ga0495669_0045620_850_1782 | 309 |
| 27 | 3300046691 | Ga0495670_0001654 | Ga0495670_0001654_2324_3256 | 309 |
| 28 | 3300005335 | Ga0070666_10007600 | Ga0070666_100076003 | 310 |
| 29 | 3300005344 | Ga0070661_100027296 | Ga0070661_1000272963 | 310 |
| 30 | 3300005456 | Ga0070678_100029442 | Ga0070678_1000294422 | 310 |
| 31 | 3300005543 | Ga0070672_100002154 | Ga0070672_1000021546 | 310 |
| 32 | 3300005564 | Ga0070664_100014968 | Ga0070664_1000149683 | 310 |
| 33 | 3300005841 | Ga0068863_100006129 | Ga0068863_10000612911 | 310 |
| 34 | 3300005842 | Ga0068858_100014242 | Ga0068858_1000142423 | 310 |
| 35 | 3300005985 | Ga0081539_10041191 | Ga0081539_100411913 | 310 |
| 36 | 3300009101 | Ga0105247_10264193 | Ga0105247_102641931 | 310 |
| 37 | 3300009177 | Ga0105248_10098492 | Ga0105248_100984924 | 310 |
| 38 | 3300009177 | Ga0105248_10100198 | Ga0105248_101001982 | 310 |
| 39 | 3300013102 | Ga0157371_10169779 | Ga0157371_101697792 | 310 |
| 40 | 3300013308 | Ga0157375_10008191 | Ga0157375_100081913 | 310 |
| 41 | 3300014325 | Ga0163163_10014997 | Ga0163163_100149975 | 310 |
| 42 | 3300025931 | Ga0207644_10018366 | Ga0207644_100183663 | 310 |
| 43 | 3300025933 | Ga0207706_10007033 | Ga0207706_100070337 | 310 |
| 44 | 3300025940 | Ga0207691_10001147 | Ga0207691_1000114717 | 310 |
| 45 | 3300026121 | Ga0207683_10005055 | Ga0207683_100050553 | 310 |
| 46 | 3300038443 | Ga0395901_0656416 | Ga0395901_0656416_102_1040 | 310 |
| 47 | 3300044656 | Ga0466969_0011193 | Ga0466969_0011193_3641_4576 | 310 |
| 48 | 3300044683 | Ga0466965_0205648 | Ga0466965_0205648_70_1005 | 310 |
| 49 | 3300045049 | Ga0466959_0095993 | Ga0466959_0095993_1066_2001 | 310 |
| 50 | 3300045836 | Ga0466958_0045016 | Ga0466958_0045016_1667_2602 | 310 |
| 51 | 3300045976 | Ga0466967_0407350 | Ga0466967_0407350_25_960 | 310 |
| 52 | 3300046525 | Ga0495663_0005944 | Ga0495663_0005944_948_1883 | 310 |
| 53 | 3300046691 | Ga0495670_0014986 | Ga0495670_0014986_1651_2586 | 310 |
| 54 | 3300046691 | Ga0495670_0090239 | Ga0495670_0090239_158_1093 | 310 |
| 55 | 3300047445 | Ga0495677_0069015 | Ga0495677_0069015_64_999 | 310 |
| 56 | 3300048905 | Ga0496102_0270262 | Ga0496102_0270262_140_1075 | 310 |
| 57 | 3300048911 | Ga0496108_0006742 | Ga0496108_0006742_3763_4698 | 310 |
| 58 | 3300048912 | Ga0496109_0067752 | Ga0496109_0067752_1402_2337 | 310 |
| 59 | 3300048913 | Ga0496110_0009337 | Ga0496110_0009337_3009_3944 | 310 |
| 60 | 3300048914 | Ga0496111_0021015 | Ga0496111_0021015_1850_2785 | 310 |
| 61 | 3300025932 | Ga0207690_10065964 | Ga0207690_100659643 | 311 |
| 62 | 3300037466 | Ga0395898_0080411 | Ga0395898_0080411_11_952 | 311 |
| 63 | 3300049705 | Ga0501225_0015983 | Ga0501225_0015983_41_979 | 311 |
| 64 | 3300005355 | Ga0070671_100004406 | Ga0070671_1000044064 | 312 |
| 65 | 3300005338 | Ga0068868_100007475 | Ga0068868_1000074757 | 314 |
| 66 | 3300005985 | Ga0081539_10016891 | Ga0081539_100168913 | 314 |
| 67 | 3300037471 | Ga0395905_0379372 | Ga0395905_0379372_85_1056 | 323 |
| 68 | 3300009094 | Ga0111539_10213844 | Ga0111539_102138442 | 325 |
| 69 | 3300046539 | Ga0495621_0005701 | Ga0495621_0005701_680_1663 | 325 |
| 70 | 3300046539 | Ga0495621_0079821 | Ga0495621_0079821_153_1160 | 325 |
| 71 | 3300046664 | Ga0495659_0041946 | Ga0495659_0041946_47_1054 | 325 |
| 72 | 3300046691 | Ga0495670_0012515 | Ga0495670_0012515_2515_3522 | 325 |
| 73 | 3300005353 | Ga0070669_100101424 | Ga0070669_1001014242 | 326 |
| 74 | 3300005617 | Ga0068859_100063134 | Ga0068859_1000631342 | 326 |
| 75 | 3300006931 | Ga0097620_100063133 | Ga0097620_1000631332 | 326 |
| 76 | 3300009177 | Ga0105248_10013976 | Ga0105248_100139763 | 326 |
| 77 | 3300025941 | Ga0207711_10037257 | Ga0207711_100372573 | 326 |
| 78 | 3300025961 | Ga0207712_10209462 | Ga0207712_102094621 | 326 |
| 79 | 3300032005 | Ga0307411_10012578 | Ga0307411_100125782 | 326 |
| 80 | 3300037312 | Ga0395899_0098928 | Ga0395899_0098928_1022_2098 | 326 |
| 81 | 3300009177 | Ga0105248_10725781 | Ga0105248_107257811 | 327 |
| 82 | 3300031548 | Ga0307408_100011699 | Ga0307408_1000116996 | 327 |
| 83 | 3300031901 | Ga0307406_10046387 | Ga0307406_100463873 | 327 |
| 84 | 3300032004 | Ga0307414_10245416 | Ga0307414_102454162 | 327 |
| 85 | 3300032005 | Ga0307411_10029372 | Ga0307411_100293723 | 327 |
| 86 | 3300037312 | Ga0395899_0040918 | Ga0395899_0040918_1661_2677 | 327 |
| 87 | 3300037466 | Ga0395898_0038179 | Ga0395898_0038179_2244_3260 | 327 |
| 88 | 3300037471 | Ga0395905_0022927 | Ga0395905_0022927_428_1609 | 327 |
| 89 | 3300038443 | Ga0395901_0075005 | Ga0395901_0075005_2326_3330 | 327 |
| 90 | 3300046512 | Ga0495610_0060171 | Ga0495610_0060171_543_1583 | 327 |
| 91 | 3300048911 | Ga0496108_0008862 | Ga0496108_0008862_4447_5502 | 327 |
| 92 | 3300050511 | nmdc:mga08y16_312874_c1 | nmdc:mga08y16_312874_c1_22_1077 | 327 |
| 93 | 3300001990 | JGI24737J22298_10000450 | JGI24737J22298_100004504 | 328 |
| 94 | 3300001990 | JGI24737J22298_10005651 | JGI24737J22298_100056514 | 328 |
| 95 | 3300005327 | Ga0070658_10193367 | Ga0070658_101933671 | 328 |
| 96 | 3300005327 | Ga0070658_10219493 | Ga0070658_102194931 | 328 |
| 97 | 3300005328 | Ga0070676_10010940 | Ga0070676_100109405 | 328 |
| 98 | 3300005330 | Ga0070690_100001325 | Ga0070690_1000013258 | 328 |
| 99 | 3300005330 | Ga0070690_100005407 | Ga0070690_1000054074 | 328 |
| 100 | 3300005330 | Ga0070690_100064445 | Ga0070690_1000644453 | 328 |
| 101 | 3300005331 | Ga0070670_100027284 | Ga0070670_1000272844 | 328 |
| 102 | 3300005331 | Ga0070670_100028402 | Ga0070670_1000284024 | 328 |
| 103 | 3300005333 | Ga0070677_10000999 | Ga0070677_100009995 | 328 |
| 104 | 3300005335 | Ga0070666_10001909 | Ga0070666_100019096 | 328 |
| 105 | 3300005335 | Ga0070666_10005798 | Ga0070666_100057988 | 328 |
| 106 | 3300005338 | Ga0068868_100017471 | Ga0068868_1000174713 | 328 |
| 107 | 3300005339 | Ga0070660_100006513 | Ga0070660_1000065138 | 328 |
| 108 | 3300005344 | Ga0070661_100095311 | Ga0070661_1000953112 | 328 |
| 109 | 3300005354 | Ga0070675_100004653 | Ga0070675_1000046537 | 328 |
| 110 | 3300005355 | Ga0070671_100004514 | Ga0070671_1000045145 | 328 |
| 111 | 3300005355 | Ga0070671_100011508 | Ga0070671_1000115083 | 328 |
| 112 | 3300005355 | Ga0070671_100014729 | Ga0070671_1000147294 | 328 |
| 113 | 3300005355 | Ga0070671_100039305 | Ga0070671_1000393053 | 328 |
| 114 | 3300005356 | Ga0070674_100002641 | Ga0070674_1000026417 | 328 |
| 115 | 3300005364 | Ga0070673_100056512 | Ga0070673_1000565122 | 328 |
| 116 | 3300005364 | Ga0070673_100065813 | Ga0070673_1000658131 | 328 |
| 117 | 3300005366 | Ga0070659_100001058 | Ga0070659_10000105812 | 328 |
| 118 | 3300005366 | Ga0070659_100004420 | Ga0070659_1000044205 | 328 |
| 119 | 3300005366 | Ga0070659_100011181 | Ga0070659_1000111813 | 328 |
| 120 | 3300005366 | Ga0070659_100146749 | Ga0070659_1001467492 | 328 |
| 121 | 3300005367 | Ga0070667_100003455 | Ga0070667_10000345510 | 328 |
| 122 | 3300005367 | Ga0070667_100007636 | Ga0070667_1000076365 | 328 |
| 123 | 3300005367 | Ga0070667_100016732 | Ga0070667_1000167324 | 328 |
| 124 | 3300005436 | Ga0070713_100017293 | Ga0070713_1000172931 | 328 |
| 125 | 3300005436 | Ga0070713_100076786 | Ga0070713_1000767863 | 328 |
| 126 | 3300005455 | Ga0070663_100006460 | Ga0070663_1000064605 | 328 |
| 127 | 3300005456 | Ga0070678_100001087 | Ga0070678_10000108713 | 328 |
| 128 | 3300005457 | Ga0070662_100008482 | Ga0070662_1000084823 | 328 |
| 129 | 3300005457 | Ga0070662_100010844 | Ga0070662_1000108445 | 328 |
| 130 | 3300005539 | Ga0068853_100060015 | Ga0068853_1000600153 | 328 |
| 131 | 3300005539 | Ga0068853_100239193 | Ga0068853_1002391931 | 328 |
| 132 | 3300005543 | Ga0070672_100003490 | Ga0070672_1000034906 | 328 |
| 133 | 3300005544 | Ga0070686_100002623 | Ga0070686_1000026232 | 328 |
| 134 | 3300005549 | Ga0070704_100226972 | Ga0070704_1002269722 | 328 |
| 135 | 3300005564 | Ga0070664_100012535 | Ga0070664_1000125354 | 328 |
| 136 | 3300005564 | Ga0070664_100047963 | Ga0070664_1000479633 | 328 |
| 137 | 3300005577 | Ga0068857_100009098 | Ga0068857_1000090986 | 328 |
| 138 | 3300005578 | Ga0068854_100083449 | Ga0068854_1000834493 | 328 |
| 139 | 3300005616 | Ga0068852_100013293 | Ga0068852_1000132934 | 328 |
| 140 | 3300005616 | Ga0068852_100050120 | Ga0068852_1000501204 | 328 |
| 141 | 3300005617 | Ga0068859_100061949 | Ga0068859_1000619493 | 328 |
| 142 | 3300005618 | Ga0068864_100005693 | Ga0068864_1000056935 | 328 |
| 143 | 3300005618 | Ga0068864_100012661 | Ga0068864_1000126613 | 328 |
| 144 | 3300005618 | Ga0068864_100162974 | Ga0068864_1001629742 | 328 |
| 145 | 3300005718 | Ga0068866_10002827 | Ga0068866_100028273 | 328 |
| 146 | 3300005719 | Ga0068861_100004768 | Ga0068861_1000047685 | 328 |
| 147 | 3300005834 | Ga0068851_10024179 | Ga0068851_100241793 | 328 |
| 148 | 3300005841 | Ga0068863_100020055 | Ga0068863_1000200553 | 328 |
| 149 | 3300005842 | Ga0068858_100008141 | Ga0068858_1000081414 | 328 |
| 150 | 3300005843 | Ga0068860_100211198 | Ga0068860_1002111981 | 328 |
| 151 | 3300005844 | Ga0068862_100005443 | Ga0068862_1000054436 | 328 |
| 152 | 3300006028 | Ga0070717_10024236 | Ga0070717_100242364 | 328 |
| 153 | 3300006358 | Ga0068871_100010640 | Ga0068871_1000106406 | 328 |
| 154 | 3300006931 | Ga0097620_100061945 | Ga0097620_1000619453 | 328 |
| 155 | 3300009093 | Ga0105240_10047741 | Ga0105240_100477415 | 328 |
| 156 | 3300009093 | Ga0105240_10078388 | Ga0105240_100783883 | 328 |
| 157 | 3300009094 | Ga0111539_10031153 | Ga0111539_100311536 | 328 |
| 158 | 3300009148 | Ga0105243_10238459 | Ga0105243_102384592 | 328 |
| 159 | 3300009148 | Ga0105243_10298768 | Ga0105243_102987681 | 328 |
| 160 | 3300009174 | Ga0105241_10291951 | Ga0105241_102919511 | 328 |
| 161 | 3300009176 | Ga0105242_10000993 | Ga0105242_1000099312 | 328 |
| 162 | 3300009177 | Ga0105248_10004871 | Ga0105248_1000487112 | 328 |
| 163 | 3300009177 | Ga0105248_10013847 | Ga0105248_100138475 | 328 |
| 164 | 3300009177 | Ga0105248_10081096 | Ga0105248_100810963 | 328 |
| 165 | 3300009177 | Ga0105248_10271859 | Ga0105248_102718592 | 328 |
| 166 | 3300009551 | Ga0105238_10007506 | Ga0105238_100075064 | 328 |
| 167 | 3300009553 | Ga0105249_10010129 | Ga0105249_100101296 | 328 |
| 168 | 3300009553 | Ga0105249_10193504 | Ga0105249_101935041 | 328 |
| 169 | 3300013102 | Ga0157371_10044544 | Ga0157371_100445443 | 328 |
| 170 | 3300013104 | Ga0157370_10011611 | Ga0157370_100116115 | 328 |
| 171 | 3300013104 | Ga0157370_10018643 | Ga0157370_100186433 | 328 |
| 172 | 3300013105 | Ga0157369_10058498 | Ga0157369_100584984 | 328 |
| 173 | 3300013105 | Ga0157369_10097381 | Ga0157369_100973812 | 328 |
| 174 | 3300013105 | Ga0157369_10502382 | Ga0157369_105023821 | 328 |
| 175 | 3300013297 | Ga0157378_10010569 | Ga0157378_100105693 | 328 |
| 176 | 3300013306 | Ga0163162_10137775 | Ga0163162_101377753 | 328 |
| 177 | 3300013307 | Ga0157372_10034037 | Ga0157372_100340374 | 328 |
| 178 | 3300013307 | Ga0157372_10137932 | Ga0157372_101379322 | 328 |
| 179 | 3300014325 | Ga0163163_10023776 | Ga0163163_100237764 | 328 |
| 180 | 3300014326 | Ga0157380_10005051 | Ga0157380_100050516 | 328 |
| 181 | 3300014969 | Ga0157376_10002890 | Ga0157376_100028905 | 328 |
| 182 | 3300017792 | Ga0163161_10017298 | Ga0163161_100172983 | 328 |
| 183 | 3300025315 | Ga0207697_10005052 | Ga0207697_100050527 | 328 |
| 184 | 3300025321 | Ga0207656_10040839 | Ga0207656_100408391 | 328 |
| 185 | 3300025893 | Ga0207682_10001693 | Ga0207682_100016937 | 328 |
| 186 | 3300025901 | Ga0207688_10079099 | Ga0207688_100790992 | 328 |
| 187 | 3300025903 | Ga0207680_10001102 | Ga0207680_100011027 | 328 |
| 188 | 3300025903 | Ga0207680_10018349 | Ga0207680_100183494 | 328 |
| 189 | 3300025907 | Ga0207645_10011685 | Ga0207645_100116857 | 328 |
| 190 | 3300025907 | Ga0207645_10029423 | Ga0207645_100294233 | 328 |
| 191 | 3300025919 | Ga0207657_10002291 | Ga0207657_1000229112 | 328 |
| 192 | 3300025919 | Ga0207657_10006293 | Ga0207657_1000629311 | 328 |
| 193 | 3300025919 | Ga0207657_10022931 | Ga0207657_100229314 | 328 |
| 194 | 3300025921 | Ga0207652_10061785 | Ga0207652_100617853 | 328 |
| 195 | 3300025925 | Ga0207650_10003054 | Ga0207650_100030545 | 328 |
| 196 | 3300025928 | Ga0207700_10013879 | Ga0207700_100138793 | 328 |
| 197 | 3300025928 | Ga0207700_10058519 | Ga0207700_100585192 | 328 |
| 198 | 3300025929 | Ga0207664_10021302 | Ga0207664_100213024 | 328 |
| 199 | 3300025929 | Ga0207664_10024314 | Ga0207664_100243144 | 328 |
| 200 | 3300025931 | Ga0207644_10001502 | Ga0207644_100015021 | 328 |
| 201 | 3300025931 | Ga0207644_10004832 | Ga0207644_100048323 | 328 |
| 202 | 3300025931 | Ga0207644_10020310 | Ga0207644_100203103 | 328 |
| 203 | 3300025932 | Ga0207690_10001173 | Ga0207690_1000117316 | 328 |
| 204 | 3300025932 | Ga0207690_10008367 | Ga0207690_100083675 | 328 |
| 205 | 3300025932 | Ga0207690_10107897 | Ga0207690_101078971 | 328 |
| 206 | 3300025932 | Ga0207690_10152858 | Ga0207690_101528582 | 328 |
| 207 | 3300025933 | Ga0207706_10000434 | Ga0207706_1000043435 | 328 |
| 208 | 3300025933 | Ga0207706_10004157 | Ga0207706_100041573 | 328 |
| 209 | 3300025933 | Ga0207706_10009816 | Ga0207706_100098167 | 328 |
| 210 | 3300025934 | Ga0207686_10033458 | Ga0207686_100334583 | 328 |
| 211 | 3300025937 | Ga0207669_10004765 | Ga0207669_100047654 | 328 |
| 212 | 3300025937 | Ga0207669_10008574 | Ga0207669_100085743 | 328 |
| 213 | 3300025937 | Ga0207669_10014453 | Ga0207669_100144531 | 328 |
| 214 | 3300025940 | Ga0207691_10000852 | Ga0207691_1000085221 | 328 |
| 215 | 3300025940 | Ga0207691_10001370 | Ga0207691_1000137013 | 328 |
| 216 | 3300025940 | Ga0207691_10159858 | Ga0207691_101598582 | 328 |
| 217 | 3300025941 | Ga0207711_10003771 | Ga0207711_100037719 | 328 |
| 218 | 3300025941 | Ga0207711_10022793 | Ga0207711_100227935 | 328 |
| 219 | 3300025941 | Ga0207711_10127572 | Ga0207711_101275722 | 328 |
| 220 | 3300025945 | Ga0207679_10113614 | Ga0207679_101136142 | 328 |
| 221 | 3300025949 | Ga0207667_10027212 | Ga0207667_100272124 | 328 |
| 222 | 3300025960 | Ga0207651_10004940 | Ga0207651_100049404 | 328 |
| 223 | 3300025960 | Ga0207651_10178164 | Ga0207651_101781641 | 328 |
| 224 | 3300025961 | Ga0207712_10006581 | Ga0207712_100065815 | 328 |
| 225 | 3300025961 | Ga0207712_10008327 | Ga0207712_100083276 | 328 |
| 226 | 3300025972 | Ga0207668_10002049 | Ga0207668_100020498 | 328 |
| 227 | 3300025972 | Ga0207668_10064739 | Ga0207668_100647391 | 328 |
| 228 | 3300025986 | Ga0207658_10003315 | Ga0207658_100033155 | 328 |
| 229 | 3300025986 | Ga0207658_10015299 | Ga0207658_100152994 | 328 |
| 230 | 3300025986 | Ga0207658_10175899 | Ga0207658_101758993 | 328 |
| 231 | 3300026023 | Ga0207677_10002552 | Ga0207677_100025524 | 328 |
| 232 | 3300026023 | Ga0207677_10042672 | Ga0207677_100426722 | 328 |
| 233 | 3300026035 | Ga0207703_10002473 | Ga0207703_100024737 | 328 |
| 234 | 3300026041 | Ga0207639_10092037 | Ga0207639_100920373 | 328 |
| 235 | 3300026041 | Ga0207639_10198791 | Ga0207639_101987911 | 328 |
| 236 | 3300026067 | Ga0207678_10015700 | Ga0207678_100157004 | 328 |
| 237 | 3300026067 | Ga0207678_10048157 | Ga0207678_100481573 | 328 |
| 238 | 3300026067 | Ga0207678_10090664 | Ga0207678_100906643 | 328 |
| 239 | 3300026078 | Ga0207702_10015606 | Ga0207702_100156064 | 328 |
| 240 | 3300026089 | Ga0207648_10004762 | Ga0207648_100047626 | 328 |
| 241 | 3300026095 | Ga0207676_10012995 | Ga0207676_100129952 | 328 |
| 242 | 3300026095 | Ga0207676_10085957 | Ga0207676_100859572 | 328 |
| 243 | 3300026095 | Ga0207676_10292296 | Ga0207676_102922961 | 328 |
| 244 | 3300026116 | Ga0207674_10000291 | Ga0207674_1000029114 | 328 |
| 245 | 3300026118 | Ga0207675_100006808 | Ga0207675_10000680813 | 328 |
| 246 | 3300026121 | Ga0207683_10001764 | Ga0207683_100017649 | 328 |
| 247 | 3300026121 | Ga0207683_10006197 | Ga0207683_100061978 | 328 |
| 248 | 3300026142 | Ga0207698_10008160 | Ga0207698_100081605 | 328 |
| 249 | 3300028380 | Ga0268265_10004795 | Ga0268265_100047958 | 328 |
| 250 | 3300031548 | Ga0307408_100018322 | Ga0307408_1000183225 | 328 |
| 251 | 3300031824 | Ga0307413_10067411 | Ga0307413_100674112 | 328 |
| 252 | 3300031901 | Ga0307406_10022496 | Ga0307406_100224963 | 328 |
| 253 | 3300031901 | Ga0307406_10133771 | Ga0307406_101337711 | 328 |
| 254 | 3300031903 | Ga0307407_10006774 | Ga0307407_100067743 | 328 |
| 255 | 3300031911 | Ga0307412_10009623 | Ga0307412_100096233 | 328 |
| 256 | 3300031911 | Ga0307412_10033032 | Ga0307412_100330322 | 328 |
| 257 | 3300032002 | Ga0307416_100002829 | Ga0307416_1000028296 | 328 |
| 258 | 3300032004 | Ga0307414_10027648 | Ga0307414_100276483 | 328 |
| 259 | 3300032004 | Ga0307414_10124538 | Ga0307414_101245382 | 328 |
| 260 | 3300032005 | Ga0307411_10147301 | Ga0307411_101473012 | 328 |
| 261 | 3300032126 | Ga0307415_100050323 | Ga0307415_1000503232 | 328 |
| 262 | 3300032126 | Ga0307415_100075489 | Ga0307415_1000754892 | 328 |
| 263 | 3300035692 | Ga0373935_0002619 | Ga0373935_0002619_6073_7140 | 328 |
| 264 | 3300035692 | Ga0373935_0240928 | Ga0373935_0240928_151_1146 | 328 |
| 265 | 3300037312 | Ga0395899_0005072 | Ga0395899_0005072_7174_8217 | 328 |
| 266 | 3300037312 | Ga0395899_0035725 | Ga0395899_0035725_2188_3252 | 328 |
| 267 | 3300037418 | Ga0395900_0008623 | Ga0395900_0008623_9447_10463 | 328 |
| 268 | 3300037418 | Ga0395900_0016804 | Ga0395900_0016804_1686_2681 | 328 |
| 269 | 3300037418 | Ga0395900_0049235 | Ga0395900_0049235_1178_2245 | 328 |
| 270 | 3300037418 | Ga0395900_0062933 | Ga0395900_0062933_2272_3336 | 328 |
| 271 | 3300037418 | Ga0395900_0121936 | Ga0395900_0121936_250_1293 | 328 |
| 272 | 3300037418 | Ga0395900_0208850 | Ga0395900_0208850_163_1206 | 328 |
| 273 | 3300037418 | Ga0395900_0302267 | Ga0395900_0302267_510_1553 | 328 |
| 274 | 3300037418 | Ga0395900_0499018 | Ga0395900_0499018_145_1140 | 328 |
| 275 | 3300037471 | Ga0395905_0001635 | Ga0395905_0001635_6595_7590 | 328 |
| 276 | 3300037471 | Ga0395905_0007828 | Ga0395905_0007828_8498_9514 | 328 |
| 277 | 3300037471 | Ga0395905_0011111 | Ga0395905_0011111_704_1699 | 328 |
| 278 | 3300037471 | Ga0395905_0073349 | Ga0395905_0073349_939_1955 | 328 |
| 279 | 3300037471 | Ga0395905_0150559 | Ga0395905_0150559_187_1248 | 328 |
| 280 | 3300037471 | Ga0395905_0192366 | Ga0395905_0192366_866_1882 | 328 |
| 281 | 3300037471 | Ga0395905_0279384 | Ga0395905_0279384_213_1256 | 328 |
| 282 | 3300037471 | Ga0395905_0489808 | Ga0395905_0489808_68_1111 | 328 |
| 283 | 3300038443 | Ga0395901_0006151 | Ga0395901_0006151_6053_7048 | 328 |
| 284 | 3300038443 | Ga0395901_0064624 | Ga0395901_0064624_1957_2952 | 328 |
| 285 | 3300038443 | Ga0395901_0069957 | Ga0395901_0069957_2330_3397 | 328 |
| 286 | 3300038443 | Ga0395901_0103501 | Ga0395901_0103501_203_1219 | 328 |
| 287 | 3300042005 | Ga0439448_0000637 | Ga0439448_0000637_4962_5978 | 328 |
| 288 | 3300042157 | Ga0439458_0000016 | Ga0439458_0000016_23161_24177 | 328 |
| 289 | 3300044684 | Ga0466966_0013208 | Ga0466966_0013208_255_1271 | 328 |
| 290 | 3300044693 | Ga0466961_0018514 | Ga0466961_0018514_2688_3683 | 328 |
| 291 | 3300044693 | Ga0466961_0102886 | Ga0466961_0102886_255_1271 | 328 |
| 292 | 3300044694 | Ga0466963_0013250 | Ga0466963_0013250_697_1740 | 328 |
| 293 | 3300044694 | Ga0466963_0081359 | Ga0466963_0081359_778_1839 | 328 |
| 294 | 3300044706 | Ga0466964_0002041 | Ga0466964_0002041_5232_6227 | 328 |
| 295 | 3300044706 | Ga0466964_0005969 | Ga0466964_0005969_1159_2175 | 328 |
| 296 | 3300044719 | Ga0466971_0024715 | Ga0466971_0024715_1411_2427 | 328 |
| 297 | 3300044719 | Ga0466971_0096837 | Ga0466971_0096837_34_1029 | 328 |
| 298 | 3300044719 | Ga0466971_0100158 | Ga0466971_0100158_212_1228 | 328 |
| 299 | 3300044735 | Ga0466968_0004014 | Ga0466968_0004014_2607_3602 | 328 |
| 300 | 3300044765 | Ga0466970_0009178 | Ga0466970_0009178_3009_4004 | 328 |
| 301 | 3300044765 | Ga0466970_0091847 | Ga0466970_0091847_499_1515 | 328 |
| 302 | 3300044842 | Ga0466957_0001921 | Ga0466957_0001921_275_1291 | 328 |
| 303 | 3300044842 | Ga0466957_0150634 | Ga0466957_0150634_246_1241 | 328 |
| 304 | 3300044901 | Ga0466960_0026512 | Ga0466960_0026512_185_1201 | 328 |
| 305 | 3300045049 | Ga0466959_0274831 | Ga0466959_0274831_30_1025 | 328 |
| 306 | 3300045836 | Ga0466958_0002038 | Ga0466958_0002038_380_1375 | 328 |
| 307 | 3300045836 | Ga0466958_0032577 | Ga0466958_0032577_156_1217 | 328 |
| 308 | 3300045976 | Ga0466967_0075060 | Ga0466967_0075060_495_1490 | 328 |
| 309 | 3300046459 | Ga0495629_0196770 | Ga0495629_0196770_76_1092 | 328 |
| 310 | 3300046537 | Ga0495598_0073591 | Ga0495598_0073591_12_1022 | 328 |
| 311 | 3300046691 | Ga0495670_0010361 | Ga0495670_0010361_2351_3361 | 328 |
| 312 | 3300048903 | Ga0496100_0000581 | Ga0496100_0000581_2701_3711 | 328 |
| 313 | 3300048904 | Ga0496101_0007992 | Ga0496101_0007992_1487_2497 | 328 |
| 314 | 3300048906 | Ga0496103_0183757 | Ga0496103_0183757_88_1098 | 328 |
| 315 | 3300048907 | Ga0496104_0059996 | Ga0496104_0059996_2451_3461 | 328 |
| 316 | 3300048908 | Ga0496105_0012290 | Ga0496105_0012290_5385_6395 | 328 |
| 317 | 3300048909 | Ga0496106_0016741 | Ga0496106_0016741_2694_3704 | 328 |
| 318 | 3300048910 | Ga0496107_0008596 | Ga0496107_0008596_3565_4608 | 328 |
| 319 | 3300048911 | Ga0496108_0111999 | Ga0496108_0111999_502_1512 | 328 |
| 320 | 3300048912 | Ga0496109_0066459 | Ga0496109_0066459_1790_2800 | 328 |
| 321 | 3300048912 | Ga0496109_0159326 | Ga0496109_0159326_603_1613 | 328 |
| 322 | 3300048913 | Ga0496110_0004364 | Ga0496110_0004364_9866_10876 | 328 |
| 323 | 3300048914 | Ga0496111_0057480 | Ga0496111_0057480_369_1379 | 328 |
| 324 | 3300048915 | Ga0496112_0014432 | Ga0496112_0014432_756_1766 | 328 |
| 325 | 3300048915 | Ga0496112_0025959 | Ga0496112_0025959_4552_5562 | 328 |
| 326 | 3300048917 | Ga0496114_0000131 | Ga0496114_0000131_25406_26434 | 328 |
| 327 | 3300048917 | Ga0496114_0044424 | Ga0496114_0044424_305_1348 | 328 |
| 328 | 3300048917 | Ga0496114_0151961 | Ga0496114_0151961_47_1057 | 328 |
| 329 | 3300048918 | Ga0496115_0019427 | Ga0496115_0019427_2166_3209 | 328 |
| 330 | 3300049668 | Ga0501233_040922 | Ga0501233_040922_46_1062 | 328 |
| 331 | 3300061719 | Ga0466962_0016490 | Ga0466962_0016490_1960_2976 | 328 |
| 332 | 3300061719 | Ga0466962_0084563 | Ga0466962_0084563_397_1413 | 328 |
| 333 | 3300005344 | Ga0070661_100149375 | Ga0070661_1001493752 | 329 |
| 334 | 3300005539 | Ga0068853_100072022 | Ga0068853_1000720222 | 329 |
| 335 | 3300005578 | Ga0068854_100140556 | Ga0068854_1001405561 | 329 |
| 336 | 3300005616 | Ga0068852_100010717 | Ga0068852_1000107174 | 329 |
| 337 | 3300009545 | Ga0105237_10072879 | Ga0105237_100728793 | 329 |
| 338 | 3300009551 | Ga0105238_10014359 | Ga0105238_100143598 | 329 |
| 339 | 3300013100 | Ga0157373_10202143 | Ga0157373_102021432 | 329 |
| 340 | 3300013102 | Ga0157371_10043367 | Ga0157371_100433673 | 329 |
| 341 | 3300013104 | Ga0157370_10017359 | Ga0157370_100173596 | 329 |
| 342 | 3300013105 | Ga0157369_10011956 | Ga0157369_100119562 | 329 |
| 343 | 3300025909 | Ga0207705_10025698 | Ga0207705_100256982 | 329 |
| 344 | 3300025919 | Ga0207657_10014704 | Ga0207657_100147045 | 329 |
| 345 | 3300025924 | Ga0207694_10008340 | Ga0207694_100083402 | 329 |
| 346 | 3300025932 | Ga0207690_10031693 | Ga0207690_100316933 | 329 |
| 347 | 3300026041 | Ga0207639_10093431 | Ga0207639_100934313 | 329 |
| 348 | 3300026142 | Ga0207698_10005196 | Ga0207698_100051966 | 329 |
| 349 | 3300037312 | Ga0395899_0012804 | Ga0395899_0012804_4797_5807 | 329 |
| 350 | 3300037312 | Ga0395899_0183492 | Ga0395899_0183492_239_1255 | 329 |
| 351 | 3300037418 | Ga0395900_0160920 | Ga0395900_0160920_927_2099 | 329 |
| 352 | 3300037418 | Ga0395900_0171327 | Ga0395900_0171327_579_1589 | 329 |
| 353 | 3300037466 | Ga0395898_0024035 | Ga0395898_0024035_579_1589 | 329 |
| 354 | 3300037471 | Ga0395905_0027023 | Ga0395905_0027023_41_1051 | 329 |
| 355 | 3300037471 | Ga0395905_0282021 | Ga0395905_0282021_335_1351 | 329 |
| 356 | 3300038443 | Ga0395901_0042350 | Ga0395901_0042350_1379_2389 | 329 |
| 357 | 3300038443 | Ga0395901_0355885 | Ga0395901_0355885_71_1087 | 329 |
| 358 | 3300044706 | Ga0466964_0038247 | Ga0466964_0038247_871_1887 | 329 |
| 359 | 3300045976 | Ga0466967_0007335 | Ga0466967_0007335_4627_5637 | 329 |
| 360 | 3300045976 | Ga0466967_0008133 | Ga0466967_0008133_2278_3291 | 329 |
| 361 | 3300005327 | Ga0070658_10086254 | Ga0070658_100862542 | 330 |
| 362 | 3300005347 | Ga0070668_100154036 | Ga0070668_1001540362 | 330 |
| 363 | 3300005364 | Ga0070673_100007637 | Ga0070673_1000076372 | 330 |
| 364 | 3300005456 | Ga0070678_100137975 | Ga0070678_1001379752 | 330 |
| 365 | 3300005539 | Ga0068853_100052656 | Ga0068853_1000526562 | 330 |
| 366 | 3300005543 | Ga0070672_100041357 | Ga0070672_1000413574 | 330 |
| 367 | 3300005548 | Ga0070665_100012043 | Ga0070665_1000120435 | 330 |
| 368 | 3300005578 | Ga0068854_100126169 | Ga0068854_1001261692 | 330 |
| 369 | 3300013296 | Ga0157374_10056936 | Ga0157374_100569364 | 330 |
| 370 | 3300013306 | Ga0163162_10217821 | Ga0163162_102178211 | 330 |
| 371 | 3300013308 | Ga0157375_10024631 | Ga0157375_100246314 | 330 |
| 372 | 3300025909 | Ga0207705_10035958 | Ga0207705_100359582 | 330 |
| 373 | 3300025926 | Ga0207659_10019935 | Ga0207659_100199353 | 330 |
| 374 | 3300025940 | Ga0207691_10052542 | Ga0207691_100525424 | 330 |
| 375 | 3300025960 | Ga0207651_10029871 | Ga0207651_100298714 | 330 |
| 376 | 3300025986 | Ga0207658_10083280 | Ga0207658_100832803 | 330 |
| 377 | 3300026023 | Ga0207677_10087902 | Ga0207677_100879023 | 330 |
| 378 | 3300026078 | Ga0207702_10227644 | Ga0207702_102276442 | 330 |
| 379 | 3300026121 | Ga0207683_10135312 | Ga0207683_101353122 | 330 |
| 380 | 3300028379 | Ga0268266_10017076 | Ga0268266_100170764 | 330 |
| 381 | 3300031548 | Ga0307408_100097161 | Ga0307408_1000971612 | 330 |
| 382 | 3300037466 | Ga0395898_0291047 | Ga0395898_0291047_262_1443 | 330 |
| 383 | 3300038443 | Ga0395901_0417439 | Ga0395901_0417439_164_1345 | 330 |
| 384 | 3300031995 | Ga0307409_100106366 | Ga0307409_1001063662 | 331 |
| 385 | 3300032005 | Ga0307411_10002357 | Ga0307411_100023572 | 331 |
| 386 | 3300032005 | Ga0307411_10066948 | Ga0307411_100669481 | 331 |
| 387 | 3300005327 | Ga0070658_10331020 | Ga0070658_103310201 | 332 |
| 388 | 3300005338 | Ga0068868_100029630 | Ga0068868_1000296303 | 332 |
| 389 | 3300005354 | Ga0070675_100026701 | Ga0070675_1000267014 | 332 |
| 390 | 3300005455 | Ga0070663_100032667 | Ga0070663_1000326673 | 332 |
| 391 | 3300005616 | Ga0068852_100024314 | Ga0068852_1000243143 | 332 |
| 392 | 3300006847 | Ga0075431_100033856 | Ga0075431_1000338564 | 332 |
| 393 | 3300013102 | Ga0157371_10086739 | Ga0157371_100867392 | 332 |
| 394 | 3300013296 | Ga0157374_10054329 | Ga0157374_100543294 | 332 |
| 395 | 3300025909 | Ga0207705_10039435 | Ga0207705_100394354 | 332 |
| 396 | 3300025920 | Ga0207649_10025315 | Ga0207649_100253153 | 332 |
| 397 | 3300026067 | Ga0207678_10009957 | Ga0207678_100099579 | 332 |
| 398 | 3300045049 | Ga0466959_0252823 | Ga0466959_0252823_19_1176 | 332 |
| 399 | 3300050510 | nmdc:mga06r32_22563_c1 | nmdc:mga06r32_22563_c1_3533_4708 | 332 |
| 400 | 3300026067 | Ga0207678_10035314 | Ga0207678_100353144 | 333 |
| 401 | 3300026088 | Ga0207641_10068451 | Ga0207641_100684513 | 334 |
| 402 | 3300031731 | Ga0307405_10125226 | Ga0307405_101252262 | 334 |
| 403 | 3300031901 | Ga0307406_10071477 | Ga0307406_100714772 | 334 |
| 404 | 3300031903 | Ga0307407_10062513 | Ga0307407_100625132 | 334 |
| 405 | 3300031911 | Ga0307412_10133415 | Ga0307412_101334152 | 334 |
| 406 | 3300031995 | Ga0307409_100205501 | Ga0307409_1002055012 | 334 |
| 407 | 3300032002 | Ga0307416_100194829 | Ga0307416_1001948292 | 334 |
| 408 | 3300032126 | Ga0307415_100065850 | Ga0307415_1000658503 | 334 |
| 409 | 3300038443 | Ga0395901_0178628 | Ga0395901_0178628_590_1783 | 334 |
| 410 | 3300045976 | Ga0466967_0123773 | Ga0466967_0123773_520_1698 | 334 |
| 411 | 3300046691 | Ga0495670_0175144 | Ga0495670_0175144_54_1103 | 334 |
| 412 | 3300005327 | Ga0070658_10008348 | Ga0070658_100083484 | 335 |
| 413 | 3300005329 | Ga0070683_100002246 | Ga0070683_10000224614 | 335 |
| 414 | 3300005336 | Ga0070680_100004263 | Ga0070680_1000042638 | 335 |
| 415 | 3300005339 | Ga0070660_100017486 | Ga0070660_1000174863 | 335 |
| 416 | 3300005341 | Ga0070691_10005847 | Ga0070691_100058473 | 335 |
| 417 | 3300005344 | Ga0070661_100211041 | Ga0070661_1002110412 | 335 |
| 418 | 3300005535 | Ga0070684_100009105 | Ga0070684_1000091057 | 335 |
| 419 | 3300005577 | Ga0068857_100008864 | Ga0068857_1000088647 | 335 |
| 420 | 3300020069 | Ga0197907_10556007 | Ga0197907_105560072 | 335 |
| 421 | 3300020070 | Ga0206356_11135239 | Ga0206356_111352392 | 335 |
| 422 | 3300025932 | Ga0207690_10076812 | Ga0207690_100768123 | 335 |
| 423 | 3300025944 | Ga0207661_10022219 | Ga0207661_100222192 | 335 |
| 424 | 3300025981 | Ga0207640_10010153 | Ga0207640_100101534 | 335 |
| 425 | 3300026116 | Ga0207674_10000580 | Ga0207674_1000058018 | 335 |
| 426 | 3300026142 | Ga0207698_10003377 | Ga0207698_100033775 | 335 |
| 427 | 3300031731 | Ga0307405_10021078 | Ga0307405_100210782 | 335 |
| 428 | 3300032005 | Ga0307411_10019918 | Ga0307411_100199183 | 335 |
| 429 | 3300032005 | Ga0307411_10145936 | Ga0307411_101459362 | 335 |
| 430 | 3300045976 | Ga0466967_0073433 | Ga0466967_0073433_1362_2417 | 335 |
| 431 | 3300005564 | Ga0070664_100002634 | Ga0070664_1000026347 | 336 |
| 432 | 3300005577 | Ga0068857_100097814 | Ga0068857_1000978141 | 336 |
| 433 | 3300005578 | Ga0068854_100031056 | Ga0068854_1000310564 | 336 |
| 434 | 3300005614 | Ga0068856_100050939 | Ga0068856_1000509394 | 336 |
| 435 | 3300013105 | Ga0157369_10029017 | Ga0157369_100290176 | 336 |
| 436 | 3300025919 | Ga0207657_10033062 | Ga0207657_100330624 | 336 |
| 437 | 3300025937 | Ga0207669_10027204 | Ga0207669_100272043 | 336 |
| 438 | 3300025945 | Ga0207679_10029532 | Ga0207679_100295322 | 336 |
| 439 | 3300026078 | Ga0207702_10031699 | Ga0207702_100316993 | 336 |
| 440 | 3300031824 | Ga0307413_10029266 | Ga0307413_100292662 | 336 |
| 441 | 3300032002 | Ga0307416_100499462 | Ga0307416_1004994621 | 336 |
| 442 | 3300032004 | Ga0307414_10049155 | Ga0307414_100491553 | 336 |
| 443 | 3300005335 | Ga0070666_10043591 | Ga0070666_100435914 | 337 |
| 444 | 3300005543 | Ga0070672_100166404 | Ga0070672_1001664042 | 337 |
| 445 | 3300025949 | Ga0207667_10462385 | Ga0207667_104623851 | 337 |
| 446 | 3300026067 | Ga0207678_10014935 | Ga0207678_100149351 | 337 |
| 447 | 3300044842 | Ga0466957_0149371 | Ga0466957_0149371_85_1161 | 337 |
| 448 | 3300045836 | Ga0466958_0000295 | Ga0466958_0000295_2251_3312 | 337 |
| 449 | 3300045976 | Ga0466967_0005395 | Ga0466967_0005395_5952_7028 | 337 |
| 450 | 3300045976 | Ga0466967_0216416 | Ga0466967_0216416_627_1688 | 337 |
| 451 | 3300061719 | Ga0466962_0028622 | Ga0466962_0028622_1287_2348 | 337 |
| 452 | 3300005327 | Ga0070658_10004834 | Ga0070658_100048344 | 338 |
| 453 | 3300005334 | Ga0068869_100062579 | Ga0068869_1000625792 | 338 |
| 454 | 3300005335 | Ga0070666_10029477 | Ga0070666_100294772 | 338 |
| 455 | 3300005455 | Ga0070663_100028142 | Ga0070663_1000281424 | 338 |
| 456 | 3300005548 | Ga0070665_100039523 | Ga0070665_1000395233 | 338 |
| 457 | 3300005577 | Ga0068857_100045474 | Ga0068857_1000454744 | 338 |
| 458 | 3300005616 | Ga0068852_100083964 | Ga0068852_1000839642 | 338 |
| 459 | 3300005617 | Ga0068859_100275797 | Ga0068859_1002757971 | 338 |
| 460 | 3300005841 | Ga0068863_100082035 | Ga0068863_1000820354 | 338 |
| 461 | 3300005842 | Ga0068858_100115449 | Ga0068858_1001154492 | 338 |
| 462 | 3300005842 | Ga0068858_100156202 | Ga0068858_1001562022 | 338 |
| 463 | 3300005843 | Ga0068860_100088338 | Ga0068860_1000883382 | 338 |
| 464 | 3300006931 | Ga0097620_100275812 | Ga0097620_1002758121 | 338 |
| 465 | 3300013104 | Ga0157370_10002976 | Ga0157370_100029769 | 338 |
| 466 | 3300014968 | Ga0157379_10056703 | Ga0157379_100567032 | 338 |
| 467 | 3300025903 | Ga0207680_10023816 | Ga0207680_100238163 | 338 |
| 468 | 3300025907 | Ga0207645_10026481 | Ga0207645_100264814 | 338 |
| 469 | 3300025907 | Ga0207645_10071189 | Ga0207645_100711893 | 338 |
| 470 | 3300025909 | Ga0207705_10006023 | Ga0207705_100060233 | 338 |
| 471 | 3300025919 | Ga0207657_10011918 | Ga0207657_100119184 | 338 |
| 472 | 3300025919 | Ga0207657_10015026 | Ga0207657_100150264 | 338 |
| 473 | 3300025925 | Ga0207650_10279417 | Ga0207650_102794172 | 338 |
| 474 | 3300025933 | Ga0207706_10282834 | Ga0207706_102828341 | 338 |
| 475 | 3300025941 | Ga0207711_10003912 | Ga0207711_100039127 | 338 |
| 476 | 3300025942 | Ga0207689_10030990 | Ga0207689_100309904 | 338 |
| 477 | 3300025986 | Ga0207658_10087172 | Ga0207658_100871722 | 338 |
| 478 | 3300025986 | Ga0207658_10095860 | Ga0207658_100958602 | 338 |
| 479 | 3300026067 | Ga0207678_10048351 | Ga0207678_100483513 | 338 |
| 480 | 3300026116 | Ga0207674_10004077 | Ga0207674_1000407714 | 338 |
| 481 | 3300028379 | Ga0268266_10005814 | Ga0268266_100058149 | 338 |
| 482 | 3300028380 | Ga0268265_10024003 | Ga0268265_100240032 | 338 |
| 483 | 3300028381 | Ga0268264_10062654 | Ga0268264_100626543 | 338 |
| 484 | 3300028381 | Ga0268264_10100992 | Ga0268264_101009922 | 338 |
| 485 | 3300031731 | Ga0307405_10137963 | Ga0307405_101379632 | 338 |
| 486 | 3300031995 | Ga0307409_100189958 | Ga0307409_1001899582 | 338 |
| 487 | 3300037466 | Ga0395898_0150568 | Ga0395898_0150568_164_1354 | 338 |
| 488 | 3300005331 | Ga0070670_100038464 | Ga0070670_1000384641 | 339 |
| 489 | 3300005334 | Ga0068869_100089202 | Ga0068869_1000892022 | 339 |
| 490 | 3300005339 | Ga0070660_100022082 | Ga0070660_1000220824 | 339 |
| 491 | 3300005354 | Ga0070675_100049464 | Ga0070675_1000494644 | 339 |
| 492 | 3300005355 | Ga0070671_100004935 | Ga0070671_1000049359 | 339 |
| 493 | 3300005355 | Ga0070671_100058126 | Ga0070671_1000581263 | 339 |
| 494 | 3300005356 | Ga0070674_100011545 | Ga0070674_1000115454 | 339 |
| 495 | 3300005364 | Ga0070673_100130371 | Ga0070673_1001303712 | 339 |
| 496 | 3300005364 | Ga0070673_100283432 | Ga0070673_1002834321 | 339 |
| 497 | 3300005366 | Ga0070659_100138708 | Ga0070659_1001387082 | 339 |
| 498 | 3300005367 | Ga0070667_100004244 | Ga0070667_1000042444 | 339 |
| 499 | 3300005367 | Ga0070667_100211125 | Ga0070667_1002111252 | 339 |
| 500 | 3300005435 | Ga0070714_100047178 | Ga0070714_1000471783 | 339 |
| 501 | 3300005435 | Ga0070714_100048939 | Ga0070714_1000489394 | 339 |
| 502 | 3300005436 | Ga0070713_100097020 | Ga0070713_1000970203 | 339 |
| 503 | 3300005455 | Ga0070663_100018346 | Ga0070663_1000183462 | 339 |
| 504 | 3300005455 | Ga0070663_100158174 | Ga0070663_1001581741 | 339 |
| 505 | 3300005456 | Ga0070678_100005149 | Ga0070678_1000051494 | 339 |
| 506 | 3300005456 | Ga0070678_100031765 | Ga0070678_1000317652 | 339 |
| 507 | 3300005457 | Ga0070662_100139834 | Ga0070662_1001398342 | 339 |
| 508 | 3300005457 | Ga0070662_100169339 | Ga0070662_1001693391 | 339 |
| 509 | 3300005459 | Ga0068867_100031841 | Ga0068867_1000318412 | 339 |
| 510 | 3300005563 | Ga0068855_100035354 | Ga0068855_1000353542 | 339 |
| 511 | 3300005564 | Ga0070664_100022958 | Ga0070664_1000229582 | 339 |
| 512 | 3300005577 | Ga0068857_100292367 | Ga0068857_1002923671 | 339 |
| 513 | 3300005578 | Ga0068854_100041012 | Ga0068854_1000410124 | 339 |
| 514 | 3300005617 | Ga0068859_100088327 | Ga0068859_1000883272 | 339 |
| 515 | 3300005618 | Ga0068864_100004851 | Ga0068864_1000048515 | 339 |
| 516 | 3300005618 | Ga0068864_100013936 | Ga0068864_1000139363 | 339 |
| 517 | 3300005841 | Ga0068863_100032850 | Ga0068863_1000328502 | 339 |
| 518 | 3300005842 | Ga0068858_100051595 | Ga0068858_1000515953 | 339 |
| 519 | 3300005843 | Ga0068860_100019113 | Ga0068860_1000191136 | 339 |
| 520 | 3300005844 | Ga0068862_100009248 | Ga0068862_1000092484 | 339 |
| 521 | 3300005844 | Ga0068862_100105117 | Ga0068862_1001051173 | 339 |
| 522 | 3300006358 | Ga0068871_100020356 | Ga0068871_1000203562 | 339 |
| 523 | 3300006844 | Ga0075428_100078249 | Ga0075428_1000782492 | 339 |
| 524 | 3300006931 | Ga0097620_100088321 | Ga0097620_1000883213 | 339 |
| 525 | 3300009177 | Ga0105248_10013832 | Ga0105248_100138325 | 339 |
| 526 | 3300013104 | Ga0157370_10004977 | Ga0157370_1000497714 | 339 |
| 527 | 3300013306 | Ga0163162_10040346 | Ga0163162_100403463 | 339 |
| 528 | 3300014325 | Ga0163163_10021539 | Ga0163163_100215394 | 339 |
| 529 | 3300014326 | Ga0157380_10257164 | Ga0157380_102571641 | 339 |
| 530 | 3300014968 | Ga0157379_10023074 | Ga0157379_100230743 | 339 |
| 531 | 3300025901 | Ga0207688_10003267 | Ga0207688_100032674 | 339 |
| 532 | 3300025903 | Ga0207680_10013048 | Ga0207680_100130483 | 339 |
| 533 | 3300025903 | Ga0207680_10170749 | Ga0207680_101707491 | 339 |
| 534 | 3300025904 | Ga0207647_10012589 | Ga0207647_100125894 | 339 |
| 535 | 3300025907 | Ga0207645_10057981 | Ga0207645_100579813 | 339 |
| 536 | 3300025907 | Ga0207645_10074680 | Ga0207645_100746802 | 339 |
| 537 | 3300025917 | Ga0207660_10015525 | Ga0207660_100155255 | 339 |
| 538 | 3300025919 | Ga0207657_10001024 | Ga0207657_1000102417 | 339 |
| 539 | 3300025919 | Ga0207657_10027580 | Ga0207657_100275805 | 339 |
| 540 | 3300025919 | Ga0207657_10042043 | Ga0207657_100420434 | 339 |
| 541 | 3300025919 | Ga0207657_10049387 | Ga0207657_100493872 | 339 |
| 542 | 3300025921 | Ga0207652_10007390 | Ga0207652_100073904 | 339 |
| 543 | 3300025921 | Ga0207652_10221817 | Ga0207652_102218172 | 339 |
| 544 | 3300025925 | Ga0207650_10003838 | Ga0207650_100038381 | 339 |
| 545 | 3300025925 | Ga0207650_10203172 | Ga0207650_102031722 | 339 |
| 546 | 3300025926 | Ga0207659_10315937 | Ga0207659_103159371 | 339 |
| 547 | 3300025929 | Ga0207664_10041131 | Ga0207664_100411314 | 339 |
| 548 | 3300025929 | Ga0207664_10136390 | Ga0207664_101363902 | 339 |
| 549 | 3300025931 | Ga0207644_10000695 | Ga0207644_1000069522 | 339 |
| 550 | 3300025931 | Ga0207644_10003518 | Ga0207644_100035183 | 339 |
| 551 | 3300025931 | Ga0207644_10030225 | Ga0207644_100302253 | 339 |
| 552 | 3300025933 | Ga0207706_10020906 | Ga0207706_100209064 | 339 |
| 553 | 3300025933 | Ga0207706_10031673 | Ga0207706_100316734 | 339 |
| 554 | 3300025933 | Ga0207706_10035989 | Ga0207706_100359892 | 339 |
| 555 | 3300025937 | Ga0207669_10054465 | Ga0207669_100544652 | 339 |
| 556 | 3300025940 | Ga0207691_10072249 | Ga0207691_100722491 | 339 |
| 557 | 3300025940 | Ga0207691_10078368 | Ga0207691_100783684 | 339 |
| 558 | 3300025941 | Ga0207711_10003910 | Ga0207711_100039108 | 339 |
| 559 | 3300025941 | Ga0207711_10004265 | Ga0207711_100042659 | 339 |
| 560 | 3300025941 | Ga0207711_10017606 | Ga0207711_100176063 | 339 |
| 561 | 3300025941 | Ga0207711_10025078 | Ga0207711_100250782 | 339 |
| 562 | 3300025942 | Ga0207689_10010558 | Ga0207689_100105583 | 339 |
| 563 | 3300025944 | Ga0207661_10047354 | Ga0207661_100473543 | 339 |
| 564 | 3300025945 | Ga0207679_10026680 | Ga0207679_100266804 | 339 |
| 565 | 3300025945 | Ga0207679_10055859 | Ga0207679_100558592 | 339 |
| 566 | 3300025949 | Ga0207667_10070189 | Ga0207667_100701894 | 339 |
| 567 | 3300025960 | Ga0207651_10037678 | Ga0207651_100376783 | 339 |
| 568 | 3300025960 | Ga0207651_10248492 | Ga0207651_102484922 | 339 |
| 569 | 3300025972 | Ga0207668_10268168 | Ga0207668_102681682 | 339 |
| 570 | 3300025981 | Ga0207640_10040461 | Ga0207640_100404613 | 339 |
| 571 | 3300025986 | Ga0207658_10008048 | Ga0207658_100080484 | 339 |
| 572 | 3300026035 | Ga0207703_10007329 | Ga0207703_100073294 | 339 |
| 573 | 3300026035 | Ga0207703_10076991 | Ga0207703_100769913 | 339 |
| 574 | 3300026067 | Ga0207678_10180317 | Ga0207678_101803172 | 339 |
| 575 | 3300026088 | Ga0207641_10016993 | Ga0207641_100169933 | 339 |
| 576 | 3300026088 | Ga0207641_10021361 | Ga0207641_100213615 | 339 |
| 577 | 3300026089 | Ga0207648_10004524 | Ga0207648_100045244 | 339 |
| 578 | 3300026095 | Ga0207676_10005936 | Ga0207676_100059363 | 339 |
| 579 | 3300026095 | Ga0207676_10023746 | Ga0207676_100237464 | 339 |
| 580 | 3300026095 | Ga0207676_10059590 | Ga0207676_100595903 | 339 |
| 581 | 3300026095 | Ga0207676_10313384 | Ga0207676_103133841 | 339 |
| 582 | 3300026116 | Ga0207674_10016922 | Ga0207674_100169221 | 339 |
| 583 | 3300026116 | Ga0207674_10067314 | Ga0207674_100673141 | 339 |
| 584 | 3300026121 | Ga0207683_10013603 | Ga0207683_100136034 | 339 |
| 585 | 3300026121 | Ga0207683_10026173 | Ga0207683_100261733 | 339 |
| 586 | 3300028379 | Ga0268266_10042006 | Ga0268266_100420064 | 339 |
| 587 | 3300028380 | Ga0268265_10008727 | Ga0268265_100087274 | 339 |
| 588 | 3300028380 | Ga0268265_10015327 | Ga0268265_100153274 | 339 |
| 589 | 3300028380 | Ga0268265_10041475 | Ga0268265_100414753 | 339 |
| 590 | 3300028381 | Ga0268264_10024352 | Ga0268264_100243523 | 339 |
| 591 | 3300031548 | Ga0307408_100020083 | Ga0307408_1000200832 | 339 |
| 592 | 3300031731 | Ga0307405_10078346 | Ga0307405_100783461 | 339 |
| 593 | 3300031824 | Ga0307413_10001062 | Ga0307413_100010625 | 339 |
| 594 | 3300031824 | Ga0307413_10002669 | Ga0307413_100026695 | 339 |
| 595 | 3300031824 | Ga0307413_10074461 | Ga0307413_100744612 | 339 |
| 596 | 3300031852 | Ga0307410_10001721 | Ga0307410_100017217 | 339 |
| 597 | 3300031852 | Ga0307410_10035650 | Ga0307410_100356502 | 339 |
| 598 | 3300031852 | Ga0307410_10144018 | Ga0307410_101440182 | 339 |
| 599 | 3300031995 | Ga0307409_100019838 | Ga0307409_1000198384 | 339 |
| 600 | 3300031995 | Ga0307409_100068196 | Ga0307409_1000681962 | 339 |
| 601 | 3300032002 | Ga0307416_100019713 | Ga0307416_1000197134 | 339 |
| 602 | 3300032002 | Ga0307416_100069269 | Ga0307416_1000692693 | 339 |
| 603 | 3300032002 | Ga0307416_100104607 | Ga0307416_1001046072 | 339 |
| 604 | 3300032004 | Ga0307414_10077496 | Ga0307414_100774962 | 339 |
| 605 | 3300032004 | Ga0307414_10217674 | Ga0307414_102176742 | 339 |
| 606 | 3300032005 | Ga0307411_10001070 | Ga0307411_100010708 | 339 |
| 607 | 3300032005 | Ga0307411_10010399 | Ga0307411_100103994 | 339 |
| 608 | 3300032005 | Ga0307411_10012286 | Ga0307411_100122865 | 339 |
| 609 | 3300032005 | Ga0307411_10023867 | Ga0307411_100238673 | 339 |
| 610 | 3300032005 | Ga0307411_10034033 | Ga0307411_100340332 | 339 |
| 611 | 3300032005 | Ga0307411_10039289 | Ga0307411_100392894 | 339 |
| 612 | 3300032126 | Ga0307415_100007081 | Ga0307415_1000070816 | 339 |
| 613 | 3300032126 | Ga0307415_100015345 | Ga0307415_1000153452 | 339 |
| 614 | 3300037312 | Ga0395899_0000225 | Ga0395899_0000225_19225_20415 | 339 |
| 615 | 3300037312 | Ga0395899_0005006 | Ga0395899_0005006_6008_7201 | 339 |
| 616 | 3300037312 | Ga0395899_0025569 | Ga0395899_0025569_3030_4211 | 339 |
| 617 | 3300037312 | Ga0395899_0148385 | Ga0395899_0148385_96_1289 | 339 |
| 618 | 3300037418 | Ga0395900_0000667 | Ga0395900_0000667_903_2093 | 339 |
| 619 | 3300037418 | Ga0395900_0002993 | Ga0395900_0002993_4025_5218 | 339 |
| 620 | 3300037418 | Ga0395900_0006074 | Ga0395900_0006074_9401_10594 | 339 |
| 621 | 3300037418 | Ga0395900_0009437 | Ga0395900_0009437_938_2128 | 339 |
| 622 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_158711_159901 | 339 |
| 623 | 3300037466 | Ga0395898_0004704 | Ga0395898_0004704_1103_2296 | 339 |
| 624 | 3300037466 | Ga0395898_0009837 | Ga0395898_0009837_8104_9294 | 339 |
| 625 | 3300037466 | Ga0395898_0053101 | Ga0395898_0053101_942_2132 | 339 |
| 626 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_374963_376153 | 339 |
| 627 | 3300037471 | Ga0395905_0003067 | Ga0395905_0003067_9287_10480 | 339 |
| 628 | 3300037471 | Ga0395905_0003264 | Ga0395905_0003264_7519_8709 | 339 |
| 629 | 3300037471 | Ga0395905_0011066 | Ga0395905_0011066_1538_2731 | 339 |
| 630 | 3300038443 | Ga0395901_0000329 | Ga0395901_0000329_56143_57324 | 339 |
| 631 | 3300038443 | Ga0395901_0004318 | Ga0395901_0004318_8361_9551 | 339 |
| 632 | 3300038443 | Ga0395901_0006951 | Ga0395901_0006951_4025_5218 | 339 |
| 633 | 3300038443 | Ga0395901_0010278 | Ga0395901_0010278_7410_8600 | 339 |
| 634 | 3300038443 | Ga0395901_0016246 | Ga0395901_0016246_4554_5744 | 339 |
| 635 | 3300039437 | Ga0436365_0802722 | Ga0436365_0802722_3356_4552 | 339 |
| 636 | 3300044842 | Ga0466957_0011549 | Ga0466957_0011549_1887_3071 | 339 |
| 637 | 3300045049 | Ga0466959_0020664 | Ga0466959_0020664_3036_4226 | 339 |
| 638 | 3300045049 | Ga0466959_0052885 | Ga0466959_0052885_1714_2886 | 339 |
| 639 | 3300045976 | Ga0466967_0022827 | Ga0466967_0022827_1399_2583 | 339 |
| 640 | 3300048905 | Ga0496102_0282302 | Ga0496102_0282302_245_1438 | 339 |
| 641 | 3300048914 | Ga0496111_0057825 | Ga0496111_0057825_1480_2673 | 339 |
| 642 | 3300048915 | Ga0496112_0105724 | Ga0496112_0105724_778_1968 | 339 |
| 643 | 3300001990 | JGI24737J22298_10000380 | JGI24737J22298_100003803 | 340 |
| 644 | 3300002075 | JGI24738J21930_10000111 | JGI24738J21930_100001119 | 340 |
| 645 | 3300005327 | Ga0070658_10000950 | Ga0070658_1000095026 | 340 |
| 646 | 3300005327 | Ga0070658_10255510 | Ga0070658_102555101 | 340 |
| 647 | 3300005329 | Ga0070683_100001317 | Ga0070683_10000131717 | 340 |
| 648 | 3300005335 | Ga0070666_10000451 | Ga0070666_1000045124 | 340 |
| 649 | 3300005337 | Ga0070682_100004206 | Ga0070682_1000042065 | 340 |
| 650 | 3300005339 | Ga0070660_100000260 | Ga0070660_10000026036 | 340 |
| 651 | 3300005339 | Ga0070660_100187038 | Ga0070660_1001870382 | 340 |
| 652 | 3300005344 | Ga0070661_100000246 | Ga0070661_10000024644 | 340 |
| 653 | 3300005344 | Ga0070661_100026287 | Ga0070661_1000262874 | 340 |
| 654 | 3300005355 | Ga0070671_100065621 | Ga0070671_1000656214 | 340 |
| 655 | 3300005366 | Ga0070659_100000195 | Ga0070659_10000019519 | 340 |
| 656 | 3300005366 | Ga0070659_100094138 | Ga0070659_1000941382 | 340 |
| 657 | 3300005367 | Ga0070667_100015921 | Ga0070667_1000159215 | 340 |
| 658 | 3300005444 | Ga0070694_100060286 | Ga0070694_1000602862 | 340 |
| 659 | 3300005457 | Ga0070662_100000047 | Ga0070662_10000004719 | 340 |
| 660 | 3300005458 | Ga0070681_10063843 | Ga0070681_100638432 | 340 |
| 661 | 3300005539 | Ga0068853_100000033 | Ga0068853_10000003370 | 340 |
| 662 | 3300005547 | Ga0070693_100011462 | Ga0070693_1000114624 | 340 |
| 663 | 3300005548 | Ga0070665_100011256 | Ga0070665_1000112561 | 340 |
| 664 | 3300005563 | Ga0068855_100000531 | Ga0068855_10000053119 | 340 |
| 665 | 3300005563 | Ga0068855_100160182 | Ga0068855_1001601823 | 340 |
| 666 | 3300005563 | Ga0068855_100283969 | Ga0068855_1002839691 | 340 |
| 667 | 3300005564 | Ga0070664_100000242 | Ga0070664_10000024224 | 340 |
| 668 | 3300005564 | Ga0070664_100088858 | Ga0070664_1000888583 | 340 |
| 669 | 3300005614 | Ga0068856_100000162 | Ga0068856_10000016218 | 340 |
| 670 | 3300005614 | Ga0068856_100066587 | Ga0068856_1000665872 | 340 |
| 671 | 3300005616 | Ga0068852_100002549 | Ga0068852_1000025494 | 340 |
| 672 | 3300005616 | Ga0068852_100073146 | Ga0068852_1000731463 | 340 |
| 673 | 3300005617 | Ga0068859_100067894 | Ga0068859_1000678943 | 340 |
| 674 | 3300005618 | Ga0068864_100001290 | Ga0068864_1000012907 | 340 |
| 675 | 3300005618 | Ga0068864_100103308 | Ga0068864_1001033082 | 340 |
| 676 | 3300005834 | Ga0068851_10023139 | Ga0068851_100231392 | 340 |
| 677 | 3300005841 | Ga0068863_100187812 | Ga0068863_1001878122 | 340 |
| 678 | 3300005842 | Ga0068858_100029353 | Ga0068858_1000293532 | 340 |
| 679 | 3300006237 | Ga0097621_100254467 | Ga0097621_1002544671 | 340 |
| 680 | 3300006931 | Ga0097620_100067896 | Ga0097620_1000678962 | 340 |
| 681 | 3300009011 | Ga0105251_10047806 | Ga0105251_100478062 | 340 |
| 682 | 3300009177 | Ga0105248_10004029 | Ga0105248_100040293 | 340 |
| 683 | 3300009545 | Ga0105237_10166447 | Ga0105237_101664472 | 340 |
| 684 | 3300011119 | Ga0105246_10018923 | Ga0105246_100189235 | 340 |
| 685 | 3300013296 | Ga0157374_10072681 | Ga0157374_100726813 | 340 |
| 686 | 3300021388 | Ga0213875_10011468 | Ga0213875_100114684 | 340 |
| 687 | 3300025321 | Ga0207656_10016728 | Ga0207656_100167283 | 340 |
| 688 | 3300025903 | Ga0207680_10000681 | Ga0207680_100006814 | 340 |
| 689 | 3300025909 | Ga0207705_10000062 | Ga0207705_10000062115 | 340 |
| 690 | 3300025909 | Ga0207705_10011342 | Ga0207705_100113424 | 340 |
| 691 | 3300025909 | Ga0207705_10076232 | Ga0207705_100762321 | 340 |
| 692 | 3300025909 | Ga0207705_10192486 | Ga0207705_101924861 | 340 |
| 693 | 3300025912 | Ga0207707_10025005 | Ga0207707_100250054 | 340 |
| 694 | 3300025917 | Ga0207660_10039636 | Ga0207660_100396361 | 340 |
| 695 | 3300025919 | Ga0207657_10000403 | Ga0207657_1000040331 | 340 |
| 696 | 3300025919 | Ga0207657_10002900 | Ga0207657_1000290018 | 340 |
| 697 | 3300025920 | Ga0207649_10000230 | Ga0207649_1000023045 | 340 |
| 698 | 3300025920 | Ga0207649_10007546 | Ga0207649_100075463 | 340 |
| 699 | 3300025920 | Ga0207649_10018682 | Ga0207649_100186824 | 340 |
| 700 | 3300025931 | Ga0207644_10022968 | Ga0207644_100229684 | 340 |
| 701 | 3300025932 | Ga0207690_10000155 | Ga0207690_1000015530 | 340 |
| 702 | 3300025933 | Ga0207706_10000342 | Ga0207706_1000034235 | 340 |
| 703 | 3300025933 | Ga0207706_10106492 | Ga0207706_101064922 | 340 |
| 704 | 3300025933 | Ga0207706_10228078 | Ga0207706_102280782 | 340 |
| 705 | 3300025940 | Ga0207691_10093178 | Ga0207691_100931781 | 340 |
| 706 | 3300025941 | Ga0207711_10003628 | Ga0207711_100036283 | 340 |
| 707 | 3300025941 | Ga0207711_10037884 | Ga0207711_100378844 | 340 |
| 708 | 3300025945 | Ga0207679_10000213 | Ga0207679_1000021332 | 340 |
| 709 | 3300025949 | Ga0207667_10001300 | Ga0207667_1000130031 | 340 |
| 710 | 3300025986 | Ga0207658_10007346 | Ga0207658_100073467 | 340 |
| 711 | 3300026035 | Ga0207703_10026010 | Ga0207703_100260104 | 340 |
| 712 | 3300026041 | Ga0207639_10000347 | Ga0207639_100003479 | 340 |
| 713 | 3300026078 | Ga0207702_10000496 | Ga0207702_1000049619 | 340 |
| 714 | 3300026078 | Ga0207702_10022763 | Ga0207702_100227634 | 340 |
| 715 | 3300026088 | Ga0207641_10005331 | Ga0207641_100053315 | 340 |
| 716 | 3300026095 | Ga0207676_10047469 | Ga0207676_100474693 | 340 |
| 717 | 3300026095 | Ga0207676_10086094 | Ga0207676_100860942 | 340 |
| 718 | 3300026116 | Ga0207674_10000527 | Ga0207674_100005277 | 340 |
| 719 | 3300026142 | Ga0207698_10000815 | Ga0207698_100008154 | 340 |
| 720 | 3300037853 | Ga0436364_0996148 | Ga0436364_0996148_4025_5212 | 340 |
| 721 | 3300048906 | Ga0496103_0043312 | Ga0496103_0043312_594_1775 | 340 |
| 722 | 3300048908 | Ga0496105_0052613 | Ga0496105_0052613_1683_2864 | 340 |
| 723 | 3300048909 | Ga0496106_0021199 | Ga0496106_0021199_1676_2857 | 340 |
| 724 | 3300048910 | Ga0496107_0002436 | Ga0496107_0002436_8707_9891 | 340 |
| 725 | 3300048910 | Ga0496107_0005092 | Ga0496107_0005092_1345_2526 | 340 |
| 726 | 3300048910 | Ga0496107_0059320 | Ga0496107_0059320_1487_2668 | 340 |
| 727 | 3300048911 | Ga0496108_0004564 | Ga0496108_0004564_7151_8332 | 340 |
| 728 | 3300048911 | Ga0496108_0011381 | Ga0496108_0011381_835_2019 | 340 |
| 729 | 3300048913 | Ga0496110_0007127 | Ga0496110_0007127_1140_2324 | 340 |
| 730 | 3300048914 | Ga0496111_0003961 | Ga0496111_0003961_997_2178 | 340 |
| 731 | 3300048915 | Ga0496112_0010358 | Ga0496112_0010358_2921_4105 | 340 |
| 732 | 3300048915 | Ga0496112_0013820 | Ga0496112_0013820_1494_2675 | 340 |
| 733 | 3300048916 | Ga0496113_0010547 | Ga0496113_0010547_1987_3168 | 340 |
| 734 | 3300048916 | Ga0496113_0199711 | Ga0496113_0199711_356_1540 | 340 |
| 735 | 3300049590 | Ga0501074_0033320 | Ga0501074_0033320_1307_2497 | 340 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pnw-assembly1.cif.gz_A | crystal structure of membrane-bound lytic murein transglycosylase from agrobacterium tumefaciens | 0.8817 | 16 | 337 |
| 3czb-assembly2.cif.gz_A | crystal structure of putative transglycosylase from caulobacter crescentus | 0.8382 | 10 | 330 |
| 2pnw-assembly1.cif.gz_A | crystal structure of membrane-bound lytic murein transglycosylase from agrobacterium tumefaciens | 0.835 | 16 | 337 |
| 2g5d-assembly1.cif.gz_A | crystal structure of mlta from neisseria gonorrhoeae monoclinic form | 0.8131 | 10 | 331 |
| 3czb-assembly2.cif.gz_A | crystal structure of putative transglycosylase from caulobacter crescentus | 0.8043 | 10 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pnwA02 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Barwin-like endoglucanases | 0.9394 | 87 | 241 | 2.40.240.50 |
| 2pnwA02 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Barwin-like endoglucanases | 0.9002 | 87 | 241 | 2.40.240.50 |
| 2pi8C02 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Barwin-like endoglucanases | 0.8614 | 89 | 240 | 2.40.240.50 |
| 2g5dA02 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Barwin-like endoglucanases | 0.8553 | 87 | 241 | 2.40.240.50 |
| 2g5dA02 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Barwin-like endoglucanases | 0.8495 | 87 | 241 | 2.40.240.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8LYH9-F1-model_v4 | deleted | 0.9666 | 14 | 335 |
|
| AF-A0A4Q5T411-F1-model_v4 | peptidoglycan lytic exotransglycosylase (EC 4.2.2.n1) (Murein hydrolase A) | 0.966 | 214 | 335 |
GO:0004553
GO:0008933 GO:0009253 GO:0009254 GO:0019867 GO:0071555 |
| AF-A0A257YGJ1-F1-model_v4 | peptidoglycan lytic exotransglycosylase (EC 4.2.2.n1) (Murein hydrolase A) | 0.9636 | 17 | 339 |
GO:0004553
GO:0008933 GO:0009253 GO:0009254 GO:0019867 GO:0071555 |
| AF-A0A060C7V6-F1-model_v4 | MltA | 0.9615 | 142 | 255 |
GO:0004553
GO:0008933 GO:0009253 |
| AF-A0A258IDI0-F1-model_v4 | peptidoglycan lytic exotransglycosylase (EC 4.2.2.n1) (Murein hydrolase A) | 0.9513 | 14 | 335 |
GO:0004553
GO:0008933 GO:0009253 GO:0009254 GO:0019867 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar