F477971

General Info

Members Datasets Scaffolds Average Seq Length
731 370 655 265

Family's Representative Sequence

Representative Sequence 3300016635|Ga0183361_10003|Ga0183361_10003401
Length 288
Sequence MGEPMSTPAQEDVSTTTPSSNDAAGLGLAPASAIPNPGNAPDPNRAVAGRVRNFDNAKLKKDFDDQSAFLYLEDFLAPEVTAQLVAAARGLLPSVNRNYLPGHKQGGSVSRHTIDKLAPFIAQLYRSKELIGFLEKLTGDKLLLSPADDPHAYALYYYTKPGDHIGWHYDTSYYDGRRYTLLLGVIDESSCRLDYELHTRDPNKADVPGSVQIPPGGLVFFDGDKLRHRITPALDNEMRVSLTFEYVTDPNMRPWRRVISNFKDAIAYFGFRQVFSQFARRNAKGERA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2519103095 Burkholderia sp. KJ006 Isolate Nodule
14 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
15 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
16 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
17 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
18 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
19 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
20 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
21 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
22 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
23 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
24 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
25 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
26 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
27 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
28 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
29 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
30 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
31 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
32 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
33 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
34 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
35 2818991450 Burkholderia sp. 604 Isolate Unclassified
36 2818991452 Burkholderia cepacia 561 Isolate Unclassified
37 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
38 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
39 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
40 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
41 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
42 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
43 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
44 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
45 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
46 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
47 2904564687 Burkholderia sp. 571 Isolate Unclassified
48 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
49 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
50 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
51 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
52 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
53 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
54 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
55 2928163908 Burkholderia sp. 567 Isolate Unclassified
56 2928170801 Burkholderia sp. 572 Isolate Unclassified
57 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
58 2928536128 Burkholderia sola 565 Isolate Unclassified
59 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
60 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
61 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
73 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
74 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
75 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
76 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
87 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
149 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
319 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
357 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
358 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
359 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
360 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
361 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
362 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
363 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
364 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
365 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
366 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
367 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
368 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
369 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
370 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0.68
Isolates 10.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 2.33
Rhizoplane 7.11
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012066 3300001979 Bacteria 3266
2 JGI24740J21852_10046178 3300001979 Bacteria 1280
3 JGI24739J22299_10000666 3300001989 Bacteria 12365
4 JGI25156J39149_1000388 3300002705 Bacteria 27622
5 JGI25151J46595_10001559 3300003187 Bacteria 15298
6 JGI25151J46595_10001889 3300003187 Bacteria 13335
7 JGI25165J46597_1001417 3300003214 Bacteria 12948
8 rootH1_10087144 3300003316 Bacteria 2456
9 rootH2_10030674 3300003320 Bacteria 8682
10 rootL2_10043099 3300003322 Bacteria 4594
11 rootL2_10052145 3300003322 Bacteria 10309
12 JGI25160J50197_1000891 3300003354 Bacteria 15706
13 Ga0055533_1000094 3300003756 Bacteria 115741
14 Ga0055533_1008302 3300003756 Bacteria 1330
15 Ga0055532_1000003 3300003758 Bacteria 494004
16 Ga0055532_1002398 3300003758 Bacteria 3932
17 Ga0055532_1002815 3300003758 Bacteria 3340
18 Ga0055532_1002986 3300003758 Bacteria 3147
19 Ga0055527_1000006 3300003760 Bacteria 494004
20 Ga0055527_1002274 3300003760 Bacteria 3343
21 Ga0055527_1002647 3300003760 Bacteria 2931
22 Ga0055535_1000003 3300003761 Bacteria 494004
23 Ga0055535_1004527 3300003761 Bacteria 3343
24 Ga0055535_1004823 3300003761 Bacteria 3147
25 Ga0055542_1000007 3300003762 Bacteria 494004
26 Ga0055542_1004561 3300003762 Bacteria 3327
27 Ga0055542_1004854 3300003762 Bacteria 3150
28 Ga0055529_1000003 3300003763 Bacteria 494004
29 Ga0055529_1002308 3300003763 Bacteria 3813
30 Ga0055526_1007508 3300003771 Bacteria 5648
31 Ga0055526_1014101 3300003771 Bacteria 3317
32 Ga0055526_1014140 3300003771 Bacteria 3309
33 Ga0055537_1002716 3300003773 Bacteria 5762
34 Ga0055524_1001249 3300003775 Bacteria 14915
35 Ga0055524_1007937 3300003775 Bacteria 4456
36 Ga0055536_1000151 3300003781 Bacteria 59579
37 Ga0055534_1000430 3300003784 Bacteria 25069
38 Ga0055534_1002100 3300003784 Bacteria 7153
39 Ga0055528_1006793 3300003790 Bacteria 5144
40 Ga0058692_1006976 3300003856 Bacteria 3040
41 Ga0065165_1003328 3300005262 Bacteria 11475
42 Ga0070658_10008169 3300005327 Bacteria 8412
43 Ga0070658_10132222 3300005327 Bacteria 2080
44 Ga0070690_100026950 3300005330 Bacteria 3550
45 Ga0068869_100149149 3300005334 Bacteria 1812
46 Ga0070666_10003402 3300005335 Bacteria 9641
47 Ga0070666_10015929 3300005335 Bacteria 4802
48 Ga0070680_100079820 3300005336 Bacteria 2697
49 Ga0068868_100014098 3300005338 Bacteria 5884
50 Ga0070660_100000002 3300005339 Bacteria 177777
51 Ga0070660_100113586 3300005339 Bacteria 2157
52 Ga0070669_100490953 3300005353 Bacteria 1017
53 Ga0070671_100000799 3300005355 Bacteria 22726
54 Ga0070671_100115835 3300005355 Bacteria 2253
55 Ga0070674_100057507 3300005356 Bacteria 2700
56 Ga0070674_100155228 3300005356 Bacteria 1731
57 Ga0070659_100000007 3300005366 Bacteria 204358
58 Ga0070659_100441072 3300005366 Bacteria 1103
59 Ga0070667_100009756 3300005367 Bacteria 7960
60 Ga0070667_100029723 3300005367 Bacteria 4555
61 Ga0070709_10109287 3300005434 Bacteria 1856
62 Ga0070663_100002432 3300005455 Bacteria 10477
63 Ga0070663_100091781 3300005455 Bacteria 2251
64 Ga0070681_10000460 3300005458 Bacteria 33209
65 Ga0070681_10000668 3300005458 Bacteria 28378
66 Ga0068867_100085067 3300005459 Bacteria 2390
67 Ga0068867_100141927 3300005459 Bacteria 1878
68 Ga0070679_100000666 3300005530 Bacteria 29261
69 Ga0070679_100125757 3300005530 Bacteria 2546
70 Ga0070679_100245769 3300005530 Bacteria 1746
71 Ga0068853_100512113 3300005539 Bacteria 1134
72 Ga0070696_100145052 3300005546 Bacteria 1738
73 Ga0070665_100004690 3300005548 Bacteria 14269
74 Ga0070665_100221638 3300005548 Bacteria 1892
75 Ga0068855_100001590 3300005563 Bacteria 28523
76 Ga0068855_100013226 3300005563 Bacteria 9955
77 Ga0068855_100014409 3300005563 Bacteria 9518
78 Ga0068855_100076194 3300005563 Bacteria 3893
79 Ga0070664_100220927 3300005564 Bacteria 1695
80 Ga0068856_100006988 3300005614 Bacteria 11026
81 Ga0068856_100190786 3300005614 Bacteria 2063
82 Ga0070702_100038788 3300005615 Bacteria 2655
83 Ga0068852_100081166 3300005616 Bacteria 2878
84 Ga0068852_100289365 3300005616 Bacteria 1582
85 Ga0068859_100003018 3300005617 Bacteria 17065
86 Ga0068866_10096886 3300005718 Bacteria 1619
87 Ga0068870_10225532 3300005840 Bacteria 1149
88 Ga0068863_100004798 3300005841 Bacteria 13318
89 Ga0068863_100045905 3300005841 Bacteria 4146
90 Ga0068858_100002341 3300005842 Bacteria 19143
91 Ga0068858_100040355 3300005842 Bacteria 4328
92 Ga0068860_100038141 3300005843 Bacteria 4597
93 Ga0070717_10727163 3300006028 Bacteria 902
94 Ga0070715_10047205 3300006163 Bacteria 1834
95 Ga0070716_100017471 3300006173 Bacteria 3720
96 Ga0070716_100025956 3300006173 Bacteria 3133
97 Ga0070712_100029151 3300006175 Bacteria 3698
98 Ga0075428_100512579 3300006844 Bacteria 1283
99 Ga0068865_100050034 3300006881 Bacteria 2885
100 Ga0097620_100003018 3300006931 Bacteria 17065
101 Ga0105251_10000714 3300009011 Bacteria 30597
102 Ga0105251_10001186 3300009011 Bacteria 22567
103 Ga0105251_10018195 3300009011 Bacteria 3742
104 Ga0105251_10048349 3300009011 Bacteria 2039
105 Ga0105240_10010335 3300009093 Bacteria 13132
106 Ga0105240_10012433 3300009093 Bacteria 11750
107 Ga0105240_10015865 3300009093 Bacteria 10221
108 Ga0105240_10054386 3300009093 Bacteria 5016
109 Ga0105240_10076405 3300009093 Bacteria 4129
110 Ga0105240_10129030 3300009093 Bacteria 3035
111 Ga0105240_10391096 3300009093 Bacteria 1568
112 Ga0111539_10825507 3300009094 Bacteria 1079
113 Ga0105245_10031275 3300009098 Bacteria 4709
114 Ga0105245_10094629 3300009098 Bacteria 2754
115 Ga0105247_10000137 3300009101 Bacteria 70918
116 Ga0105241_10077514 3300009174 Bacteria 2595
117 Ga0105241_10216080 3300009174 Bacteria 1609
118 Ga0105242_10006774 3300009176 Bacteria 8835
119 Ga0105248_10013042 3300009177 Bacteria 9162
120 Ga0105248_10526183 3300009177 Bacteria 1333
121 Ga0105237_10006678 3300009545 Bacteria 12752
122 Ga0105237_10019403 3300009545 Bacteria 7021
123 Ga0105237_10183206 3300009545 Bacteria 2094
124 Ga0105238_10005358 3300009551 Bacteria 12676
125 Ga0105238_10026930 3300009551 Bacteria 5860
126 Ga0105238_10191105 3300009551 Bacteria 2023
127 Ga0105238_10205122 3300009551 Bacteria 1947
128 Ga0105238_10213466 3300009551 Bacteria 1906
129 Ga0105249_10020381 3300009553 Bacteria 5929
130 Ga0105249_10400139 3300009553 Bacteria 1403
131 Ga0099796_10000063 3300010159 Bacteria 19147
132 Ga0105239_10011331 3300010375 Bacteria 9952
133 Ga0105239_10014066 3300010375 Bacteria 8884
134 Ga0105239_10531663 3300010375 Bacteria 1338
135 Ga0157371_10008061 3300013102 Bacteria 8424
136 Ga0157370_10000919 3300013104 Bacteria 37363
137 Ga0157370_10011490 3300013104 Bacteria 9253
138 Ga0157369_10000084 3300013105 Bacteria 130587
139 Ga0157369_10000093 3300013105 Bacteria 122566
140 Ga0157369_10003434 3300013105 Bacteria 18793
141 Ga0157369_10005727 3300013105 Bacteria 14436
142 Ga0157369_10006041 3300013105 Bacteria 14057
143 Ga0157369_10014340 3300013105 Bacteria 8949
144 Ga0157369_10318274 3300013105 Bacteria 1617
145 Ga0157374_10000034 3300013296 Bacteria 180660
146 Ga0157374_10032044 3300013296 Bacteria 4783
147 Ga0157374_10705339 3300013296 Bacteria 1022
148 Ga0157378_10016544 3300013297 Bacteria 6460
149 Ga0157378_10282324 3300013297 Bacteria 1601
150 Ga0157378_10388832 3300013297 Bacteria 1372
151 Ga0163162_10001260 3300013306 Bacteria 23667
152 Ga0163162_10005558 3300013306 Bacteria 12193
153 Ga0163162_10040088 3300013306 Bacteria 4682
154 Ga0163162_10120683 3300013306 Bacteria 2725
155 Ga0157372_10039719 3300013307 Bacteria 5195
156 Ga0157375_10032502 3300013308 Bacteria 4950
157 Ga0157375_10116071 3300013308 Bacteria 2781
158 Ga0157375_10182706 3300013308 Bacteria 2249
159 Ga0163163_10206787 3300014325 Bacteria 2011
160 Ga0163163_10235976 3300014325 Bacteria 1878
161 Ga0157379_10006556 3300014968 Bacteria 10043
162 Ga0157376_10114666 3300014969 Bacteria 2378
163 Ga0182007_10000198 3300015262 Bacteria 40280
164 Ga0183361_10003 3300016635 Bacteria 577277
165 Ga0206354_11101660 3300020081 Bacteria 4460
166 Ga0206354_11661290 3300020081 Bacteria 1724
167 Ga0224712_10000105 3300022467 Bacteria 13146
168 Ga0209566_100307 3300025225 Bacteria 44141
169 Ga0209674_100025 3300025226 Bacteria 515942
170 Ga0209674_100144 3300025226 Bacteria 107160
171 Ga0209672_100002 3300025228 Bacteria 1733325
172 Ga0209672_100015 3300025228 Bacteria 529352
173 Ga0209672_100031 3300025228 Bacteria 332889
174 Ga0209147_100003 3300025229 Bacteria 1733325
175 Ga0209147_100016 3300025229 Bacteria 527606
176 Ga0209147_100503 3300025229 Bacteria 22767
177 Ga0209147_100611 3300025229 Bacteria 19499
178 Ga0209563_103475 3300025230 Bacteria 3242
179 Ga0207427_101251 3300025231 Bacteria 9738
180 Ga0209258_100005 3300025242 Bacteria 1087938
181 Ga0209258_100026 3300025242 Bacteria 527606
182 Ga0209258_100774 3300025242 Bacteria 19468
183 Ga0209148_1000006 3300025254 Bacteria 1733325
184 Ga0209148_1000070 3300025254 Bacteria 332889
185 Ga0209148_1001109 3300025254 Bacteria 16139
186 Ga0209759_1000008 3300025256 Bacteria 461395
187 Ga0209759_1000014 3300025256 Bacteria 396291
188 Ga0209759_1000094 3300025256 Bacteria 159426
189 Ga0209759_1006541 3300025256 Bacteria 3897
190 Ga0209233_1000018 3300025261 Bacteria 886857
191 Ga0209565_1000529 3300025263 Bacteria 27049
192 Ga0209565_1004340 3300025263 Bacteria 4344
193 Ga0209455_1000003 3300025272 Bacteria 1471893
194 Ga0209455_1000069 3300025272 Bacteria 308247
195 Ga0209455_1005672 3300025272 Bacteria 3813
196 Ga0209673_1000028 3300025273 Bacteria 358901
197 Ga0209673_1014734 3300025273 Bacteria 3013
198 Ga0209130_1006892 3300025284 Bacteria 3606
199 Ga0209675_1000040 3300025291 Bacteria 247535
200 Ga0209675_1000906 3300025291 Bacteria 18947
201 Ga0209675_1009780 3300025291 Bacteria 3351
202 Ga0209676_1000014 3300025292 Bacteria 793514
203 Ga0209025_1000092 3300025294 Bacteria 247020
204 Ga0209025_1002860 3300025294 Bacteria 17318
205 Ga0209025_1010269 3300025294 Bacteria 6368
206 Ga0209564_1000159 3300025295 Bacteria 164319
207 Ga0209564_1000615 3300025295 Bacteria 54694
208 Ga0209564_1001298 3300025295 Bacteria 27038
209 Ga0209564_1033396 3300025295 Bacteria 1531
210 Ga0209758_1023254 3300025297 Bacteria 2810
211 Ga0209256_1000386 3300025299 Bacteria 70160
212 Ga0209256_1003779 3300025299 Bacteria 10198
213 Ga0207426_1000180 3300025302 Bacteria 158321
214 Ga0207426_1001366 3300025302 Bacteria 20681
215 Ga0209051_1008382 3300025303 Bacteria 5478
216 Ga0207713_1000590 3300025735 Bacteria 35946
217 Ga0207713_1002233 3300025735 Bacteria 14351
218 Ga0207692_10279225 3300025898 Bacteria 1010
219 Ga0207642_10026019 3300025899 Bacteria 2376
220 Ga0207710_10001357 3300025900 Bacteria 12296
221 Ga0207680_10040799 3300025903 Bacteria 2704
222 Ga0207680_10063030 3300025903 Bacteria 2267
223 Ga0207680_10108472 3300025903 Bacteria 1796
224 Ga0207647_10000977 3300025904 Bacteria 22156
225 Ga0207647_10003311 3300025904 Bacteria 12101
226 Ga0207647_10020333 3300025904 Bacteria 4452
227 Ga0207647_10044284 3300025904 Bacteria 2782
228 Ga0207699_10214020 3300025906 Bacteria 1312
229 Ga0207705_10001880 3300025909 Bacteria 16475
230 Ga0207705_10044905 3300025909 Bacteria 3175
231 Ga0207707_10000107 3300025912 Bacteria 82899
232 Ga0207707_10001891 3300025912 Bacteria 19082
233 Ga0207707_10071391 3300025912 Bacteria 3026
234 Ga0207695_10004996 3300025913 Bacteria 17830
235 Ga0207695_10031137 3300025913 Bacteria 5857
236 Ga0207695_10071675 3300025913 Bacteria 3538
237 Ga0207695_10118654 3300025913 Bacteria 2616
238 Ga0207695_10434851 3300025913 Bacteria 1196
239 Ga0207671_10023359 3300025914 Bacteria 4663
240 Ga0207671_10052985 3300025914 Bacteria 3007
241 Ga0207671_10104774 3300025914 Bacteria 2145
242 Ga0207693_10001490 3300025915 Bacteria 20648
243 Ga0207660_10170240 3300025917 Bacteria 1685
244 Ga0207657_10000012 3300025919 Bacteria 185417
245 Ga0207657_10157219 3300025919 Bacteria 1848
246 Ga0207657_10163893 3300025919 Bacteria 1804
247 Ga0207652_10000738 3300025921 Bacteria 31584
248 Ga0207652_10133950 3300025921 Bacteria 2211
249 Ga0207652_10181944 3300025921 Bacteria 1889
250 Ga0207681_10441913 3300025923 Bacteria 1057
251 Ga0207694_10003158 3300025924 Bacteria 13161
252 Ga0207694_10090313 3300025924 Bacteria 2417
253 Ga0207694_10319943 3300025924 Bacteria 1280
254 Ga0207687_10301751 3300025927 Bacteria 1290
255 Ga0207644_10000708 3300025931 Bacteria 21213
256 Ga0207690_10000008 3300025932 Bacteria 366090
257 Ga0207669_10027269 3300025937 Bacteria 3124
258 Ga0207704_10068620 3300025938 Bacteria 2236
259 Ga0207704_10113048 3300025938 Bacteria 1840
260 Ga0207665_10003828 3300025939 Bacteria 10055
261 Ga0207665_10007330 3300025939 Bacteria 7298
262 Ga0207711_10032076 3300025941 Bacteria 4440
263 Ga0207711_10374484 3300025941 Bacteria 1321
264 Ga0207689_10129682 3300025942 Bacteria 2075
265 Ga0207667_10009108 3300025949 Bacteria 11734
266 Ga0207667_10009509 3300025949 Bacteria 11439
267 Ga0207667_10021321 3300025949 Bacteria 7180
268 Ga0207667_10334758 3300025949 Bacteria 1545
269 Ga0207712_10086664 3300025961 Bacteria 2294
270 Ga0207668_10093997 3300025972 Bacteria 2210
271 Ga0207658_10011861 3300025986 Bacteria 5940
272 Ga0207703_10000957 3300026035 Bacteria 27938
273 Ga0207678_10001382 3300026067 Bacteria 22326
274 Ga0207678_10035851 3300026067 Bacteria 4319
275 Ga0207678_10315792 3300026067 Bacteria 1344
276 Ga0207702_10163458 3300026078 Bacteria 2035
277 Ga0207641_10006476 3300026088 Bacteria 9861
278 Ga0207641_10160927 3300026088 Bacteria 2041
279 Ga0207648_10066597 3300026089 Bacteria 3141
280 Ga0207683_10016674 3300026121 Bacteria 6252
281 Ga0207698_10007664 3300026142 Bacteria 6770
282 Ga0209371_1000670 3300027312 Bacteria 29828
283 Ga0209371_1011628 3300027312 Bacteria 2600
284 Ga0209282_1000156 3300027666 Bacteria 39547
285 Ga0268266_10003195 3300028379 Bacteria 16585
286 Ga0268264_10058724 3300028381 Bacteria 3222
287 Ga0268256_1000567 3300030500 Bacteria 29776
288 Ga0268256_1010581 3300030500 Bacteria 2979
289 Ga0307511_10000037 3300030521 Bacteria 103008
290 Ga0265770_1000507 3300030878 Bacteria 5415
291 Ga0265760_10000102 3300031090 Bacteria 21821
292 Ga0307509_10000001 3300031507 Bacteria 629324
293 Ga0307408_100024560 3300031548 Bacteria 4117
294 Ga0265313_10068209 3300031595 Bacteria 1644
295 Ga0307516_10004172 3300031730 Bacteria 18010
296 Ga0307412_10000039 3300031911 Bacteria 182976
297 Ga0373936_0003390 3300035113 Bacteria 5973
298 Ga0373945_0039004 3300035116 Bacteria 1711
299 Ga0373935_0160961 3300035692 Bacteria 1530
300 Ga0373927_0017430 3300035695 Bacteria 4726
301 Ga0373933_0266681 3300035724 Bacteria 1105
302 Ga0373933_0271631 3300035724 Bacteria 1094
303 Ga0373937_0132157 3300036401 Bacteria 2331
304 Ga0395899_0000023 3300037312 Bacteria 367159
305 Ga0395899_0016219 3300037312 Bacteria 5678
306 Ga0395900_0000019 3300037418 Bacteria 357240
307 Ga0395900_0000182 3300037418 Bacteria 100777
308 Ga0395900_0216086 3300037418 Bacteria 1934
309 Ga0395898_0000016 3300037466 Bacteria 435585
310 Ga0395898_0001753 3300037466 Bacteria 28483
311 Ga0395898_0006217 3300037466 Bacteria 12791
312 Ga0395898_0012589 3300037466 Bacteria 8745
313 Ga0395898_0050606 3300037466 Bacteria 4065
314 Ga0395905_0000004 3300037471 Bacteria 674991
315 Ga0395901_0000004 3300038443 Bacteria 657361
316 Ga0395901_0000040 3300038443 Bacteria 204677
317 Ga0395901_0000326 3300038443 Bacteria 58686
318 Ga0395901_0029069 3300038443 Bacteria 5686
319 Ga0395901_0692096 3300038443 Bacteria 1018
320 Ga0436365_1156792 3300039437 Bacteria 2404
321 Ga0439448_0000018 3300042005 Bacteria 28604
322 Ga0466969_0001035 3300044656 Bacteria 15006
323 Ga0466973_0031288 3300044659 Bacteria 5083
324 Ga0466965_0001868 3300044683 Bacteria 8767
325 Ga0466966_0001688 3300044684 Bacteria 14253
326 Ga0466966_0017560 3300044684 Bacteria 4728
327 Ga0466966_0063219 3300044684 Bacteria 2332
328 Ga0466966_0381918 3300044684 Bacteria 846
329 Ga0466961_0000909 3300044693 Bacteria 18382
330 Ga0466961_0254238 3300044693 Bacteria 1079
331 Ga0466963_0002294 3300044694 Bacteria 10637
332 Ga0466963_0010154 3300044694 Bacteria 5693
333 Ga0466964_0007403 3300044706 Bacteria 4106
334 Ga0466971_0036075 3300044719 Bacteria 2217
335 Ga0466968_0041955 3300044735 Bacteria 1933
336 Ga0466970_0007817 3300044765 Bacteria 5367
337 Ga0466970_0023727 3300044765 Bacteria 3206
338 Ga0466957_0001477 3300044842 Bacteria 12332
339 Ga0466957_0006925 3300044842 Bacteria 6409
340 Ga0466957_0041079 3300044842 Bacteria 2796
341 Ga0466959_0056251 3300045049 Bacteria 2871
342 Ga0466958_0003557 3300045836 Bacteria 8107
343 Ga0466958_0003923 3300045836 Bacteria 7797
344 Ga0466958_0005081 3300045836 Bacteria 7031
345 Ga0466967_0622360 3300045976 Bacteria 1066
346 Ga0495592_0028665 3300046454 Bacteria 4214
347 Ga0495592_0076936 3300046454 Bacteria 2420
348 Ga0495603_0002366 3300046455 Bacteria 11073
349 Ga0495603_0031577 3300046455 Bacteria 3188
350 Ga0495590_0002819 3300046457 Bacteria 7172
351 Ga0495591_004355 3300046458 Bacteria 6970
352 Ga0495629_0000247 3300046459 Bacteria 47185
353 Ga0495629_0000704 3300046459 Bacteria 27097
354 Ga0495629_0002464 3300046459 Bacteria 14199
355 Ga0495629_0009512 3300046459 Bacteria 7102
356 Ga0495629_0011681 3300046459 Bacteria 6372
357 Ga0495638_0000976 3300046460 Bacteria 28790
358 Ga0495638_0022862 3300046460 Bacteria 4099
359 Ga0495641_0019953 3300046461 Bacteria 3415
360 Ga0495651_0013144 3300046462 Bacteria 6400
361 Ga0495651_0080039 3300046462 Bacteria 2468
362 Ga0495651_0200182 3300046462 Bacteria 1398
363 Ga0495653_0001472 3300046463 Bacteria 18364
364 Ga0495653_0002197 3300046463 Bacteria 15431
365 Ga0495653_0105974 3300046463 Bacteria 2028
366 Ga0495650_0000554 3300046471 Bacteria 53235
367 Ga0495650_0002743 3300046471 Bacteria 13598
368 Ga0495650_0003550 3300046471 Bacteria 11291
369 Ga0495650_0006564 3300046471 Bacteria 7231
370 Ga0495650_0114046 3300046471 Bacteria 1000
371 Ga0495580_0000008 3300046472 Bacteria 102421
372 Ga0495580_0000532 3300046472 Bacteria 32248
373 Ga0495580_0001335 3300046472 Bacteria 21761
374 Ga0495580_0002997 3300046472 Bacteria 14480
375 Ga0495580_0006979 3300046472 Bacteria 9105
376 Ga0495580_0015765 3300046472 Bacteria 5692
377 Ga0495580_0027655 3300046472 Bacteria 4126
378 Ga0495580_0142296 3300046472 Bacteria 1662
379 Ga0495580_0323732 3300046472 Bacteria 1047
380 Ga0495582_0000202 3300046473 Bacteria 33047
381 Ga0495582_0229493 3300046473 Bacteria 1063
382 Ga0495605_0001989 3300046474 Bacteria 12952
383 Ga0495605_0006271 3300046474 Bacteria 6852
384 Ga0495662_0016718 3300046476 Bacteria 3554
385 Ga0495664_0000389 3300046477 Bacteria 21485
386 Ga0495664_0007907 3300046477 Bacteria 5918
387 Ga0495664_0021180 3300046477 Bacteria 3755
388 Ga0495664_0080606 3300046477 Bacteria 1951
389 Ga0495584_0133439 3300046491 Bacteria 1260
390 Ga0495596_0000157 3300046500 Bacteria 47448
391 Ga0495596_0017129 3300046500 Bacteria 3004
392 Ga0495596_0110299 3300046500 Bacteria 1068
393 Ga0495596_0112912 3300046500 Bacteria 1055
394 Ga0495583_0006948 3300046506 Bacteria 7259
395 Ga0495583_0020605 3300046506 Bacteria 3409
396 Ga0495583_0054868 3300046506 Bacteria 1803
397 Ga0495606_0009209 3300046507 Bacteria 8392
398 Ga0495606_0068135 3300046507 Bacteria 2252
399 Ga0495608_0007370 3300046511 Bacteria 7773
400 Ga0495610_0000623 3300046512 Bacteria 35034
401 Ga0495610_0001301 3300046512 Bacteria 22255
402 Ga0495616_0006731 3300046513 Bacteria 6930
403 Ga0495616_0025441 3300046513 Bacteria 3163
404 Ga0495618_0002329 3300046514 Bacteria 12275
405 Ga0495618_0002763 3300046514 Bacteria 11160
406 Ga0495620_0007184 3300046515 Bacteria 6068
407 Ga0495628_0002415 3300046516 Bacteria 16855
408 Ga0495628_0014740 3300046516 Bacteria 6543
409 Ga0495628_0064189 3300046516 Bacteria 2875
410 Ga0495628_0159434 3300046516 Bacteria 1715
411 Ga0495628_0247585 3300046516 Bacteria 1331
412 Ga0495628_0258021 3300046516 Bacteria 1299
413 Ga0495630_0001539 3300046517 Bacteria 16004
414 Ga0495630_0010361 3300046517 Bacteria 6726
415 Ga0495630_0027150 3300046517 Bacteria 4244
416 Ga0495630_0031126 3300046517 Bacteria 3971
417 Ga0495630_0075101 3300046517 Bacteria 2547
418 Ga0495631_0050321 3300046518 Bacteria 1823
419 Ga0495632_0039935 3300046519 Bacteria 2366
420 Ga0495643_0028247 3300046522 Bacteria 3147
421 Ga0495648_0017371 3300046524 Bacteria 5144
422 Ga0495648_0018461 3300046524 Bacteria 4936
423 Ga0495648_0040367 3300046524 Bacteria 2959
424 Ga0495648_0138951 3300046524 Bacteria 1281
425 Ga0495666_0000247 3300046526 Bacteria 23327
426 Ga0495666_0002384 3300046526 Bacteria 9357
427 Ga0495666_0012618 3300046526 Bacteria 4211
428 Ga0495666_0013125 3300046526 Bacteria 4127
429 Ga0495666_0029908 3300046526 Bacteria 2677
430 Ga0495652_0016081 3300046529 Bacteria 6693
431 Ga0495652_0034838 3300046529 Bacteria 4385
432 Ga0495652_0043525 3300046529 Bacteria 3866
433 Ga0495652_0052543 3300046529 Bacteria 3475
434 Ga0495652_0174517 3300046529 Bacteria 1656
435 Ga0495654_0180202 3300046530 Bacteria 915
436 Ga0495665_0005589 3300046531 Bacteria 6776
437 Ga0495665_0014770 3300046531 Bacteria 4208
438 Ga0495665_0049906 3300046531 Bacteria 2218
439 Ga0495665_0086675 3300046531 Bacteria 1645
440 Ga0495665_0199007 3300046531 Bacteria 1039
441 Ga0495640_0009866 3300046533 Bacteria 7408
442 Ga0495640_0012834 3300046533 Bacteria 6391
443 Ga0495586_0019721 3300046535 Bacteria 3590
444 Ga0495587_0004211 3300046536 Bacteria 9519
445 Ga0495587_0019491 3300046536 Bacteria 4196
446 Ga0495609_0002254 3300046538 Bacteria 12030
447 Ga0495609_0009119 3300046538 Bacteria 4815
448 Ga0495597_0004638 3300046542 Bacteria 7486
449 Ga0495645_0000886 3300046543 Bacteria 20409
450 Ga0495645_0003992 3300046543 Bacteria 10069
451 Ga0495645_0043274 3300046543 Bacteria 3284
452 Ga0495645_0345046 3300046543 Bacteria 961
453 Ga0495622_0000140 3300046557 Bacteria 62347
454 Ga0495622_0010112 3300046557 Bacteria 4365
455 Ga0495667_0175210 3300046559 Bacteria 1378
456 Ga0495634_0018717 3300046642 Bacteria 4926
457 Ga0495634_0076630 3300046642 Bacteria 2194
458 Ga0495611_0031044 3300046648 Bacteria 2350
459 Ga0495635_0002465 3300046663 Bacteria 12635
460 Ga0495635_0041278 3300046663 Bacteria 3187
461 Ga0495635_0062940 3300046663 Bacteria 2547
462 Ga0495661_0003608 3300046665 Bacteria 11396
463 Ga0495661_0007417 3300046665 Bacteria 7646
464 Ga0495661_0011321 3300046665 Bacteria 6053
465 Ga0495661_0026177 3300046665 Bacteria 3759
466 Ga0495657_0015928 3300046675 Bacteria 5487
467 Ga0495599_0016332 3300046678 Bacteria 4609
468 Ga0495599_0039347 3300046678 Bacteria 2971
469 Ga0495623_0009831 3300046679 Bacteria 6197
470 Ga0495646_0003240 3300046680 Bacteria 10117
471 Ga0495646_0006405 3300046680 Bacteria 7466
472 Ga0495646_0014935 3300046680 Bacteria 4932
473 Ga0495646_0035805 3300046680 Bacteria 3077
474 Ga0495646_0089898 3300046680 Bacteria 1775
475 Ga0495658_0226025 3300046683 Bacteria 1173
476 Ga0495669_0000883 3300046684 Bacteria 12633
477 Ga0495613_0045430 3300046689 Bacteria 3248
478 Ga0495613_0048748 3300046689 Bacteria 3127
479 Ga0495624_0000346 3300046690 Bacteria 36774
480 Ga0495624_0018707 3300046690 Bacteria 4631
481 Ga0495624_0025826 3300046690 Bacteria 3854
482 Ga0495624_0059864 3300046690 Bacteria 2388
483 Ga0495624_0101474 3300046690 Bacteria 1771
484 Ga0495624_0101484 3300046690 Bacteria 1771
485 Ga0495670_0092625 3300046691 Bacteria 1548
486 Ga0495671_0000232 3300046692 Bacteria 47998
487 Ga0495671_0025069 3300046692 Bacteria 3102
488 Ga0495649_0006145 3300046694 Bacteria 7504
489 Ga0495649_0080542 3300046694 Bacteria 1741
490 Ga0495589_0002642 3300046794 Bacteria 9924
491 Ga0495589_0026443 3300046794 Bacteria 2939
492 Ga0495589_0047006 3300046794 Bacteria 2140
493 Ga0495589_0063341 3300046794 Bacteria 1814
494 Ga0495589_0116085 3300046794 Bacteria 1290
495 Ga0495600_0004960 3300046809 Bacteria 7992
496 Ga0495600_0006113 3300046809 Bacteria 7292
497 Ga0495660_0076592 3300046810 Bacteria 1762
498 Ga0495581_0000497 3300047315 Bacteria 20079
499 Ga0495581_0003043 3300047315 Bacteria 9603
500 Ga0495581_0012929 3300047315 Bacteria 4838
501 Ga0495581_0017288 3300047315 Bacteria 4190
502 Ga0495604_0006557 3300047317 Bacteria 9227
503 Ga0495604_0012959 3300047317 Bacteria 6644
504 Ga0495604_0030671 3300047317 Bacteria 4269
505 Ga0495604_0074166 3300047317 Bacteria 2565
506 Ga0495604_0119590 3300047317 Bacteria 1908
507 Ga0495674_0007070 3300047319 Bacteria 10735
508 Ga0495674_0020471 3300047319 Bacteria 6123
509 Ga0495674_0027093 3300047319 Bacteria 5241
510 Ga0495674_0038867 3300047319 Bacteria 4268
511 Ga0495674_0040987 3300047319 Bacteria 4138
512 Ga0495674_0111666 3300047319 Bacteria 2316
513 Ga0495674_0158665 3300047319 Bacteria 1893
514 Ga0495674_0422532 3300047319 Bacteria 1074
515 Ga0495672_0009363 3300047320 Bacteria 7105
516 Ga0495672_0027948 3300047320 Bacteria 3577
517 Ga0495672_0042048 3300047320 Bacteria 2758
518 Ga0495672_0095199 3300047320 Bacteria 1626
519 Ga0495672_0122473 3300047320 Bacteria 1380
520 Ga0495676_0003897 3300047321 Bacteria 13565
521 Ga0495676_0031199 3300047321 Bacteria 4510
522 Ga0495676_0187349 3300047321 Bacteria 1445
523 Ga0495676_0321912 3300047321 Bacteria 1038
524 Ga0495680_0006673 3300047322 Bacteria 10688
525 Ga0495680_0069392 3300047322 Bacteria 2689
526 Ga0495680_0116517 3300047322 Bacteria 1975
527 Ga0495680_0138733 3300047322 Bacteria 1780
528 Ga0495683_0006194 3300047323 Bacteria 6550
529 Ga0495683_0011576 3300047323 Bacteria 4640
530 Ga0495683_0015976 3300047323 Bacteria 3899
531 Ga0495687_009463 3300047443 Bacteria 5442
532 Ga0495687_034369 3300047443 Bacteria 2291
533 Ga0495687_042397 3300047443 Bacteria 1988
534 Ga0495687_047113 3300047443 Bacteria 1857
535 Ga0495675_0001013 3300047444 Bacteria 17088
536 Ga0495675_0008541 3300047444 Bacteria 6346
537 Ga0495675_0013701 3300047444 Bacteria 5124
538 Ga0495675_0172333 3300047444 Bacteria 1328
539 Ga0495675_0256624 3300047444 Bacteria 1048
540 Ga0495679_000117 3300047446 Bacteria 69653
541 Ga0495679_001343 3300047446 Bacteria 14201
542 Ga0495679_001539 3300047446 Bacteria 13012
543 Ga0495679_039979 3300047446 Bacteria 1460
544 Ga0495679_075105 3300047446 Bacteria 967
545 Ga0495685_005621 3300047447 Bacteria 4097
546 Ga0495673_0006705 3300047469 Bacteria 6736
547 Ga0495673_0039560 3300047469 Bacteria 2138
548 Ga0495673_0051139 3300047469 Bacteria 1811
549 Ga0495684_0017358 3300047471 Bacteria 5539
550 Ga0495686_0000002 3300047472 Bacteria 1050777
551 Ga0495686_0041119 3300047472 Bacteria 2945
552 Ga0495686_0054564 3300047472 Bacteria 2502
553 Ga0495686_0128544 3300047472 Bacteria 1504
554 Ga0495593_0026354 3300047673 Bacteria 3211
555 Ga0495593_0031686 3300047673 Bacteria 2886
556 Ga0495593_0041848 3300047673 Bacteria 2461
557 Ga0495593_0052233 3300047673 Bacteria 2160
558 Ga0495593_0094536 3300047673 Bacteria 1537
559 Ga0495593_0101989 3300047673 Bacteria 1471
560 Ga0495602_0002585 3300048088 Bacteria 18476
561 Ga0495602_0006600 3300048088 Bacteria 12159
562 Ga0495602_0047606 3300048088 Bacteria 3862
563 Ga0495602_0132686 3300048088 Bacteria 1983
564 Ga0495614_0010644 3300048089 Bacteria 4053
565 Ga0495614_0017353 3300048089 Bacteria 3127
566 Ga0495626_0018295 3300048091 Bacteria 3522
567 Ga0496100_0000313 3300048903 Bacteria 24033
568 Ga0496101_0001365 3300048904 Bacteria 14626
569 Ga0496101_0008320 3300048904 Bacteria 6778
570 Ga0496101_0013371 3300048904 Bacteria 5496
571 Ga0496101_0120959 3300048904 Bacteria 1979
572 Ga0496101_0132837 3300048904 Bacteria 1891
573 Ga0496102_0002592 3300048905 Bacteria 15424
574 Ga0496102_0031892 3300048905 Bacteria 4731
575 Ga0496102_0075175 3300048905 Bacteria 3105
576 Ga0496102_0113528 3300048905 Bacteria 2527
577 Ga0496103_0000841 3300048906 Bacteria 22449
578 Ga0496103_0003774 3300048906 Bacteria 9212
579 Ga0496103_0097569 3300048906 Bacteria 1858
580 Ga0496103_0113437 3300048906 Bacteria 1722
581 Ga0496103_0123442 3300048906 Bacteria 1650
582 Ga0496104_0199984 3300048907 Bacteria 1910
583 Ga0496105_0016770 3300048908 Bacteria 5855
584 Ga0496105_0023742 3300048908 Bacteria 4977
585 Ga0496105_0242575 3300048908 Bacteria 1462
586 Ga0496106_0000025 3300048909 Bacteria 154905
587 Ga0496106_0026259 3300048909 Bacteria 4335
588 Ga0496106_0038078 3300048909 Bacteria 3598
589 Ga0496106_0081767 3300048909 Bacteria 2482
590 Ga0496106_0214582 3300048909 Bacteria 1534
591 Ga0496107_0022553 3300048910 Bacteria 4448
592 Ga0496107_0026960 3300048910 Bacteria 4078
593 Ga0496107_0065382 3300048910 Bacteria 2636
594 Ga0496107_0117505 3300048910 Bacteria 1958
595 Ga0496109_0157605 3300048912 Bacteria 2126
596 Ga0496109_0391567 3300048912 Bacteria 1313
597 Ga0496110_0006703 3300048913 Bacteria 9156
598 Ga0496110_0035913 3300048913 Bacteria 4303
599 Ga0496110_0610431 3300048913 Bacteria 989
600 Ga0496111_0032157 3300048914 Bacteria 3740
601 Ga0496111_0062847 3300048914 Bacteria 2692
602 Ga0496112_0005011 3300048915 Bacteria 11368
603 Ga0496112_0015117 3300048915 Bacteria 7191
604 Ga0496112_0102413 3300048915 Bacteria 2833
605 Ga0496113_0000580 3300048916 Bacteria 18226
606 Ga0496113_0048511 3300048916 Bacteria 3159
607 Ga0496114_0018555 3300048917 Bacteria 5626
608 Ga0496114_0045493 3300048917 Bacteria 3646
609 Ga0496115_0015791 3300048918 Bacteria 5734
610 Ga0496115_0055943 3300048918 Bacteria 3170
611 Ga0496115_0118311 3300048918 Bacteria 2179
612 Ga0496115_0185087 3300048918 Bacteria 1721
613 Ga0496115_0414442 3300048918 Bacteria 1092
614 Ga0496116_0008695 3300048919 Bacteria 8775
615 Ga0496116_0023149 3300048919 Bacteria 4634
616 Ga0496117_0001465 3300048920 Bacteria 33966
617 Ga0496117_0001575 3300048920 Bacteria 32376
618 Ga0496117_0003919 3300048920 Bacteria 16853
619 Ga0496117_0017415 3300048920 Bacteria 5998
620 Ga0496117_0062182 3300048920 Bacteria 2560
621 Ga0496118_0000215 3300048921 Bacteria 100753
622 Ga0496118_0001565 3300048921 Bacteria 33985
623 Ga0496118_0003868 3300048921 Bacteria 18395
624 Ga0496118_0010590 3300048921 Bacteria 9112
625 Ga0496118_0030359 3300048921 Bacteria 4512
626 Ga0496118_0042769 3300048921 Bacteria 3570
627 Ga0496118_0045149 3300048921 Bacteria 3443
628 Ga0496119_0113403 3300048922 Bacteria 1501
629 Ga0496119_0211102 3300048922 Bacteria 999
630 Ga0496120_0000242 3300048923 Bacteria 93148
631 Ga0496120_0062677 3300048923 Bacteria 2071
632 Ga0496121_0001279 3300048924 Bacteria 43329
633 Ga0496121_0001771 3300048924 Bacteria 35100
634 Ga0496121_0001850 3300048924 Bacteria 34039
635 Ga0496121_0004851 3300048924 Bacteria 17689
636 Ga0496121_0006443 3300048924 Bacteria 14569
637 Ga0496121_0027364 3300048924 Bacteria 5337
638 Ga0496121_0031945 3300048924 Bacteria 4798
639 Ga0496121_0094864 3300048924 Bacteria 2320
640 Ga0496122_0002377 3300048925 Bacteria 26941
641 Ga0496122_0004966 3300048925 Bacteria 16112
642 Ga0496123_0000963 3300048926 Bacteria 44427
643 Ga0496124_0016484 3300048927 Bacteria 7020
644 Ga0496125_0012001 3300048928 Bacteria 8627
645 Ga0496125_0013885 3300048928 Bacteria 7882
646 Ga0496126_0000393 3300048929 Bacteria 89680
647 Ga0496126_0002361 3300048929 Bacteria 25765
648 Ga0496126_0002530 3300048929 Bacteria 24476
649 Ga0496126_0005965 3300048929 Bacteria 13699
650 Ga0496126_0431176 3300048929 Bacteria 1064
651 Ga0496126_0627121 3300048929 Bacteria 844
652 Ga0495682_0021538 3300049460 Bacteria 2414
653 Ga0501043_0198078 3300049579 Bacteria 1560
654 Ga0466962_0000511 3300061719 Bacteria 16910
655 Ga0466962_0126597 3300061719 Bacteria 1233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10315792 Ga0207678_103157922 217
2 3300006173 Ga0070716_100025956 Ga0070716_1000259563 228
3 3300025939 Ga0207665_10007330 Ga0207665_100073302 228
4 3300013105 Ga0157369_10005727 Ga0157369_100057273 232
5 3300046543 Ga0495645_0345046 Ga0495645_0345046_28_729 233
6 3300009094 Ga0111539_10825507 Ga0111539_108255072 234
7 3300009098 Ga0105245_10094629 Ga0105245_100946292 234
8 3300025924 Ga0207694_10090313 Ga0207694_100903133 234
9 3300048923 Ga0496120_0000242 Ga0496120_0000242_44040_44768 234
10 3300009093 Ga0105240_10076405 Ga0105240_100764054 235
11 3300009551 Ga0105238_10026930 Ga0105238_100269303 235
12 3300028379 Ga0268266_10003195 Ga0268266_100031954 235
13 3300005335 Ga0070666_10003402 Ga0070666_100034027 236
14 3300005355 Ga0070671_100000799 Ga0070671_1000007998 236
15 3300005367 Ga0070667_100029723 Ga0070667_1000297234 236
16 3300005548 Ga0070665_100004690 Ga0070665_1000046902 236
17 3300005617 Ga0068859_100003018 Ga0068859_1000030184 236
18 3300005841 Ga0068863_100004798 Ga0068863_1000047985 236
19 3300005842 Ga0068858_100002341 Ga0068858_1000023419 236
20 3300005843 Ga0068860_100038141 Ga0068860_1000381414 236
21 3300006931 Ga0097620_100003018 Ga0097620_1000030184 236
22 3300009101 Ga0105247_10000137 Ga0105247_1000013749 236
23 3300009177 Ga0105248_10013042 Ga0105248_100130425 236
24 3300009553 Ga0105249_10020381 Ga0105249_100203814 236
25 3300013306 Ga0163162_10120683 Ga0163162_101206832 236
26 3300014325 Ga0163163_10206787 Ga0163163_102067873 236
27 3300014968 Ga0157379_10006556 Ga0157379_100065568 236
28 3300014969 Ga0157376_10114666 Ga0157376_101146662 236
29 3300025900 Ga0207710_10001357 Ga0207710_100013576 236
30 3300025903 Ga0207680_10063030 Ga0207680_100630303 236
31 3300025931 Ga0207644_10000708 Ga0207644_1000070813 236
32 3300025961 Ga0207712_10086664 Ga0207712_100866642 236
33 3300025986 Ga0207658_10011861 Ga0207658_100118615 236
34 3300026035 Ga0207703_10000957 Ga0207703_1000095719 236
35 3300026088 Ga0207641_10006476 Ga0207641_100064769 236
36 3300028381 Ga0268264_10058724 Ga0268264_100587243 236
37 3300031730 Ga0307516_10004172 Ga0307516_100041728 236
38 3300048905 Ga0496102_0031892 Ga0496102_0031892_1100_1810 236
39 3300048915 Ga0496112_0102413 Ga0496112_0102413_854_1564 236
40 3300048924 Ga0496121_0001771 Ga0496121_0001771_16957_17667 236
41 3300048928 Ga0496125_0013885 Ga0496125_0013885_5971_6681 236
42 3300031507 Ga0307509_10000001 Ga0307509_10000001366 237
43 3300030521 Ga0307511_10000037 Ga0307511_1000003779 238
44 3300031595 Ga0265313_10068209 Ga0265313_100682092 238
45 3300044684 Ga0466966_0381918 Ga0466966_0381918_24_764 238
46 3300045049 Ga0466959_0056251 Ga0466959_0056251_1004_1744 238
47 3300047443 Ga0495687_047113 Ga0495687_047113_792_1508 238
48 3300048912 Ga0496109_0391567 Ga0496109_0391567_17_736 238
49 3300049579 Ga0501043_0198078 Ga0501043_0198078_754_1518 239
50 3300006844 Ga0075428_100512579 Ga0075428_1005125792 240
51 3300035116 Ga0373945_0039004 Ga0373945_0039004_144_893 240
52 3300035724 Ga0373933_0271631 Ga0373933_0271631_232_981 240
53 3300048908 Ga0496105_0016770 Ga0496105_0016770_50_799 240
54 3300048917 Ga0496114_0045493 Ga0496114_0045493_2659_3408 240
55 3300048918 Ga0496115_0118311 Ga0496115_0118311_1372_2121 240
56 3300030878 Ga0265770_1000507 Ga0265770_10005073 241
57 3300031090 Ga0265760_10000102 Ga0265760_1000010217 241
58 3300035113 Ga0373936_0003390 Ga0373936_0003390_4025_4777 241
59 3300005530 Ga0070679_100245769 Ga0070679_1002457692 242
60 3300025906 Ga0207699_10214020 Ga0207699_102140202 242
61 3300025912 Ga0207707_10001891 Ga0207707_1000189115 242
62 3300025921 Ga0207652_10133950 Ga0207652_101339502 242
63 3300005330 Ga0070690_100026950 Ga0070690_1000269502 243
64 3300005334 Ga0068869_100149149 Ga0068869_1001491492 243
65 3300005335 Ga0070666_10015929 Ga0070666_100159294 243
66 3300005338 Ga0068868_100014098 Ga0068868_1000140984 243
67 3300005355 Ga0070671_100115835 Ga0070671_1001158352 243
68 3300005356 Ga0070674_100155228 Ga0070674_1001552281 243
69 3300005367 Ga0070667_100009756 Ga0070667_1000097562 243
70 3300005434 Ga0070709_10109287 Ga0070709_101092872 243
71 3300005459 Ga0068867_100141927 Ga0068867_1001419272 243
72 3300005546 Ga0070696_100145052 Ga0070696_1001450522 243
73 3300005614 Ga0068856_100006988 Ga0068856_1000069885 243
74 3300005840 Ga0068870_10225532 Ga0068870_102255322 243
75 3300005841 Ga0068863_100045905 Ga0068863_1000459055 243
76 3300005842 Ga0068858_100040355 Ga0068858_1000403552 243
77 3300006028 Ga0070717_10727163 Ga0070717_107271631 243
78 3300006163 Ga0070715_10047205 Ga0070715_100472052 243
79 3300006173 Ga0070716_100017471 Ga0070716_1000174714 243
80 3300006175 Ga0070712_100029151 Ga0070712_1000291512 243
81 3300006881 Ga0068865_100050034 Ga0068865_1000500342 243
82 3300009176 Ga0105242_10006774 Ga0105242_100067744 243
83 3300013296 Ga0157374_10032044 Ga0157374_100320444 243
84 3300013297 Ga0157378_10016544 Ga0157378_100165444 243
85 3300013306 Ga0163162_10040088 Ga0163162_100400883 243
86 3300013308 Ga0157375_10116071 Ga0157375_101160712 243
87 3300014325 Ga0163163_10235976 Ga0163163_102359762 243
88 3300025898 Ga0207692_10279225 Ga0207692_102792251 243
89 3300025899 Ga0207642_10026019 Ga0207642_100260193 243
90 3300025903 Ga0207680_10108472 Ga0207680_101084722 243
91 3300025915 Ga0207693_10001490 Ga0207693_1000149015 243
92 3300025938 Ga0207704_10113048 Ga0207704_101130482 243
93 3300025939 Ga0207665_10003828 Ga0207665_100038283 243
94 3300025941 Ga0207711_10032076 Ga0207711_100320763 243
95 3300025942 Ga0207689_10129682 Ga0207689_101296823 243
96 3300026088 Ga0207641_10160927 Ga0207641_101609272 243
97 3300026089 Ga0207648_10066597 Ga0207648_100665972 243
98 3300026121 Ga0207683_10016674 Ga0207683_100166745 243
99 3300035692 Ga0373935_0160961 Ga0373935_0160961_609_1364 243
100 3300035695 Ga0373927_0017430 Ga0373927_0017430_2130_2885 243
101 3300035724 Ga0373933_0266681 Ga0373933_0266681_132_887 243
102 3300036401 Ga0373937_0132157 Ga0373937_0132157_1362_2117 243
103 3300046472 Ga0495580_0000532 Ga0495580_0000532_18102_18857 243
104 3300046473 Ga0495582_0229493 Ga0495582_0229493_100_855 243
105 3300046518 Ga0495631_0050321 Ga0495631_0050321_1038_1802 243
106 3300046531 Ga0495665_0199007 Ga0495665_0199007_144_899 243
107 3300046683 Ga0495658_0226025 Ga0495658_0226025_154_909 243
108 3300047319 Ga0495674_0422532 Ga0495674_0422532_235_990 243
109 3300048905 Ga0496102_0075175 Ga0496102_0075175_751_1506 243
110 3300048909 Ga0496106_0038078 Ga0496106_0038078_576_1331 243
111 3300048910 Ga0496107_0065382 Ga0496107_0065382_1204_1959 243
112 3300048913 Ga0496110_0035913 Ga0496110_0035913_2892_3647 243
113 3300048914 Ga0496111_0032157 Ga0496111_0032157_897_1652 243
114 3300048915 Ga0496112_0015117 Ga0496112_0015117_604_1359 243
115 3300048918 Ga0496115_0015791 Ga0496115_0015791_2422_3177 243
116 3300048929 Ga0496126_0005965 Ga0496126_0005965_8577_9341 244
117 iso_pu_bacteria 2501025501 2501072086 244
118 3300005336 Ga0070680_100079820 Ga0070680_1000798202 245
119 3300005458 Ga0070681_10000668 Ga0070681_1000066818 245
120 3300005530 Ga0070679_100000666 Ga0070679_10000066613 245
121 3300005563 Ga0068855_100001590 Ga0068855_10000159018 245
122 3300005563 Ga0068855_100013226 Ga0068855_1000132263 245
123 3300009093 Ga0105240_10010335 Ga0105240_1001033512 245
124 3300009093 Ga0105240_10015865 Ga0105240_100158653 245
125 3300009551 Ga0105238_10005358 Ga0105238_1000535810 245
126 3300013104 Ga0157370_10000919 Ga0157370_1000091913 245
127 3300013105 Ga0157369_10006041 Ga0157369_100060418 245
128 3300025912 Ga0207707_10000107 Ga0207707_1000010730 245
129 3300025913 Ga0207695_10004996 Ga0207695_1000499614 245
130 3300025914 Ga0207671_10104774 Ga0207671_101047743 245
131 3300025917 Ga0207660_10170240 Ga0207660_101702402 245
132 3300025921 Ga0207652_10000738 Ga0207652_1000073811 245
133 3300025924 Ga0207694_10003158 Ga0207694_100031584 245
134 3300025949 Ga0207667_10021321 Ga0207667_100213215 245
135 3300026078 Ga0207702_10163458 Ga0207702_101634582 245
136 3300005356 Ga0070674_100057507 Ga0070674_1000575072 246
137 3300005458 Ga0070681_10000460 Ga0070681_1000046014 246
138 3300005459 Ga0068867_100085067 Ga0068867_1000850672 246
139 3300005530 Ga0070679_100125757 Ga0070679_1001257572 246
140 3300005548 Ga0070665_100221638 Ga0070665_1002216382 246
141 3300005615 Ga0070702_100038788 Ga0070702_1000387883 246
142 3300005718 Ga0068866_10096886 Ga0068866_100968862 246
143 3300010375 Ga0105239_10531663 Ga0105239_105316632 246
144 3300013297 Ga0157378_10282324 Ga0157378_102823242 246
145 3300013308 Ga0157375_10182706 Ga0157375_101827063 246
146 3300025912 Ga0207707_10071391 Ga0207707_100713913 246
147 3300025921 Ga0207652_10181944 Ga0207652_101819442 246
148 3300025937 Ga0207669_10027269 Ga0207669_100272693 246
149 3300025938 Ga0207704_10068620 Ga0207704_100686203 246
150 iso_pu_bacteria 2519103095 2519461829 247
151 3300003187 JGI25151J46595_10001889 JGI25151J46595_100018898 248
152 3300003771 Ga0055526_1007508 Ga0055526_10075085 248
153 3300003773 Ga0055537_1002716 Ga0055537_10027164 248
154 3300003775 Ga0055524_1001249 Ga0055524_10012496 248
155 3300003784 Ga0055534_1002100 Ga0055534_10021006 248
156 3300025263 Ga0209565_1000529 Ga0209565_10005297 248
157 3300025273 Ga0209673_1014734 Ga0209673_10147342 248
158 3300025291 Ga0209675_1000906 Ga0209675_100090613 248
159 3300025294 Ga0209025_1002860 Ga0209025_10028608 248
160 3300025295 Ga0209564_1001298 Ga0209564_10012987 248
161 3300025297 Ga0209758_1023254 Ga0209758_10232543 248
162 3300025299 Ga0209256_1003779 Ga0209256_10037795 248
163 3300047320 Ga0495672_0009363 Ga0495672_0009363_5249_6040 248
164 3300025924 Ga0207694_10319943 Ga0207694_103199432 249
165 3300046454 Ga0495592_0076936 Ga0495592_0076936_1619_2389 249
166 3300046810 Ga0495660_0076592 Ga0495660_0076592_790_1560 249
167 3300047323 Ga0495683_0011576 Ga0495683_0011576_796_1566 249
168 3300048091 Ga0495626_0018295 Ga0495626_0018295_1499_2269 249
169 3300048922 Ga0496119_0113403 Ga0496119_0113403_188_1006 250
170 3300010159 Ga0099796_10000063 Ga0099796_100000633 252
171 3300046462 Ga0495651_0200182 Ga0495651_0200182_539_1351 252
172 3300047317 Ga0495604_0006557 Ga0495604_0006557_3377_4189 252
173 3300047444 Ga0495675_0013701 Ga0495675_0013701_616_1428 252
174 3300048906 Ga0496103_0003774 Ga0496103_0003774_929_1744 252
175 3300048920 Ga0496117_0003919 Ga0496117_0003919_11287_12102 252
176 3300048921 Ga0496118_0000215 Ga0496118_0000215_88732_89547 252
177 3300048929 Ga0496126_0431176 Ga0496126_0431176_240_1031 252
178 iso_pu_bacteria 2501025502 2501084418 252
179 iso_pu_bacteria 2510917013 2511088502 252
180 iso_pu_bacteria 2904615490 2904622153 252
181 3300046454 Ga0495592_0028665 Ga0495592_0028665_1314_2129 253
182 3300046458 Ga0495591_004355 Ga0495591_004355_4998_5813 253
183 3300046459 Ga0495629_0009512 Ga0495629_0009512_4909_5724 253
184 3300046462 Ga0495651_0013144 Ga0495651_0013144_5050_5865 253
185 3300046463 Ga0495653_0105974 Ga0495653_0105974_435_1250 253
186 3300046472 Ga0495580_0142296 Ga0495580_0142296_664_1479 253
187 3300046476 Ga0495662_0016718 Ga0495662_0016718_909_1724 253
188 3300046516 Ga0495628_0064189 Ga0495628_0064189_910_1725 253
189 3300046524 Ga0495648_0040367 Ga0495648_0040367_1709_2524 253
190 3300046526 Ga0495666_0013125 Ga0495666_0013125_2137_2952 253
191 3300046529 Ga0495652_0016081 Ga0495652_0016081_4539_5354 253
192 3300046533 Ga0495640_0012834 Ga0495640_0012834_4925_5740 253
193 3300046536 Ga0495587_0019491 Ga0495587_0019491_1600_2415 253
194 3300046642 Ga0495634_0076630 Ga0495634_0076630_1070_1885 253
195 3300046663 Ga0495635_0062940 Ga0495635_0062940_651_1466 253
196 3300046665 Ga0495661_0011321 Ga0495661_0011321_436_1251 253
197 3300046678 Ga0495599_0039347 Ga0495599_0039347_2099_2914 253
198 3300046679 Ga0495623_0009831 Ga0495623_0009831_3521_4336 253
199 3300046680 Ga0495646_0089898 Ga0495646_0089898_310_1125 253
200 3300046689 Ga0495613_0045430 Ga0495613_0045430_779_1594 253
201 3300046690 Ga0495624_0059864 Ga0495624_0059864_910_1725 253
202 3300046794 Ga0495589_0026443 Ga0495589_0026443_664_1479 253
203 3300046809 Ga0495600_0004960 Ga0495600_0004960_759_1574 253
204 3300047315 Ga0495581_0017288 Ga0495581_0017288_1652_2467 253
205 3300047317 Ga0495604_0012959 Ga0495604_0012959_1163_1978 253
206 3300047319 Ga0495674_0111666 Ga0495674_0111666_216_1031 253
207 3300047321 Ga0495676_0031199 Ga0495676_0031199_1830_2645 253
208 3300047322 Ga0495680_0069392 Ga0495680_0069392_505_1320 253
209 3300047444 Ga0495675_0001013 Ga0495675_0001013_5102_5917 253
210 3300047446 Ga0495679_001343 Ga0495679_001343_11184_11999 253
211 3300047469 Ga0495673_0006705 Ga0495673_0006705_4101_4916 253
212 3300047673 Ga0495593_0052233 Ga0495593_0052233_910_1725 253
213 3300048088 Ga0495602_0132686 Ga0495602_0132686_664_1479 253
214 3300048089 Ga0495614_0010644 Ga0495614_0010644_1958_2773 253
215 3300048924 Ga0496121_0001279 Ga0496121_0001279_9129_9950 253
216 3300048929 Ga0496126_0002530 Ga0496126_0002530_10942_11763 253
217 3300013296 Ga0157374_10000034 Ga0157374_1000003459 254
218 3300025904 Ga0207647_10020333 Ga0207647_100203332 254
219 iso_pu_bacteria 2510917014 2511100896 254
220 iso_pu_bacteria 2510917015 2511107345 254
221 iso_pu_bacteria 2515154189 2516020496 254
222 iso_pu_bacteria 2582581311 2585293823 254
223 iso_pu_bacteria 2599185239 2599735331 254
224 iso_pu_bacteria 2599185240 2599743450 254
225 iso_pu_bacteria 2599185355 2600205318 254
226 iso_pu_bacteria 2675903129 2676740615 254
227 iso_pu_bacteria 2808606384 2808969467 254
228 iso_pu_bacteria 2808606390 2809004298 254
229 iso_pu_bacteria 2808606391 2809012876 254
230 iso_pu_bacteria 2816332253 2817258695 254
231 iso_pu_bacteria 2816332256 2817280874 254
232 iso_pu_bacteria 2816332286 2817453389 254
233 iso_pu_bacteria 2818991452 2819632239 254
234 iso_pu_bacteria 2863421361 2863422616 254
235 iso_pu_bacteria 2870068957 2870072832 254
236 iso_pu_bacteria 2883087390 2883089525 254
237 iso_pu_bacteria 2904564687 2904565118 254
238 iso_pu_bacteria 2904571731 2904572186 254
239 iso_pu_bacteria 2928157003 2928157312 254
240 iso_pu_bacteria 2928163908 2928165158 254
241 iso_pu_bacteria 2928170801 2928172410 254
242 iso_pu_bacteria 2928536128 2928537509 254
243 iso_pu_bacteria 2981990288 2981990295 254
244 iso_pu_bacteria 641736154 642417524 254
245 iso_pu_bacteria 8018845410 8018851687 254
246 iso_pu_bacteria 8020807995 8020812433 254
247 iso_pu_bacteria 8020938398 8020944289 254
248 iso_pu_bacteria 8020945358 8020952668 254
249 iso_pu_bacteria 8020953355 8020953978 254
250 iso_pu_bacteria 8021120328 8021120678 254
251 iso_pu_bacteria 8039098773 8039102948 254
252 iso_pu_bacteria 8040167225 8040169407 254
253 iso_pu_bacteria 8040173305 8040173800 254
254 3300005366 Ga0070659_100441072 Ga0070659_1004410721 255
255 3300013306 Ga0163162_10005558 Ga0163162_100055586 255
256 3300046471 Ga0495650_0003550 Ga0495650_0003550_4119_4934 255
257 3300046516 Ga0495628_0258021 Ga0495628_0258021_388_1206 255
258 3300047317 Ga0495604_0030671 Ga0495604_0030671_1411_2241 255
259 3300047472 Ga0495686_0000002 Ga0495686_0000002_253069_253887 255
260 3300048920 Ga0496117_0001575 Ga0496117_0001575_25786_26634 255
261 3300048921 Ga0496118_0010590 Ga0496118_0010590_2506_3354 255
262 3300048929 Ga0496126_0000393 Ga0496126_0000393_45920_46768 255
263 3300009011 Ga0105251_10000714 Ga0105251_1000071413 257
264 3300009098 Ga0105245_10031275 Ga0105245_100312752 257
265 3300009174 Ga0105241_10077514 Ga0105241_100775142 257
266 3300009174 Ga0105241_10216080 Ga0105241_102160802 257
267 3300009545 Ga0105237_10183206 Ga0105237_101832062 257
268 3300009551 Ga0105238_10191105 Ga0105238_101911052 257
269 3300013296 Ga0157374_10705339 Ga0157374_107053391 257
270 3300025302 Ga0207426_1001366 Ga0207426_100136615 257
271 3300025735 Ga0207713_1002233 Ga0207713_10022334 257
272 3300025913 Ga0207695_10434851 Ga0207695_104348512 257
273 3300027312 Ga0209371_1011628 Ga0209371_10116283 257
274 3300030500 Ga0268256_1010581 Ga0268256_10105812 257
275 3300038443 Ga0395901_0000004 Ga0395901_0000004_606664_607473 257
276 3300046477 Ga0495664_0007907 Ga0495664_0007907_4829_5641 257
277 3300046491 Ga0495584_0133439 Ga0495584_0133439_238_1050 257
278 3300046517 Ga0495630_0075101 Ga0495630_0075101_1484_2296 257
279 3300046531 Ga0495665_0086675 Ga0495665_0086675_535_1347 257
280 3300046542 Ga0495597_0004638 Ga0495597_0004638_2041_2853 257
281 3300046543 Ga0495645_0003992 Ga0495645_0003992_5712_6524 257
282 3300046690 Ga0495624_0018707 Ga0495624_0018707_404_1216 257
283 3300047317 Ga0495604_0074166 Ga0495604_0074166_905_1717 257
284 3300047322 Ga0495680_0006673 Ga0495680_0006673_3013_3825 257
285 3300047323 Ga0495683_0006194 Ga0495683_0006194_2722_3534 257
286 3300047444 Ga0495675_0172333 Ga0495675_0172333_207_1019 257
287 3300047444 Ga0495675_0256624 Ga0495675_0256624_62_874 257
288 3300047469 Ga0495673_0039560 Ga0495673_0039560_43_855 257
289 3300047673 Ga0495593_0031686 Ga0495593_0031686_701_1513 257
290 3300047673 Ga0495593_0101989 Ga0495593_0101989_553_1365 257
291 3300048088 Ga0495602_0047606 Ga0495602_0047606_767_1579 257
292 3300048904 Ga0496101_0008320 Ga0496101_0008320_5947_6759 257
293 3300048904 Ga0496101_0120959 Ga0496101_0120959_17_829 257
294 3300048905 Ga0496102_0113528 Ga0496102_0113528_1696_2508 257
295 3300048906 Ga0496103_0113437 Ga0496103_0113437_761_1573 257
296 3300048907 Ga0496104_0199984 Ga0496104_0199984_736_1548 257
297 3300048909 Ga0496106_0026259 Ga0496106_0026259_377_1189 257
298 3300048909 Ga0496106_0214582 Ga0496106_0214582_375_1187 257
299 3300048910 Ga0496107_0022553 Ga0496107_0022553_1929_2741 257
300 3300048912 Ga0496109_0157605 Ga0496109_0157605_35_847 257
301 3300048913 Ga0496110_0006703 Ga0496110_0006703_1216_2028 257
302 3300048914 Ga0496111_0062847 Ga0496111_0062847_1262_2074 257
303 3300048915 Ga0496112_0005011 Ga0496112_0005011_4618_5430 257
304 3300048916 Ga0496113_0048511 Ga0496113_0048511_518_1330 257
305 3300048918 Ga0496115_0414442 Ga0496115_0414442_24_836 257
306 3300048919 Ga0496116_0008695 Ga0496116_0008695_4626_5438 257
307 3300048920 Ga0496117_0062182 Ga0496117_0062182_1730_2542 257
308 3300048921 Ga0496118_0042769 Ga0496118_0042769_642_1454 257
309 3300048922 Ga0496119_0211102 Ga0496119_0211102_166_978 257
310 3300048924 Ga0496121_0004851 Ga0496121_0004851_16093_16905 257
311 3300048925 Ga0496122_0004966 Ga0496122_0004966_12714_13526 257
312 3300048927 Ga0496124_0016484 Ga0496124_0016484_5773_6585 257
313 3300048928 Ga0496125_0012001 Ga0496125_0012001_5569_6381 257
314 3300048929 Ga0496126_0627121 Ga0496126_0627121_16_828 257
315 3300001979 JGI24740J21852_10046178 JGI24740J21852_100461782 258
316 3300003316 rootH1_10087144 rootH1_100871442 258
317 3300003758 Ga0055532_1002398 Ga0055532_10023983 258
318 3300003758 Ga0055532_1002815 Ga0055532_10028153 258
319 3300003758 Ga0055532_1002986 Ga0055532_10029862 258
320 3300003760 Ga0055527_1002274 Ga0055527_10022742 258
321 3300003760 Ga0055527_1002647 Ga0055527_10026473 258
322 3300003761 Ga0055535_1004527 Ga0055535_10045272 258
323 3300003761 Ga0055535_1004823 Ga0055535_10048232 258
324 3300003762 Ga0055542_1004561 Ga0055542_10045612 258
325 3300003762 Ga0055542_1004854 Ga0055542_10048542 258
326 3300003763 Ga0055529_1002308 Ga0055529_10023082 258
327 3300003790 Ga0055528_1006793 Ga0055528_10067933 258
328 3300003856 Ga0058692_1006976 Ga0058692_10069762 258
329 3300005339 Ga0070660_100000002 Ga0070660_100000002132 258
330 3300005366 Ga0070659_100000007 Ga0070659_100000007108 258
331 3300005455 Ga0070663_100002432 Ga0070663_1000024327 258
332 3300005563 Ga0068855_100076194 Ga0068855_1000761942 258
333 3300005564 Ga0070664_100220927 Ga0070664_1002209272 258
334 3300005614 Ga0068856_100190786 Ga0068856_1001907862 258
335 3300005616 Ga0068852_100081166 Ga0068852_1000811662 258
336 3300009093 Ga0105240_10012433 Ga0105240_100124339 258
337 3300009545 Ga0105237_10019403 Ga0105237_100194035 258
338 3300009551 Ga0105238_10213466 Ga0105238_102134662 258
339 3300010375 Ga0105239_10014066 Ga0105239_100140664 258
340 3300025225 Ga0209566_100307 Ga0209566_10030718 258
341 3300025228 Ga0209672_100015 Ga0209672_100015233 258
342 3300025228 Ga0209672_100031 Ga0209672_100031292 258
343 3300025229 Ga0209147_100016 Ga0209147_100016231 258
344 3300025229 Ga0209147_100503 Ga0209147_10050317 258
345 3300025229 Ga0209147_100611 Ga0209147_10061112 258
346 3300025242 Ga0209258_100026 Ga0209258_100026233 258
347 3300025242 Ga0209258_100774 Ga0209258_1007746 258
348 3300025254 Ga0209148_1000070 Ga0209148_10000706 258
349 3300025254 Ga0209148_1001109 Ga0209148_10011094 258
350 3300025263 Ga0209565_1004340 Ga0209565_10043404 258
351 3300025272 Ga0209455_1000069 Ga0209455_1000069272 258
352 3300025272 Ga0209455_1005672 Ga0209455_10056722 258
353 3300025273 Ga0209673_1000028 Ga0209673_1000028311 258
354 3300025904 Ga0207647_10003311 Ga0207647_1000331111 258
355 3300025909 Ga0207705_10044905 Ga0207705_100449053 258
356 3300025913 Ga0207695_10031137 Ga0207695_100311372 258
357 3300025914 Ga0207671_10052985 Ga0207671_100529853 258
358 3300025919 Ga0207657_10000012 Ga0207657_1000001226 258
359 3300025932 Ga0207690_10000008 Ga0207690_10000008196 258
360 3300025949 Ga0207667_10334758 Ga0207667_103347582 258
361 3300026067 Ga0207678_10001382 Ga0207678_100013829 258
362 3300026142 Ga0207698_10007664 Ga0207698_100076645 258
363 3300027312 Ga0209371_1000670 Ga0209371_100067012 258
364 3300030500 Ga0268256_1000567 Ga0268256_100056712 258
365 3300039437 Ga0436365_1156792 Ga0436365_1156792_919_1728 258
366 3300045976 Ga0466967_0622360 Ga0466967_0622360_201_1031 258
367 3300046557 Ga0495622_0000140 Ga0495622_0000140_8253_9083 258
368 3300046690 Ga0495624_0025826 Ga0495624_0025826_1141_1971 258
369 3300003771 Ga0055526_1014101 Ga0055526_10141013 259
370 3300003775 Ga0055524_1007937 Ga0055524_10079372 259
371 3300025291 Ga0209675_1009780 Ga0209675_10097802 259
372 3300025294 Ga0209025_1010269 Ga0209025_10102692 259
373 3300025295 Ga0209564_1000615 Ga0209564_100061552 259
374 3300025299 Ga0209256_1000386 Ga0209256_100038625 259
375 3300025303 Ga0209051_1008382 Ga0209051_10083824 259
376 3300027666 Ga0209282_1000156 Ga0209282_100015618 259
377 3300046474 Ga0495605_0006271 Ga0495605_0006271_2846_3673 259
378 3300046500 Ga0495596_0000157 Ga0495596_0000157_31523_32350 259
379 3300046512 Ga0495610_0000623 Ga0495610_0000623_31524_32351 259
380 3300046513 Ga0495616_0006731 Ga0495616_0006731_3470_4297 259
381 3300046524 Ga0495648_0138951 Ga0495648_0138951_425_1252 259
382 3300046538 Ga0495609_0002254 Ga0495609_0002254_8554_9381 259
383 3300046665 Ga0495661_0007417 Ga0495661_0007417_6064_6891 259
384 3300046692 Ga0495671_0000232 Ga0495671_0000232_44553_45380 259
385 3300046794 Ga0495589_0047006 Ga0495589_0047006_1224_2051 259
386 3300047320 Ga0495672_0027948 Ga0495672_0027948_251_1078 259
387 3300047447 Ga0495685_005621 Ga0495685_005621_2107_2934 259
388 3300047469 Ga0495673_0051139 Ga0495673_0051139_966_1793 259
389 3300048924 Ga0496121_0006443 Ga0496121_0006443_11059_11886 259
390 3300048925 Ga0496122_0002377 Ga0496122_0002377_23496_24323 259
391 3300048926 Ga0496123_0000963 Ga0496123_0000963_40860_41687 259
392 iso_pu_bacteria 2510065045 2510248666 259
393 iso_pu_bacteria 2512047030 2512349225 259
394 iso_pu_bacteria 2515154122 2515680092 259
395 iso_pu_bacteria 2718217991 2719642908 259
396 iso_pu_bacteria 2842324504 2842326641 259
397 iso_pu_bacteria 2842348783 2842350245 259
398 iso_pu_bacteria 2842454564 2842455894 259
399 iso_pu_bacteria 2900634093 2900638639 259
400 iso_pu_bacteria 2902682994 2902688063 259
401 iso_pu_bacteria 642555113 642615391 259
402 3300005327 Ga0070658_10008169 Ga0070658_100081693 260
403 3300005563 Ga0068855_100014409 Ga0068855_1000144093 260
404 3300009093 Ga0105240_10129030 Ga0105240_101290304 260
405 3300025909 Ga0207705_10001880 Ga0207705_1000188012 260
406 3300025913 Ga0207695_10118654 Ga0207695_101186543 260
407 3300025949 Ga0207667_10009108 Ga0207667_100091087 260
408 3300047673 Ga0495593_0041848 Ga0495593_0041848_1279_2112 260
409 iso_pu_bacteria 2791355137 2792837983 260
410 iso_pu_bacteria 2818991450 2819619383 260
411 iso_pu_bacteria 2928108538 2928111594 260
412 iso_pu_bacteria 2928135762 2928138396 260
413 iso_pu_bacteria 2928503688 2928504795 260
414 3300003187 JGI25151J46595_10001559 JGI25151J46595_1000155913 261
415 3300003354 JGI25160J50197_1000891 JGI25160J50197_10008915 261
416 3300003771 Ga0055526_1014140 Ga0055526_10141403 261
417 3300003781 Ga0055536_1000151 Ga0055536_10001518 261
418 3300003784 Ga0055534_1000430 Ga0055534_10004309 261
419 3300005262 Ga0065165_1003328 Ga0065165_10033285 261
420 3300005327 Ga0070658_10132222 Ga0070658_101322222 261
421 3300005339 Ga0070660_100113586 Ga0070660_1001135862 261
422 3300005353 Ga0070669_100490953 Ga0070669_1004909531 261
423 3300005455 Ga0070663_100091781 Ga0070663_1000917812 261
424 3300009011 Ga0105251_10018195 Ga0105251_100181953 261
425 3300009093 Ga0105240_10054386 Ga0105240_100543863 261
426 3300009545 Ga0105237_10006678 Ga0105237_100066787 261
427 3300009551 Ga0105238_10205122 Ga0105238_102051222 261
428 3300009553 Ga0105249_10400139 Ga0105249_104001392 261
429 3300010375 Ga0105239_10011331 Ga0105239_100113314 261
430 3300013104 Ga0157370_10011490 Ga0157370_100114904 261
431 3300013105 Ga0157369_10003434 Ga0157369_100034349 261
432 3300013105 Ga0157369_10014340 Ga0157369_100143402 261
433 3300013297 Ga0157378_10388832 Ga0157378_103888322 261
434 3300013306 Ga0163162_10001260 Ga0163162_1000126010 261
435 3300013307 Ga0157372_10039719 Ga0157372_100397192 261
436 3300013308 Ga0157375_10032502 Ga0157375_100325022 261
437 3300025284 Ga0209130_1006892 Ga0209130_10068922 261
438 3300025291 Ga0209675_1000040 Ga0209675_1000040143 261
439 3300025292 Ga0209676_1000014 Ga0209676_1000014510 261
440 3300025294 Ga0209025_1000092 Ga0209025_1000092144 261
441 3300025295 Ga0209564_1000159 Ga0209564_10001593 261
442 3300025302 Ga0207426_1000180 Ga0207426_1000180142 261
443 3300025903 Ga0207680_10040799 Ga0207680_100407993 261
444 3300025904 Ga0207647_10000977 Ga0207647_1000097718 261
445 3300025913 Ga0207695_10071675 Ga0207695_100716753 261
446 3300025914 Ga0207671_10023359 Ga0207671_100233594 261
447 3300025919 Ga0207657_10157219 Ga0207657_101572192 261
448 3300025923 Ga0207681_10441913 Ga0207681_104419132 261
449 3300025927 Ga0207687_10301751 Ga0207687_103017512 261
450 3300025949 Ga0207667_10009509 Ga0207667_100095096 261
451 3300025972 Ga0207668_10093997 Ga0207668_100939972 261
452 3300042005 Ga0439448_0000018 Ga0439448_0000018_11330_12166 261
453 3300046455 Ga0495603_0002366 Ga0495603_0002366_7467_8291 261
454 3300046459 Ga0495629_0000247 Ga0495629_0000247_38917_39741 261
455 3300046460 Ga0495638_0000976 Ga0495638_0000976_27823_28650 261
456 3300046462 Ga0495651_0080039 Ga0495651_0080039_753_1559 261
457 3300046471 Ga0495650_0000554 Ga0495650_0000554_34332_35156 261
458 3300046472 Ga0495580_0001335 Ga0495580_0001335_4902_5708 261
459 3300046472 Ga0495580_0027655 Ga0495580_0027655_128_952 261
460 3300046474 Ga0495605_0001989 Ga0495605_0001989_11096_11923 261
461 3300046477 Ga0495664_0080606 Ga0495664_0080606_460_1284 261
462 3300046500 Ga0495596_0112912 Ga0495596_0112912_123_947 261
463 3300046506 Ga0495583_0054868 Ga0495583_0054868_534_1358 261
464 3300046507 Ga0495606_0009209 Ga0495606_0009209_5955_6779 261
465 3300046507 Ga0495606_0068135 Ga0495606_0068135_1215_2039 261
466 3300046517 Ga0495630_0010361 Ga0495630_0010361_4763_5569 261
467 3300046526 Ga0495666_0002384 Ga0495666_0002384_3701_4507 261
468 3300046529 Ga0495652_0052543 Ga0495652_0052543_1258_2064 261
469 3300046529 Ga0495652_0174517 Ga0495652_0174517_542_1366 261
470 3300046530 Ga0495654_0180202 Ga0495654_0180202_27_851 261
471 3300046543 Ga0495645_0043274 Ga0495645_0043274_1945_2769 261
472 3300046559 Ga0495667_0175210 Ga0495667_0175210_169_993 261
473 3300046678 Ga0495599_0016332 Ga0495599_0016332_2417_3223 261
474 3300046680 Ga0495646_0035805 Ga0495646_0035805_1260_2066 261
475 3300046684 Ga0495669_0000883 Ga0495669_0000883_5997_6824 261
476 3300046690 Ga0495624_0000346 Ga0495624_0000346_21991_22797 261
477 3300046691 Ga0495670_0092625 Ga0495670_0092625_47_871 261
478 3300046694 Ga0495649_0006145 Ga0495649_0006145_658_1482 261
479 3300046794 Ga0495589_0002642 Ga0495589_0002642_3118_3945 261
480 3300046794 Ga0495589_0063341 Ga0495589_0063341_777_1601 261
481 3300046794 Ga0495589_0116085 Ga0495589_0116085_21_845 261
482 3300047315 Ga0495581_0003043 Ga0495581_0003043_113_937 261
483 3300047322 Ga0495680_0138733 Ga0495680_0138733_339_1145 261
484 3300047443 Ga0495687_009463 Ga0495687_009463_2503_3327 261
485 3300047446 Ga0495679_039979 Ga0495679_039979_624_1448 261
486 3300047446 Ga0495679_075105 Ga0495679_075105_33_860 261
487 3300047673 Ga0495593_0026354 Ga0495593_0026354_2251_3075 261
488 3300048903 Ga0496100_0000313 Ga0496100_0000313_19253_20107 261
489 3300048904 Ga0496101_0001365 Ga0496101_0001365_2458_3312 261
490 3300048904 Ga0496101_0013371 Ga0496101_0013371_2236_3060 261
491 3300048905 Ga0496102_0002592 Ga0496102_0002592_2190_3044 261
492 3300048906 Ga0496103_0000841 Ga0496103_0000841_12381_13235 261
493 3300048906 Ga0496103_0123442 Ga0496103_0123442_80_907 261
494 3300048908 Ga0496105_0242575 Ga0496105_0242575_426_1253 261
495 3300048909 Ga0496106_0000025 Ga0496106_0000025_82416_83264 261
496 3300048909 Ga0496106_0081767 Ga0496106_0081767_343_1170 261
497 3300048910 Ga0496107_0117505 Ga0496107_0117505_270_1097 261
498 3300048913 Ga0496110_0610431 Ga0496110_0610431_131_955 261
499 3300048917 Ga0496114_0018555 Ga0496114_0018555_2316_3140 261
500 3300048918 Ga0496115_0055943 Ga0496115_0055943_2310_3134 261
501 3300048918 Ga0496115_0185087 Ga0496115_0185087_181_1008 261
502 3300048920 Ga0496117_0001465 Ga0496117_0001465_20682_21536 261
503 3300048921 Ga0496118_0001565 Ga0496118_0001565_12418_13272 261
504 3300048924 Ga0496121_0001850 Ga0496121_0001850_12431_13285 261
505 3300048929 Ga0496126_0002361 Ga0496126_0002361_4923_5729 261
506 iso_pu_bacteria 2513237166 2514051927 261
507 iso_pu_bacteria 2562617112 2563058510 261
508 iso_pu_bacteria 2711768613 2713474952 261
509 iso_pu_bacteria 2921643360 2921653393 261
510 iso_pu_bacteria 642555112 642595643 261
511 3300003320 rootH2_10030674 rootH2_100306742 262
512 3300003322 rootL2_10043099 rootL2_100430992 262
513 3300003322 rootL2_10052145 rootL2_100521453 262
514 3300009177 Ga0105248_10526183 Ga0105248_105261832 262
515 3300013105 Ga0157369_10000093 Ga0157369_10000093105 262
516 3300020081 Ga0206354_11101660 Ga0206354_111016604 262
517 3300022467 Ga0224712_10000105 Ga0224712_100001053 262
518 3300025295 Ga0209564_1033396 Ga0209564_10333962 262
519 3300025941 Ga0207711_10374484 Ga0207711_103744842 262
520 3300031548 Ga0307408_100024560 Ga0307408_1000245603 262
521 3300037312 Ga0395899_0000023 Ga0395899_0000023_160772_161584 262
522 3300037312 Ga0395899_0016219 Ga0395899_0016219_561_1385 262
523 3300037418 Ga0395900_0000019 Ga0395900_0000019_205576_206388 262
524 3300037418 Ga0395900_0216086 Ga0395900_0216086_173_985 262
525 3300037466 Ga0395898_0000016 Ga0395898_0000016_200725_201537 262
526 3300037466 Ga0395898_0012589 Ga0395898_0012589_2890_3702 262
527 3300038443 Ga0395901_0000326 Ga0395901_0000326_9596_10408 262
528 3300045836 Ga0466958_0005081 Ga0466958_0005081_2045_2869 262
529 3300046455 Ga0495603_0031577 Ga0495603_0031577_1815_2669 262
530 3300046472 Ga0495580_0002997 Ga0495580_0002997_11990_12844 262
531 3300046506 Ga0495583_0020605 Ga0495583_0020605_1663_2517 262
532 3300046513 Ga0495616_0025441 Ga0495616_0025441_1765_2619 262
533 3300046524 Ga0495648_0017371 Ga0495648_0017371_4127_4981 262
534 3300046531 Ga0495665_0005589 Ga0495665_0005589_3953_4807 262
535 3300046557 Ga0495622_0010112 Ga0495622_0010112_1672_2526 262
536 3300047319 Ga0495674_0007070 Ga0495674_0007070_7874_8728 262
537 3300047320 Ga0495672_0042048 Ga0495672_0042048_983_1837 262
538 3300047472 Ga0495686_0041119 Ga0495686_0041119_1310_2128 262
539 3300048904 Ga0496101_0132837 Ga0496101_0132837_964_1818 262
540 3300048906 Ga0496103_0097569 Ga0496103_0097569_841_1695 262
541 3300048908 Ga0496105_0023742 Ga0496105_0023742_2165_3019 262
542 3300048910 Ga0496107_0026960 Ga0496107_0026960_1952_2806 262
543 3300048916 Ga0496113_0000580 Ga0496113_0000580_15609_16463 262
544 3300048923 Ga0496120_0062677 Ga0496120_0062677_567_1421 262
545 3300048924 Ga0496121_0027364 Ga0496121_0027364_1966_2820 262
546 3300048924 Ga0496121_0094864 Ga0496121_0094864_1047_1865 262
547 3300049460 Ga0495682_0021538 Ga0495682_0021538_736_1590 262
548 3300002705 JGI25156J39149_1000388 JGI25156J39149_10003883 263
549 3300025256 Ga0209759_1000094 Ga0209759_10000947 263
550 3300046457 Ga0495590_0002819 Ga0495590_0002819_106_918 263
551 3300046459 Ga0495629_0000704 Ga0495629_0000704_8392_9204 263
552 3300046460 Ga0495638_0022862 Ga0495638_0022862_1444_2256 263
553 3300046463 Ga0495653_0001472 Ga0495653_0001472_6565_7377 263
554 3300046471 Ga0495650_0002743 Ga0495650_0002743_7786_8598 263
555 3300046472 Ga0495580_0015765 Ga0495580_0015765_106_918 263
556 3300046472 Ga0495580_0323732 Ga0495580_0323732_106_918 263
557 3300046500 Ga0495596_0017129 Ga0495596_0017129_116_928 263
558 3300046506 Ga0495583_0006948 Ga0495583_0006948_5066_5878 263
559 3300046515 Ga0495620_0007184 Ga0495620_0007184_574_1386 263
560 3300046516 Ga0495628_0014740 Ga0495628_0014740_4128_4940 263
561 3300046517 Ga0495630_0027150 Ga0495630_0027150_2109_2921 263
562 3300046519 Ga0495632_0039935 Ga0495632_0039935_582_1394 263
563 3300046526 Ga0495666_0029908 Ga0495666_0029908_366_1178 263
564 3300046531 Ga0495665_0014770 Ga0495665_0014770_1371_2183 263
565 3300046538 Ga0495609_0009119 Ga0495609_0009119_3686_4498 263
566 3300046648 Ga0495611_0031044 Ga0495611_0031044_1424_2236 263
567 3300046665 Ga0495661_0026177 Ga0495661_0026177_1297_2109 263
568 3300046680 Ga0495646_0006405 Ga0495646_0006405_4740_5552 263
569 3300046690 Ga0495624_0101474 Ga0495624_0101474_305_1117 263
570 3300046690 Ga0495624_0101484 Ga0495624_0101484_305_1117 263
571 3300046692 Ga0495671_0025069 Ga0495671_0025069_863_1675 263
572 3300047319 Ga0495674_0027093 Ga0495674_0027093_4003_4815 263
573 3300047319 Ga0495674_0158665 Ga0495674_0158665_427_1239 263
574 3300047320 Ga0495672_0095199 Ga0495672_0095199_66_878 263
575 3300047321 Ga0495676_0187349 Ga0495676_0187349_520_1332 263
576 3300047443 Ga0495687_034369 Ga0495687_034369_1394_2206 263
577 3300047446 Ga0495679_000117 Ga0495679_000117_61967_62779 263
578 3300047472 Ga0495686_0128544 Ga0495686_0128544_237_1049 263
579 3300047673 Ga0495593_0094536 Ga0495593_0094536_557_1369 263
580 3300048921 Ga0496118_0030359 Ga0496118_0030359_1988_2800 263
581 3300048924 Ga0496121_0031945 Ga0496121_0031945_1094_1906 263
582 iso_pu_bacteria 2513237151 2513958275 263
583 iso_pu_bacteria 2857357740 2857367849 263
584 3300001989 JGI24739J22299_10000666 JGI24739J22299_100006669 264
585 3300005616 Ga0068852_100289365 Ga0068852_1002893652 264
586 3300009011 Ga0105251_10001186 Ga0105251_100011869 264
587 3300013102 Ga0157371_10008061 Ga0157371_100080615 264
588 3300013105 Ga0157369_10000084 Ga0157369_1000008454 264
589 3300015262 Ga0182007_10000198 Ga0182007_1000019835 264
590 3300020081 Ga0206354_11661290 Ga0206354_116612902 264
591 3300025735 Ga0207713_1000590 Ga0207713_100059019 264
592 3300037418 Ga0395900_0000182 Ga0395900_0000182_53504_54346 264
593 3300037466 Ga0395898_0001753 Ga0395898_0001753_5688_6518 264
594 3300037466 Ga0395898_0006217 Ga0395898_0006217_6336_7166 264
595 3300037471 Ga0395905_0000004 Ga0395905_0000004_530651_531520 264
596 3300038443 Ga0395901_0000040 Ga0395901_0000040_109424_110254 264
597 3300038443 Ga0395901_0029069 Ga0395901_0029069_1148_1978 264
598 3300044656 Ga0466969_0001035 Ga0466969_0001035_9838_10707 264
599 3300044659 Ga0466973_0031288 Ga0466973_0031288_1464_2333 264
600 3300044683 Ga0466965_0001868 Ga0466965_0001868_7676_8545 264
601 3300044684 Ga0466966_0001688 Ga0466966_0001688_5873_6703 264
602 3300044684 Ga0466966_0017560 Ga0466966_0017560_3132_4001 264
603 3300044693 Ga0466961_0000909 Ga0466961_0000909_15172_16041 264
604 3300044693 Ga0466961_0254238 Ga0466961_0254238_76_939 264
605 3300044694 Ga0466963_0002294 Ga0466963_0002294_9739_10569 264
606 3300044765 Ga0466970_0023727 Ga0466970_0023727_2263_3132 264
607 3300044842 Ga0466957_0006925 Ga0466957_0006925_3519_4349 264
608 3300046459 Ga0495629_0002464 Ga0495629_0002464_1120_1935 264
609 3300046461 Ga0495641_0019953 Ga0495641_0019953_1051_1866 264
610 3300046463 Ga0495653_0002197 Ga0495653_0002197_10330_11145 264
611 3300046472 Ga0495580_0000008 Ga0495580_0000008_14646_15461 264
612 3300046473 Ga0495582_0000202 Ga0495582_0000202_15459_16274 264
613 3300046477 Ga0495664_0000389 Ga0495664_0000389_11281_12096 264
614 3300046514 Ga0495618_0002329 Ga0495618_0002329_7767_8582 264
615 3300046516 Ga0495628_0002415 Ga0495628_0002415_1552_2367 264
616 3300046516 Ga0495628_0159434 Ga0495628_0159434_813_1628 264
617 3300046517 Ga0495630_0001539 Ga0495630_0001539_1836_2651 264
618 3300046524 Ga0495648_0018461 Ga0495648_0018461_575_1390 264
619 3300046526 Ga0495666_0000247 Ga0495666_0000247_9390_10205 264
620 3300046529 Ga0495652_0034838 Ga0495652_0034838_156_971 264
621 3300046531 Ga0495665_0049906 Ga0495665_0049906_156_971 264
622 3300046535 Ga0495586_0019721 Ga0495586_0019721_1120_1935 264
623 3300046536 Ga0495587_0004211 Ga0495587_0004211_2253_3068 264
624 3300046543 Ga0495645_0000886 Ga0495645_0000886_14844_15659 264
625 3300046663 Ga0495635_0002465 Ga0495635_0002465_10060_10875 264
626 3300046665 Ga0495661_0003608 Ga0495661_0003608_9389_10204 264
627 3300046680 Ga0495646_0003240 Ga0495646_0003240_28_843 264
628 3300046689 Ga0495613_0048748 Ga0495613_0048748_1193_2008 264
629 3300047315 Ga0495581_0000497 Ga0495581_0000497_6452_7267 264
630 3300047317 Ga0495604_0119590 Ga0495604_0119590_756_1571 264
631 3300047319 Ga0495674_0020471 Ga0495674_0020471_4249_5064 264
632 3300047319 Ga0495674_0040987 Ga0495674_0040987_2076_2891 264
633 3300047320 Ga0495672_0122473 Ga0495672_0122473_101_916 264
634 3300047321 Ga0495676_0003897 Ga0495676_0003897_2314_3129 264
635 3300047446 Ga0495679_001539 Ga0495679_001539_8911_9726 264
636 3300047471 Ga0495684_0017358 Ga0495684_0017358_3650_4465 264
637 3300048088 Ga0495602_0002585 Ga0495602_0002585_16152_16967 264
638 3300048089 Ga0495614_0017353 Ga0495614_0017353_1193_2008 264
639 3300048921 Ga0496118_0003868 Ga0496118_0003868_16901_17722 264
640 3300061719 Ga0466962_0000511 Ga0466962_0000511_7154_7984 264
641 3300003214 JGI25165J46597_1001417 JGI25165J46597_10014174 265
642 3300003756 Ga0055533_1000094 Ga0055533_100009444 265
643 3300003758 Ga0055532_1000003 Ga0055532_1000003195 265
644 3300003760 Ga0055527_1000006 Ga0055527_1000006260 265
645 3300003761 Ga0055535_1000003 Ga0055535_1000003195 265
646 3300003762 Ga0055542_1000007 Ga0055542_1000007195 265
647 3300003763 Ga0055529_1000003 Ga0055529_1000003260 265
648 3300009093 Ga0105240_10391096 Ga0105240_103910962 265
649 3300013105 Ga0157369_10318274 Ga0157369_103182742 265
650 3300025226 Ga0209674_100025 Ga0209674_100025190 265
651 3300025228 Ga0209672_100002 Ga0209672_1000021093 265
652 3300025229 Ga0209147_100003 Ga0209147_1000031093 265
653 3300025230 Ga0209563_103475 Ga0209563_1034754 265
654 3300025231 Ga0207427_101251 Ga0207427_1012516 265
655 3300025242 Ga0209258_100005 Ga0209258_100005735 265
656 3300025254 Ga0209148_1000006 Ga0209148_10000061093 265
657 3300025256 Ga0209759_1000014 Ga0209759_1000014262 265
658 3300025261 Ga0209233_1000018 Ga0209233_1000018260 265
659 3300025272 Ga0209455_1000003 Ga0209455_10000031093 265
660 3300025904 Ga0207647_10044284 Ga0207647_100442844 265
661 3300037466 Ga0395898_0050606 Ga0395898_0050606_2472_3323 265
662 3300038443 Ga0395901_0692096 Ga0395901_0692096_157_1008 265
663 3300044684 Ga0466966_0063219 Ga0466966_0063219_1394_2248 265
664 3300044706 Ga0466964_0007403 Ga0466964_0007403_2196_3050 265
665 3300044735 Ga0466968_0041955 Ga0466968_0041955_693_1547 265
666 3300044765 Ga0466970_0007817 Ga0466970_0007817_2263_3117 265
667 3300044842 Ga0466957_0041079 Ga0466957_0041079_801_1655 265
668 3300045836 Ga0466958_0003557 Ga0466958_0003557_2707_3561 265
669 3300046471 Ga0495650_0114046 Ga0495650_0114046_78_902 265
670 3300046472 Ga0495580_0006979 Ga0495580_0006979_6366_7190 265
671 3300046694 Ga0495649_0080542 Ga0495649_0080542_627_1460 265
672 3300047472 Ga0495686_0054564 Ga0495686_0054564_1530_2354 265
673 3300048919 Ga0496116_0023149 Ga0496116_0023149_1970_2797 265
674 iso_pu_bacteria 2508501125 2509126496 265
675 3300044694 Ga0466963_0010154 Ga0466963_0010154_2720_3577 266
676 3300044719 Ga0466971_0036075 Ga0466971_0036075_1014_1871 266
677 3300044842 Ga0466957_0001477 Ga0466957_0001477_10501_11358 266
678 3300045836 Ga0466958_0003923 Ga0466958_0003923_3438_4295 266
679 3300047319 Ga0495674_0038867 Ga0495674_0038867_1737_2558 266
680 3300061719 Ga0466962_0126597 Ga0466962_0126597_30_887 266
681 iso_pu_bacteria 2904483920 2904486850 266
682 iso_pu_bacteria 2919527303 2919528182 266
683 3300009011 Ga0105251_10048349 Ga0105251_100483492 267
684 3300048088 Ga0495602_0006600 Ga0495602_0006600_11073_11903 267
685 3300003756 Ga0055533_1008302 Ga0055533_10083022 268
686 3300016635 Ga0183361_10003 Ga0183361_10003401 268
687 3300025226 Ga0209674_100144 Ga0209674_10014472 268
688 3300025256 Ga0209759_1000008 Ga0209759_100000835 268
689 iso_pu_bacteria 2738541296 2738819350 268
690 iso_pu_bacteria 2738541298 2738831829 268
691 iso_pu_bacteria 2738541306 2738873357 268
692 iso_pu_bacteria 2738543002 2739184987 268
693 iso_pu_bacteria 2738543008 2739219956 268
694 iso_pu_bacteria 2945934425 2945940365 268
695 iso_pu_bacteria 2990703756 2990707493 268
696 iso_pu_bacteria 641736151 642423934 268
697 3300005539 Ga0068853_100512113 Ga0068853_1005121131 270
698 3300046459 Ga0495629_0011681 Ga0495629_0011681_1650_2483 270
699 3300046471 Ga0495650_0006564 Ga0495650_0006564_4711_5544 270
700 3300046477 Ga0495664_0021180 Ga0495664_0021180_309_1142 270
701 3300046511 Ga0495608_0007370 Ga0495608_0007370_2014_2847 270
702 3300046514 Ga0495618_0002763 Ga0495618_0002763_8244_9077 270
703 3300046516 Ga0495628_0247585 Ga0495628_0247585_412_1245 270
704 3300046517 Ga0495630_0031126 Ga0495630_0031126_2710_3543 270
705 3300046526 Ga0495666_0012618 Ga0495666_0012618_680_1513 270
706 3300046529 Ga0495652_0043525 Ga0495652_0043525_1774_2607 270
707 3300046533 Ga0495640_0009866 Ga0495640_0009866_2116_2949 270
708 3300046642 Ga0495634_0018717 Ga0495634_0018717_4008_4841 270
709 3300046663 Ga0495635_0041278 Ga0495635_0041278_1675_2508 270
710 3300046675 Ga0495657_0015928 Ga0495657_0015928_2736_3569 270
711 3300046680 Ga0495646_0014935 Ga0495646_0014935_1863_2696 270
712 3300046809 Ga0495600_0006113 Ga0495600_0006113_5694_6527 270
713 3300047315 Ga0495581_0012929 Ga0495581_0012929_2099_2932 270
714 3300047321 Ga0495676_0321912 Ga0495676_0321912_35_868 270
715 3300047322 Ga0495680_0116517 Ga0495680_0116517_611_1444 270
716 3300047444 Ga0495675_0008541 Ga0495675_0008541_5342_6175 270
717 iso_pu_bacteria 2526164713 2527077242 270
718 iso_pu_bacteria 8055266321 8055272104 270
719 iso_pu_bacteria 8055301274 8055304870 270
720 3300001979 JGI24740J21852_10012066 JGI24740J21852_100120664 272
721 3300025256 Ga0209759_1006541 Ga0209759_10065412 272
722 3300025919 Ga0207657_10163893 Ga0207657_101638932 272
723 3300026067 Ga0207678_10035851 Ga0207678_100358514 272
724 3300031911 Ga0307412_10000039 Ga0307412_1000003926 272
725 3300046500 Ga0495596_0110299 Ga0495596_0110299_185_1042 272
726 3300046512 Ga0495610_0001301 Ga0495610_0001301_19636_20493 272
727 3300046522 Ga0495643_0028247 Ga0495643_0028247_714_1571 272
728 3300047323 Ga0495683_0015976 Ga0495683_0015976_2469_3326 272
729 3300047443 Ga0495687_042397 Ga0495687_042397_827_1684 272
730 3300048920 Ga0496117_0017415 Ga0496117_0017415_942_1799 272
731 3300048921 Ga0496118_0045149 Ga0496118_0045149_924_1781 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23169

51

176

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u6j-assembly3.cif.gz_C halb with lysine and succinate 0.827 23 229
7jsd-assembly1.cif.gz_A hydroxylase homolog of besd with fe(ii), alpha-ketoglutarate, and lysine 0.8184 24 227
7u6h-assembly4.cif.gz_D hald with ornithine and alpha-ketoglutarate 0.8029 24 234
6nie-assembly4.cif.gz_D besd with fe(ii), chloride, and alpha-ketoglutarate 0.7985 36 227
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7962 37 227
ID Description Score Start End Superfamily
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.796 37 227 2.60.120.620
af_Q09973_31_246_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7685 37 235 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7544 31 232 2.60.120.620
af_Q9I7H9_57_285_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7451 37 230 2.60.120.620
af_Q8IL23_178_398_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7386 39 228 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A1Q7PAW2-F1-model_v4 2OG-Fe(II) oxygenase 0.9682 24 210
AF-A0A1Q7ADQ6-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9668 26 256 GO:0016491
GO:0046872
AF-A0A1F7MWU2-F1-model_v4 2OG-Fe(II) oxygenase 0.9641 23 194
AF-A0A849TUS2-F1-model_v4 2OG-Fe(II) oxygenase 0.9583 23 171
AF-A0A354BKF6-F1-model_v4 2OG-Fe(II) oxygenase 0.9569 56 204

Feature Viewer

pLDDT pTM Quality
82.7 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map