F477971
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 370 | 655 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300016635|Ga0183361_10003|Ga0183361_10003401 |
| Length | 288 |
| Sequence | MGEPMSTPAQEDVSTTTPSSNDAAGLGLAPASAIPNPGNAPDPNRAVAGRVRNFDNAKLKKDFDDQSAFLYLEDFLAPEVTAQLVAAARGLLPSVNRNYLPGHKQGGSVSRHTIDKLAPFIAQLYRSKELIGFLEKLTGDKLLLSPADDPHAYALYYYTKPGDHIGWHYDTSYYDGRRYTLLLGVIDESSCRLDYELHTRDPNKADVPGSVQIPPGGLVFFDGDKLRHRITPALDNEMRVSLTFEYVTDPNMRPWRRVISNFKDAIAYFGFRQVFSQFARRNAKGERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 4 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 5 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 6 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 7 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 8 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 9 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 10 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 11 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 14 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 15 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 16 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 17 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 18 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 19 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 20 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 21 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 22 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 23 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 24 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 25 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 26 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 27 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 28 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 29 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 30 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 31 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 32 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 33 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 34 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 35 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 36 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 37 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 38 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 39 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 40 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 41 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 42 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 43 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 44 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 45 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 46 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 47 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 48 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 49 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 50 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 51 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 52 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 53 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 54 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 55 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 56 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 57 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 58 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 59 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 60 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 61 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 62 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 63 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 64 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 65 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 66 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 67 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 70 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 88 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 91 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 215 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 349 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 357 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 358 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 359 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 360 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 361 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 362 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 363 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 364 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 365 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 366 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 367 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 368 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 369 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 370 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.92 |
| Metatranscriptomes | 0.68 |
| Isolates | 10.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.4 |
| Nodule | 2.33 |
| Rhizoplane | 7.11 |
| Rhizosphere | 68.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10012066 | 3300001979 | Bacteria | 3266 |
| 2 | JGI24740J21852_10046178 | 3300001979 | Bacteria | 1280 |
| 3 | JGI24739J22299_10000666 | 3300001989 | Bacteria | 12365 |
| 4 | JGI25156J39149_1000388 | 3300002705 | Bacteria | 27622 |
| 5 | JGI25151J46595_10001559 | 3300003187 | Bacteria | 15298 |
| 6 | JGI25151J46595_10001889 | 3300003187 | Bacteria | 13335 |
| 7 | JGI25165J46597_1001417 | 3300003214 | Bacteria | 12948 |
| 8 | rootH1_10087144 | 3300003316 | Bacteria | 2456 |
| 9 | rootH2_10030674 | 3300003320 | Bacteria | 8682 |
| 10 | rootL2_10043099 | 3300003322 | Bacteria | 4594 |
| 11 | rootL2_10052145 | 3300003322 | Bacteria | 10309 |
| 12 | JGI25160J50197_1000891 | 3300003354 | Bacteria | 15706 |
| 13 | Ga0055533_1000094 | 3300003756 | Bacteria | 115741 |
| 14 | Ga0055533_1008302 | 3300003756 | Bacteria | 1330 |
| 15 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 16 | Ga0055532_1002398 | 3300003758 | Bacteria | 3932 |
| 17 | Ga0055532_1002815 | 3300003758 | Bacteria | 3340 |
| 18 | Ga0055532_1002986 | 3300003758 | Bacteria | 3147 |
| 19 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 20 | Ga0055527_1002274 | 3300003760 | Bacteria | 3343 |
| 21 | Ga0055527_1002647 | 3300003760 | Bacteria | 2931 |
| 22 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 23 | Ga0055535_1004527 | 3300003761 | Bacteria | 3343 |
| 24 | Ga0055535_1004823 | 3300003761 | Bacteria | 3147 |
| 25 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 26 | Ga0055542_1004561 | 3300003762 | Bacteria | 3327 |
| 27 | Ga0055542_1004854 | 3300003762 | Bacteria | 3150 |
| 28 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 29 | Ga0055529_1002308 | 3300003763 | Bacteria | 3813 |
| 30 | Ga0055526_1007508 | 3300003771 | Bacteria | 5648 |
| 31 | Ga0055526_1014101 | 3300003771 | Bacteria | 3317 |
| 32 | Ga0055526_1014140 | 3300003771 | Bacteria | 3309 |
| 33 | Ga0055537_1002716 | 3300003773 | Bacteria | 5762 |
| 34 | Ga0055524_1001249 | 3300003775 | Bacteria | 14915 |
| 35 | Ga0055524_1007937 | 3300003775 | Bacteria | 4456 |
| 36 | Ga0055536_1000151 | 3300003781 | Bacteria | 59579 |
| 37 | Ga0055534_1000430 | 3300003784 | Bacteria | 25069 |
| 38 | Ga0055534_1002100 | 3300003784 | Bacteria | 7153 |
| 39 | Ga0055528_1006793 | 3300003790 | Bacteria | 5144 |
| 40 | Ga0058692_1006976 | 3300003856 | Bacteria | 3040 |
| 41 | Ga0065165_1003328 | 3300005262 | Bacteria | 11475 |
| 42 | Ga0070658_10008169 | 3300005327 | Bacteria | 8412 |
| 43 | Ga0070658_10132222 | 3300005327 | Bacteria | 2080 |
| 44 | Ga0070690_100026950 | 3300005330 | Bacteria | 3550 |
| 45 | Ga0068869_100149149 | 3300005334 | Bacteria | 1812 |
| 46 | Ga0070666_10003402 | 3300005335 | Bacteria | 9641 |
| 47 | Ga0070666_10015929 | 3300005335 | Bacteria | 4802 |
| 48 | Ga0070680_100079820 | 3300005336 | Bacteria | 2697 |
| 49 | Ga0068868_100014098 | 3300005338 | Bacteria | 5884 |
| 50 | Ga0070660_100000002 | 3300005339 | Bacteria | 177777 |
| 51 | Ga0070660_100113586 | 3300005339 | Bacteria | 2157 |
| 52 | Ga0070669_100490953 | 3300005353 | Bacteria | 1017 |
| 53 | Ga0070671_100000799 | 3300005355 | Bacteria | 22726 |
| 54 | Ga0070671_100115835 | 3300005355 | Bacteria | 2253 |
| 55 | Ga0070674_100057507 | 3300005356 | Bacteria | 2700 |
| 56 | Ga0070674_100155228 | 3300005356 | Bacteria | 1731 |
| 57 | Ga0070659_100000007 | 3300005366 | Bacteria | 204358 |
| 58 | Ga0070659_100441072 | 3300005366 | Bacteria | 1103 |
| 59 | Ga0070667_100009756 | 3300005367 | Bacteria | 7960 |
| 60 | Ga0070667_100029723 | 3300005367 | Bacteria | 4555 |
| 61 | Ga0070709_10109287 | 3300005434 | Bacteria | 1856 |
| 62 | Ga0070663_100002432 | 3300005455 | Bacteria | 10477 |
| 63 | Ga0070663_100091781 | 3300005455 | Bacteria | 2251 |
| 64 | Ga0070681_10000460 | 3300005458 | Bacteria | 33209 |
| 65 | Ga0070681_10000668 | 3300005458 | Bacteria | 28378 |
| 66 | Ga0068867_100085067 | 3300005459 | Bacteria | 2390 |
| 67 | Ga0068867_100141927 | 3300005459 | Bacteria | 1878 |
| 68 | Ga0070679_100000666 | 3300005530 | Bacteria | 29261 |
| 69 | Ga0070679_100125757 | 3300005530 | Bacteria | 2546 |
| 70 | Ga0070679_100245769 | 3300005530 | Bacteria | 1746 |
| 71 | Ga0068853_100512113 | 3300005539 | Bacteria | 1134 |
| 72 | Ga0070696_100145052 | 3300005546 | Bacteria | 1738 |
| 73 | Ga0070665_100004690 | 3300005548 | Bacteria | 14269 |
| 74 | Ga0070665_100221638 | 3300005548 | Bacteria | 1892 |
| 75 | Ga0068855_100001590 | 3300005563 | Bacteria | 28523 |
| 76 | Ga0068855_100013226 | 3300005563 | Bacteria | 9955 |
| 77 | Ga0068855_100014409 | 3300005563 | Bacteria | 9518 |
| 78 | Ga0068855_100076194 | 3300005563 | Bacteria | 3893 |
| 79 | Ga0070664_100220927 | 3300005564 | Bacteria | 1695 |
| 80 | Ga0068856_100006988 | 3300005614 | Bacteria | 11026 |
| 81 | Ga0068856_100190786 | 3300005614 | Bacteria | 2063 |
| 82 | Ga0070702_100038788 | 3300005615 | Bacteria | 2655 |
| 83 | Ga0068852_100081166 | 3300005616 | Bacteria | 2878 |
| 84 | Ga0068852_100289365 | 3300005616 | Bacteria | 1582 |
| 85 | Ga0068859_100003018 | 3300005617 | Bacteria | 17065 |
| 86 | Ga0068866_10096886 | 3300005718 | Bacteria | 1619 |
| 87 | Ga0068870_10225532 | 3300005840 | Bacteria | 1149 |
| 88 | Ga0068863_100004798 | 3300005841 | Bacteria | 13318 |
| 89 | Ga0068863_100045905 | 3300005841 | Bacteria | 4146 |
| 90 | Ga0068858_100002341 | 3300005842 | Bacteria | 19143 |
| 91 | Ga0068858_100040355 | 3300005842 | Bacteria | 4328 |
| 92 | Ga0068860_100038141 | 3300005843 | Bacteria | 4597 |
| 93 | Ga0070717_10727163 | 3300006028 | Bacteria | 902 |
| 94 | Ga0070715_10047205 | 3300006163 | Bacteria | 1834 |
| 95 | Ga0070716_100017471 | 3300006173 | Bacteria | 3720 |
| 96 | Ga0070716_100025956 | 3300006173 | Bacteria | 3133 |
| 97 | Ga0070712_100029151 | 3300006175 | Bacteria | 3698 |
| 98 | Ga0075428_100512579 | 3300006844 | Bacteria | 1283 |
| 99 | Ga0068865_100050034 | 3300006881 | Bacteria | 2885 |
| 100 | Ga0097620_100003018 | 3300006931 | Bacteria | 17065 |
| 101 | Ga0105251_10000714 | 3300009011 | Bacteria | 30597 |
| 102 | Ga0105251_10001186 | 3300009011 | Bacteria | 22567 |
| 103 | Ga0105251_10018195 | 3300009011 | Bacteria | 3742 |
| 104 | Ga0105251_10048349 | 3300009011 | Bacteria | 2039 |
| 105 | Ga0105240_10010335 | 3300009093 | Bacteria | 13132 |
| 106 | Ga0105240_10012433 | 3300009093 | Bacteria | 11750 |
| 107 | Ga0105240_10015865 | 3300009093 | Bacteria | 10221 |
| 108 | Ga0105240_10054386 | 3300009093 | Bacteria | 5016 |
| 109 | Ga0105240_10076405 | 3300009093 | Bacteria | 4129 |
| 110 | Ga0105240_10129030 | 3300009093 | Bacteria | 3035 |
| 111 | Ga0105240_10391096 | 3300009093 | Bacteria | 1568 |
| 112 | Ga0111539_10825507 | 3300009094 | Bacteria | 1079 |
| 113 | Ga0105245_10031275 | 3300009098 | Bacteria | 4709 |
| 114 | Ga0105245_10094629 | 3300009098 | Bacteria | 2754 |
| 115 | Ga0105247_10000137 | 3300009101 | Bacteria | 70918 |
| 116 | Ga0105241_10077514 | 3300009174 | Bacteria | 2595 |
| 117 | Ga0105241_10216080 | 3300009174 | Bacteria | 1609 |
| 118 | Ga0105242_10006774 | 3300009176 | Bacteria | 8835 |
| 119 | Ga0105248_10013042 | 3300009177 | Bacteria | 9162 |
| 120 | Ga0105248_10526183 | 3300009177 | Bacteria | 1333 |
| 121 | Ga0105237_10006678 | 3300009545 | Bacteria | 12752 |
| 122 | Ga0105237_10019403 | 3300009545 | Bacteria | 7021 |
| 123 | Ga0105237_10183206 | 3300009545 | Bacteria | 2094 |
| 124 | Ga0105238_10005358 | 3300009551 | Bacteria | 12676 |
| 125 | Ga0105238_10026930 | 3300009551 | Bacteria | 5860 |
| 126 | Ga0105238_10191105 | 3300009551 | Bacteria | 2023 |
| 127 | Ga0105238_10205122 | 3300009551 | Bacteria | 1947 |
| 128 | Ga0105238_10213466 | 3300009551 | Bacteria | 1906 |
| 129 | Ga0105249_10020381 | 3300009553 | Bacteria | 5929 |
| 130 | Ga0105249_10400139 | 3300009553 | Bacteria | 1403 |
| 131 | Ga0099796_10000063 | 3300010159 | Bacteria | 19147 |
| 132 | Ga0105239_10011331 | 3300010375 | Bacteria | 9952 |
| 133 | Ga0105239_10014066 | 3300010375 | Bacteria | 8884 |
| 134 | Ga0105239_10531663 | 3300010375 | Bacteria | 1338 |
| 135 | Ga0157371_10008061 | 3300013102 | Bacteria | 8424 |
| 136 | Ga0157370_10000919 | 3300013104 | Bacteria | 37363 |
| 137 | Ga0157370_10011490 | 3300013104 | Bacteria | 9253 |
| 138 | Ga0157369_10000084 | 3300013105 | Bacteria | 130587 |
| 139 | Ga0157369_10000093 | 3300013105 | Bacteria | 122566 |
| 140 | Ga0157369_10003434 | 3300013105 | Bacteria | 18793 |
| 141 | Ga0157369_10005727 | 3300013105 | Bacteria | 14436 |
| 142 | Ga0157369_10006041 | 3300013105 | Bacteria | 14057 |
| 143 | Ga0157369_10014340 | 3300013105 | Bacteria | 8949 |
| 144 | Ga0157369_10318274 | 3300013105 | Bacteria | 1617 |
| 145 | Ga0157374_10000034 | 3300013296 | Bacteria | 180660 |
| 146 | Ga0157374_10032044 | 3300013296 | Bacteria | 4783 |
| 147 | Ga0157374_10705339 | 3300013296 | Bacteria | 1022 |
| 148 | Ga0157378_10016544 | 3300013297 | Bacteria | 6460 |
| 149 | Ga0157378_10282324 | 3300013297 | Bacteria | 1601 |
| 150 | Ga0157378_10388832 | 3300013297 | Bacteria | 1372 |
| 151 | Ga0163162_10001260 | 3300013306 | Bacteria | 23667 |
| 152 | Ga0163162_10005558 | 3300013306 | Bacteria | 12193 |
| 153 | Ga0163162_10040088 | 3300013306 | Bacteria | 4682 |
| 154 | Ga0163162_10120683 | 3300013306 | Bacteria | 2725 |
| 155 | Ga0157372_10039719 | 3300013307 | Bacteria | 5195 |
| 156 | Ga0157375_10032502 | 3300013308 | Bacteria | 4950 |
| 157 | Ga0157375_10116071 | 3300013308 | Bacteria | 2781 |
| 158 | Ga0157375_10182706 | 3300013308 | Bacteria | 2249 |
| 159 | Ga0163163_10206787 | 3300014325 | Bacteria | 2011 |
| 160 | Ga0163163_10235976 | 3300014325 | Bacteria | 1878 |
| 161 | Ga0157379_10006556 | 3300014968 | Bacteria | 10043 |
| 162 | Ga0157376_10114666 | 3300014969 | Bacteria | 2378 |
| 163 | Ga0182007_10000198 | 3300015262 | Bacteria | 40280 |
| 164 | Ga0183361_10003 | 3300016635 | Bacteria | 577277 |
| 165 | Ga0206354_11101660 | 3300020081 | Bacteria | 4460 |
| 166 | Ga0206354_11661290 | 3300020081 | Bacteria | 1724 |
| 167 | Ga0224712_10000105 | 3300022467 | Bacteria | 13146 |
| 168 | Ga0209566_100307 | 3300025225 | Bacteria | 44141 |
| 169 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 170 | Ga0209674_100144 | 3300025226 | Bacteria | 107160 |
| 171 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 172 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 173 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 174 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 175 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 176 | Ga0209147_100503 | 3300025229 | Bacteria | 22767 |
| 177 | Ga0209147_100611 | 3300025229 | Bacteria | 19499 |
| 178 | Ga0209563_103475 | 3300025230 | Bacteria | 3242 |
| 179 | Ga0207427_101251 | 3300025231 | Bacteria | 9738 |
| 180 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 181 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 182 | Ga0209258_100774 | 3300025242 | Bacteria | 19468 |
| 183 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 184 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 185 | Ga0209148_1001109 | 3300025254 | Bacteria | 16139 |
| 186 | Ga0209759_1000008 | 3300025256 | Bacteria | 461395 |
| 187 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 188 | Ga0209759_1000094 | 3300025256 | Bacteria | 159426 |
| 189 | Ga0209759_1006541 | 3300025256 | Bacteria | 3897 |
| 190 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 191 | Ga0209565_1000529 | 3300025263 | Bacteria | 27049 |
| 192 | Ga0209565_1004340 | 3300025263 | Bacteria | 4344 |
| 193 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 194 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 195 | Ga0209455_1005672 | 3300025272 | Bacteria | 3813 |
| 196 | Ga0209673_1000028 | 3300025273 | Bacteria | 358901 |
| 197 | Ga0209673_1014734 | 3300025273 | Bacteria | 3013 |
| 198 | Ga0209130_1006892 | 3300025284 | Bacteria | 3606 |
| 199 | Ga0209675_1000040 | 3300025291 | Bacteria | 247535 |
| 200 | Ga0209675_1000906 | 3300025291 | Bacteria | 18947 |
| 201 | Ga0209675_1009780 | 3300025291 | Bacteria | 3351 |
| 202 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 203 | Ga0209025_1000092 | 3300025294 | Bacteria | 247020 |
| 204 | Ga0209025_1002860 | 3300025294 | Bacteria | 17318 |
| 205 | Ga0209025_1010269 | 3300025294 | Bacteria | 6368 |
| 206 | Ga0209564_1000159 | 3300025295 | Bacteria | 164319 |
| 207 | Ga0209564_1000615 | 3300025295 | Bacteria | 54694 |
| 208 | Ga0209564_1001298 | 3300025295 | Bacteria | 27038 |
| 209 | Ga0209564_1033396 | 3300025295 | Bacteria | 1531 |
| 210 | Ga0209758_1023254 | 3300025297 | Bacteria | 2810 |
| 211 | Ga0209256_1000386 | 3300025299 | Bacteria | 70160 |
| 212 | Ga0209256_1003779 | 3300025299 | Bacteria | 10198 |
| 213 | Ga0207426_1000180 | 3300025302 | Bacteria | 158321 |
| 214 | Ga0207426_1001366 | 3300025302 | Bacteria | 20681 |
| 215 | Ga0209051_1008382 | 3300025303 | Bacteria | 5478 |
| 216 | Ga0207713_1000590 | 3300025735 | Bacteria | 35946 |
| 217 | Ga0207713_1002233 | 3300025735 | Bacteria | 14351 |
| 218 | Ga0207692_10279225 | 3300025898 | Bacteria | 1010 |
| 219 | Ga0207642_10026019 | 3300025899 | Bacteria | 2376 |
| 220 | Ga0207710_10001357 | 3300025900 | Bacteria | 12296 |
| 221 | Ga0207680_10040799 | 3300025903 | Bacteria | 2704 |
| 222 | Ga0207680_10063030 | 3300025903 | Bacteria | 2267 |
| 223 | Ga0207680_10108472 | 3300025903 | Bacteria | 1796 |
| 224 | Ga0207647_10000977 | 3300025904 | Bacteria | 22156 |
| 225 | Ga0207647_10003311 | 3300025904 | Bacteria | 12101 |
| 226 | Ga0207647_10020333 | 3300025904 | Bacteria | 4452 |
| 227 | Ga0207647_10044284 | 3300025904 | Bacteria | 2782 |
| 228 | Ga0207699_10214020 | 3300025906 | Bacteria | 1312 |
| 229 | Ga0207705_10001880 | 3300025909 | Bacteria | 16475 |
| 230 | Ga0207705_10044905 | 3300025909 | Bacteria | 3175 |
| 231 | Ga0207707_10000107 | 3300025912 | Bacteria | 82899 |
| 232 | Ga0207707_10001891 | 3300025912 | Bacteria | 19082 |
| 233 | Ga0207707_10071391 | 3300025912 | Bacteria | 3026 |
| 234 | Ga0207695_10004996 | 3300025913 | Bacteria | 17830 |
| 235 | Ga0207695_10031137 | 3300025913 | Bacteria | 5857 |
| 236 | Ga0207695_10071675 | 3300025913 | Bacteria | 3538 |
| 237 | Ga0207695_10118654 | 3300025913 | Bacteria | 2616 |
| 238 | Ga0207695_10434851 | 3300025913 | Bacteria | 1196 |
| 239 | Ga0207671_10023359 | 3300025914 | Bacteria | 4663 |
| 240 | Ga0207671_10052985 | 3300025914 | Bacteria | 3007 |
| 241 | Ga0207671_10104774 | 3300025914 | Bacteria | 2145 |
| 242 | Ga0207693_10001490 | 3300025915 | Bacteria | 20648 |
| 243 | Ga0207660_10170240 | 3300025917 | Bacteria | 1685 |
| 244 | Ga0207657_10000012 | 3300025919 | Bacteria | 185417 |
| 245 | Ga0207657_10157219 | 3300025919 | Bacteria | 1848 |
| 246 | Ga0207657_10163893 | 3300025919 | Bacteria | 1804 |
| 247 | Ga0207652_10000738 | 3300025921 | Bacteria | 31584 |
| 248 | Ga0207652_10133950 | 3300025921 | Bacteria | 2211 |
| 249 | Ga0207652_10181944 | 3300025921 | Bacteria | 1889 |
| 250 | Ga0207681_10441913 | 3300025923 | Bacteria | 1057 |
| 251 | Ga0207694_10003158 | 3300025924 | Bacteria | 13161 |
| 252 | Ga0207694_10090313 | 3300025924 | Bacteria | 2417 |
| 253 | Ga0207694_10319943 | 3300025924 | Bacteria | 1280 |
| 254 | Ga0207687_10301751 | 3300025927 | Bacteria | 1290 |
| 255 | Ga0207644_10000708 | 3300025931 | Bacteria | 21213 |
| 256 | Ga0207690_10000008 | 3300025932 | Bacteria | 366090 |
| 257 | Ga0207669_10027269 | 3300025937 | Bacteria | 3124 |
| 258 | Ga0207704_10068620 | 3300025938 | Bacteria | 2236 |
| 259 | Ga0207704_10113048 | 3300025938 | Bacteria | 1840 |
| 260 | Ga0207665_10003828 | 3300025939 | Bacteria | 10055 |
| 261 | Ga0207665_10007330 | 3300025939 | Bacteria | 7298 |
| 262 | Ga0207711_10032076 | 3300025941 | Bacteria | 4440 |
| 263 | Ga0207711_10374484 | 3300025941 | Bacteria | 1321 |
| 264 | Ga0207689_10129682 | 3300025942 | Bacteria | 2075 |
| 265 | Ga0207667_10009108 | 3300025949 | Bacteria | 11734 |
| 266 | Ga0207667_10009509 | 3300025949 | Bacteria | 11439 |
| 267 | Ga0207667_10021321 | 3300025949 | Bacteria | 7180 |
| 268 | Ga0207667_10334758 | 3300025949 | Bacteria | 1545 |
| 269 | Ga0207712_10086664 | 3300025961 | Bacteria | 2294 |
| 270 | Ga0207668_10093997 | 3300025972 | Bacteria | 2210 |
| 271 | Ga0207658_10011861 | 3300025986 | Bacteria | 5940 |
| 272 | Ga0207703_10000957 | 3300026035 | Bacteria | 27938 |
| 273 | Ga0207678_10001382 | 3300026067 | Bacteria | 22326 |
| 274 | Ga0207678_10035851 | 3300026067 | Bacteria | 4319 |
| 275 | Ga0207678_10315792 | 3300026067 | Bacteria | 1344 |
| 276 | Ga0207702_10163458 | 3300026078 | Bacteria | 2035 |
| 277 | Ga0207641_10006476 | 3300026088 | Bacteria | 9861 |
| 278 | Ga0207641_10160927 | 3300026088 | Bacteria | 2041 |
| 279 | Ga0207648_10066597 | 3300026089 | Bacteria | 3141 |
| 280 | Ga0207683_10016674 | 3300026121 | Bacteria | 6252 |
| 281 | Ga0207698_10007664 | 3300026142 | Bacteria | 6770 |
| 282 | Ga0209371_1000670 | 3300027312 | Bacteria | 29828 |
| 283 | Ga0209371_1011628 | 3300027312 | Bacteria | 2600 |
| 284 | Ga0209282_1000156 | 3300027666 | Bacteria | 39547 |
| 285 | Ga0268266_10003195 | 3300028379 | Bacteria | 16585 |
| 286 | Ga0268264_10058724 | 3300028381 | Bacteria | 3222 |
| 287 | Ga0268256_1000567 | 3300030500 | Bacteria | 29776 |
| 288 | Ga0268256_1010581 | 3300030500 | Bacteria | 2979 |
| 289 | Ga0307511_10000037 | 3300030521 | Bacteria | 103008 |
| 290 | Ga0265770_1000507 | 3300030878 | Bacteria | 5415 |
| 291 | Ga0265760_10000102 | 3300031090 | Bacteria | 21821 |
| 292 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 293 | Ga0307408_100024560 | 3300031548 | Bacteria | 4117 |
| 294 | Ga0265313_10068209 | 3300031595 | Bacteria | 1644 |
| 295 | Ga0307516_10004172 | 3300031730 | Bacteria | 18010 |
| 296 | Ga0307412_10000039 | 3300031911 | Bacteria | 182976 |
| 297 | Ga0373936_0003390 | 3300035113 | Bacteria | 5973 |
| 298 | Ga0373945_0039004 | 3300035116 | Bacteria | 1711 |
| 299 | Ga0373935_0160961 | 3300035692 | Bacteria | 1530 |
| 300 | Ga0373927_0017430 | 3300035695 | Bacteria | 4726 |
| 301 | Ga0373933_0266681 | 3300035724 | Bacteria | 1105 |
| 302 | Ga0373933_0271631 | 3300035724 | Bacteria | 1094 |
| 303 | Ga0373937_0132157 | 3300036401 | Bacteria | 2331 |
| 304 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 305 | Ga0395899_0016219 | 3300037312 | Bacteria | 5678 |
| 306 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 307 | Ga0395900_0000182 | 3300037418 | Bacteria | 100777 |
| 308 | Ga0395900_0216086 | 3300037418 | Bacteria | 1934 |
| 309 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 310 | Ga0395898_0001753 | 3300037466 | Bacteria | 28483 |
| 311 | Ga0395898_0006217 | 3300037466 | Bacteria | 12791 |
| 312 | Ga0395898_0012589 | 3300037466 | Bacteria | 8745 |
| 313 | Ga0395898_0050606 | 3300037466 | Bacteria | 4065 |
| 314 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 315 | Ga0395901_0000004 | 3300038443 | Bacteria | 657361 |
| 316 | Ga0395901_0000040 | 3300038443 | Bacteria | 204677 |
| 317 | Ga0395901_0000326 | 3300038443 | Bacteria | 58686 |
| 318 | Ga0395901_0029069 | 3300038443 | Bacteria | 5686 |
| 319 | Ga0395901_0692096 | 3300038443 | Bacteria | 1018 |
| 320 | Ga0436365_1156792 | 3300039437 | Bacteria | 2404 |
| 321 | Ga0439448_0000018 | 3300042005 | Bacteria | 28604 |
| 322 | Ga0466969_0001035 | 3300044656 | Bacteria | 15006 |
| 323 | Ga0466973_0031288 | 3300044659 | Bacteria | 5083 |
| 324 | Ga0466965_0001868 | 3300044683 | Bacteria | 8767 |
| 325 | Ga0466966_0001688 | 3300044684 | Bacteria | 14253 |
| 326 | Ga0466966_0017560 | 3300044684 | Bacteria | 4728 |
| 327 | Ga0466966_0063219 | 3300044684 | Bacteria | 2332 |
| 328 | Ga0466966_0381918 | 3300044684 | Bacteria | 846 |
| 329 | Ga0466961_0000909 | 3300044693 | Bacteria | 18382 |
| 330 | Ga0466961_0254238 | 3300044693 | Bacteria | 1079 |
| 331 | Ga0466963_0002294 | 3300044694 | Bacteria | 10637 |
| 332 | Ga0466963_0010154 | 3300044694 | Bacteria | 5693 |
| 333 | Ga0466964_0007403 | 3300044706 | Bacteria | 4106 |
| 334 | Ga0466971_0036075 | 3300044719 | Bacteria | 2217 |
| 335 | Ga0466968_0041955 | 3300044735 | Bacteria | 1933 |
| 336 | Ga0466970_0007817 | 3300044765 | Bacteria | 5367 |
| 337 | Ga0466970_0023727 | 3300044765 | Bacteria | 3206 |
| 338 | Ga0466957_0001477 | 3300044842 | Bacteria | 12332 |
| 339 | Ga0466957_0006925 | 3300044842 | Bacteria | 6409 |
| 340 | Ga0466957_0041079 | 3300044842 | Bacteria | 2796 |
| 341 | Ga0466959_0056251 | 3300045049 | Bacteria | 2871 |
| 342 | Ga0466958_0003557 | 3300045836 | Bacteria | 8107 |
| 343 | Ga0466958_0003923 | 3300045836 | Bacteria | 7797 |
| 344 | Ga0466958_0005081 | 3300045836 | Bacteria | 7031 |
| 345 | Ga0466967_0622360 | 3300045976 | Bacteria | 1066 |
| 346 | Ga0495592_0028665 | 3300046454 | Bacteria | 4214 |
| 347 | Ga0495592_0076936 | 3300046454 | Bacteria | 2420 |
| 348 | Ga0495603_0002366 | 3300046455 | Bacteria | 11073 |
| 349 | Ga0495603_0031577 | 3300046455 | Bacteria | 3188 |
| 350 | Ga0495590_0002819 | 3300046457 | Bacteria | 7172 |
| 351 | Ga0495591_004355 | 3300046458 | Bacteria | 6970 |
| 352 | Ga0495629_0000247 | 3300046459 | Bacteria | 47185 |
| 353 | Ga0495629_0000704 | 3300046459 | Bacteria | 27097 |
| 354 | Ga0495629_0002464 | 3300046459 | Bacteria | 14199 |
| 355 | Ga0495629_0009512 | 3300046459 | Bacteria | 7102 |
| 356 | Ga0495629_0011681 | 3300046459 | Bacteria | 6372 |
| 357 | Ga0495638_0000976 | 3300046460 | Bacteria | 28790 |
| 358 | Ga0495638_0022862 | 3300046460 | Bacteria | 4099 |
| 359 | Ga0495641_0019953 | 3300046461 | Bacteria | 3415 |
| 360 | Ga0495651_0013144 | 3300046462 | Bacteria | 6400 |
| 361 | Ga0495651_0080039 | 3300046462 | Bacteria | 2468 |
| 362 | Ga0495651_0200182 | 3300046462 | Bacteria | 1398 |
| 363 | Ga0495653_0001472 | 3300046463 | Bacteria | 18364 |
| 364 | Ga0495653_0002197 | 3300046463 | Bacteria | 15431 |
| 365 | Ga0495653_0105974 | 3300046463 | Bacteria | 2028 |
| 366 | Ga0495650_0000554 | 3300046471 | Bacteria | 53235 |
| 367 | Ga0495650_0002743 | 3300046471 | Bacteria | 13598 |
| 368 | Ga0495650_0003550 | 3300046471 | Bacteria | 11291 |
| 369 | Ga0495650_0006564 | 3300046471 | Bacteria | 7231 |
| 370 | Ga0495650_0114046 | 3300046471 | Bacteria | 1000 |
| 371 | Ga0495580_0000008 | 3300046472 | Bacteria | 102421 |
| 372 | Ga0495580_0000532 | 3300046472 | Bacteria | 32248 |
| 373 | Ga0495580_0001335 | 3300046472 | Bacteria | 21761 |
| 374 | Ga0495580_0002997 | 3300046472 | Bacteria | 14480 |
| 375 | Ga0495580_0006979 | 3300046472 | Bacteria | 9105 |
| 376 | Ga0495580_0015765 | 3300046472 | Bacteria | 5692 |
| 377 | Ga0495580_0027655 | 3300046472 | Bacteria | 4126 |
| 378 | Ga0495580_0142296 | 3300046472 | Bacteria | 1662 |
| 379 | Ga0495580_0323732 | 3300046472 | Bacteria | 1047 |
| 380 | Ga0495582_0000202 | 3300046473 | Bacteria | 33047 |
| 381 | Ga0495582_0229493 | 3300046473 | Bacteria | 1063 |
| 382 | Ga0495605_0001989 | 3300046474 | Bacteria | 12952 |
| 383 | Ga0495605_0006271 | 3300046474 | Bacteria | 6852 |
| 384 | Ga0495662_0016718 | 3300046476 | Bacteria | 3554 |
| 385 | Ga0495664_0000389 | 3300046477 | Bacteria | 21485 |
| 386 | Ga0495664_0007907 | 3300046477 | Bacteria | 5918 |
| 387 | Ga0495664_0021180 | 3300046477 | Bacteria | 3755 |
| 388 | Ga0495664_0080606 | 3300046477 | Bacteria | 1951 |
| 389 | Ga0495584_0133439 | 3300046491 | Bacteria | 1260 |
| 390 | Ga0495596_0000157 | 3300046500 | Bacteria | 47448 |
| 391 | Ga0495596_0017129 | 3300046500 | Bacteria | 3004 |
| 392 | Ga0495596_0110299 | 3300046500 | Bacteria | 1068 |
| 393 | Ga0495596_0112912 | 3300046500 | Bacteria | 1055 |
| 394 | Ga0495583_0006948 | 3300046506 | Bacteria | 7259 |
| 395 | Ga0495583_0020605 | 3300046506 | Bacteria | 3409 |
| 396 | Ga0495583_0054868 | 3300046506 | Bacteria | 1803 |
| 397 | Ga0495606_0009209 | 3300046507 | Bacteria | 8392 |
| 398 | Ga0495606_0068135 | 3300046507 | Bacteria | 2252 |
| 399 | Ga0495608_0007370 | 3300046511 | Bacteria | 7773 |
| 400 | Ga0495610_0000623 | 3300046512 | Bacteria | 35034 |
| 401 | Ga0495610_0001301 | 3300046512 | Bacteria | 22255 |
| 402 | Ga0495616_0006731 | 3300046513 | Bacteria | 6930 |
| 403 | Ga0495616_0025441 | 3300046513 | Bacteria | 3163 |
| 404 | Ga0495618_0002329 | 3300046514 | Bacteria | 12275 |
| 405 | Ga0495618_0002763 | 3300046514 | Bacteria | 11160 |
| 406 | Ga0495620_0007184 | 3300046515 | Bacteria | 6068 |
| 407 | Ga0495628_0002415 | 3300046516 | Bacteria | 16855 |
| 408 | Ga0495628_0014740 | 3300046516 | Bacteria | 6543 |
| 409 | Ga0495628_0064189 | 3300046516 | Bacteria | 2875 |
| 410 | Ga0495628_0159434 | 3300046516 | Bacteria | 1715 |
| 411 | Ga0495628_0247585 | 3300046516 | Bacteria | 1331 |
| 412 | Ga0495628_0258021 | 3300046516 | Bacteria | 1299 |
| 413 | Ga0495630_0001539 | 3300046517 | Bacteria | 16004 |
| 414 | Ga0495630_0010361 | 3300046517 | Bacteria | 6726 |
| 415 | Ga0495630_0027150 | 3300046517 | Bacteria | 4244 |
| 416 | Ga0495630_0031126 | 3300046517 | Bacteria | 3971 |
| 417 | Ga0495630_0075101 | 3300046517 | Bacteria | 2547 |
| 418 | Ga0495631_0050321 | 3300046518 | Bacteria | 1823 |
| 419 | Ga0495632_0039935 | 3300046519 | Bacteria | 2366 |
| 420 | Ga0495643_0028247 | 3300046522 | Bacteria | 3147 |
| 421 | Ga0495648_0017371 | 3300046524 | Bacteria | 5144 |
| 422 | Ga0495648_0018461 | 3300046524 | Bacteria | 4936 |
| 423 | Ga0495648_0040367 | 3300046524 | Bacteria | 2959 |
| 424 | Ga0495648_0138951 | 3300046524 | Bacteria | 1281 |
| 425 | Ga0495666_0000247 | 3300046526 | Bacteria | 23327 |
| 426 | Ga0495666_0002384 | 3300046526 | Bacteria | 9357 |
| 427 | Ga0495666_0012618 | 3300046526 | Bacteria | 4211 |
| 428 | Ga0495666_0013125 | 3300046526 | Bacteria | 4127 |
| 429 | Ga0495666_0029908 | 3300046526 | Bacteria | 2677 |
| 430 | Ga0495652_0016081 | 3300046529 | Bacteria | 6693 |
| 431 | Ga0495652_0034838 | 3300046529 | Bacteria | 4385 |
| 432 | Ga0495652_0043525 | 3300046529 | Bacteria | 3866 |
| 433 | Ga0495652_0052543 | 3300046529 | Bacteria | 3475 |
| 434 | Ga0495652_0174517 | 3300046529 | Bacteria | 1656 |
| 435 | Ga0495654_0180202 | 3300046530 | Bacteria | 915 |
| 436 | Ga0495665_0005589 | 3300046531 | Bacteria | 6776 |
| 437 | Ga0495665_0014770 | 3300046531 | Bacteria | 4208 |
| 438 | Ga0495665_0049906 | 3300046531 | Bacteria | 2218 |
| 439 | Ga0495665_0086675 | 3300046531 | Bacteria | 1645 |
| 440 | Ga0495665_0199007 | 3300046531 | Bacteria | 1039 |
| 441 | Ga0495640_0009866 | 3300046533 | Bacteria | 7408 |
| 442 | Ga0495640_0012834 | 3300046533 | Bacteria | 6391 |
| 443 | Ga0495586_0019721 | 3300046535 | Bacteria | 3590 |
| 444 | Ga0495587_0004211 | 3300046536 | Bacteria | 9519 |
| 445 | Ga0495587_0019491 | 3300046536 | Bacteria | 4196 |
| 446 | Ga0495609_0002254 | 3300046538 | Bacteria | 12030 |
| 447 | Ga0495609_0009119 | 3300046538 | Bacteria | 4815 |
| 448 | Ga0495597_0004638 | 3300046542 | Bacteria | 7486 |
| 449 | Ga0495645_0000886 | 3300046543 | Bacteria | 20409 |
| 450 | Ga0495645_0003992 | 3300046543 | Bacteria | 10069 |
| 451 | Ga0495645_0043274 | 3300046543 | Bacteria | 3284 |
| 452 | Ga0495645_0345046 | 3300046543 | Bacteria | 961 |
| 453 | Ga0495622_0000140 | 3300046557 | Bacteria | 62347 |
| 454 | Ga0495622_0010112 | 3300046557 | Bacteria | 4365 |
| 455 | Ga0495667_0175210 | 3300046559 | Bacteria | 1378 |
| 456 | Ga0495634_0018717 | 3300046642 | Bacteria | 4926 |
| 457 | Ga0495634_0076630 | 3300046642 | Bacteria | 2194 |
| 458 | Ga0495611_0031044 | 3300046648 | Bacteria | 2350 |
| 459 | Ga0495635_0002465 | 3300046663 | Bacteria | 12635 |
| 460 | Ga0495635_0041278 | 3300046663 | Bacteria | 3187 |
| 461 | Ga0495635_0062940 | 3300046663 | Bacteria | 2547 |
| 462 | Ga0495661_0003608 | 3300046665 | Bacteria | 11396 |
| 463 | Ga0495661_0007417 | 3300046665 | Bacteria | 7646 |
| 464 | Ga0495661_0011321 | 3300046665 | Bacteria | 6053 |
| 465 | Ga0495661_0026177 | 3300046665 | Bacteria | 3759 |
| 466 | Ga0495657_0015928 | 3300046675 | Bacteria | 5487 |
| 467 | Ga0495599_0016332 | 3300046678 | Bacteria | 4609 |
| 468 | Ga0495599_0039347 | 3300046678 | Bacteria | 2971 |
| 469 | Ga0495623_0009831 | 3300046679 | Bacteria | 6197 |
| 470 | Ga0495646_0003240 | 3300046680 | Bacteria | 10117 |
| 471 | Ga0495646_0006405 | 3300046680 | Bacteria | 7466 |
| 472 | Ga0495646_0014935 | 3300046680 | Bacteria | 4932 |
| 473 | Ga0495646_0035805 | 3300046680 | Bacteria | 3077 |
| 474 | Ga0495646_0089898 | 3300046680 | Bacteria | 1775 |
| 475 | Ga0495658_0226025 | 3300046683 | Bacteria | 1173 |
| 476 | Ga0495669_0000883 | 3300046684 | Bacteria | 12633 |
| 477 | Ga0495613_0045430 | 3300046689 | Bacteria | 3248 |
| 478 | Ga0495613_0048748 | 3300046689 | Bacteria | 3127 |
| 479 | Ga0495624_0000346 | 3300046690 | Bacteria | 36774 |
| 480 | Ga0495624_0018707 | 3300046690 | Bacteria | 4631 |
| 481 | Ga0495624_0025826 | 3300046690 | Bacteria | 3854 |
| 482 | Ga0495624_0059864 | 3300046690 | Bacteria | 2388 |
| 483 | Ga0495624_0101474 | 3300046690 | Bacteria | 1771 |
| 484 | Ga0495624_0101484 | 3300046690 | Bacteria | 1771 |
| 485 | Ga0495670_0092625 | 3300046691 | Bacteria | 1548 |
| 486 | Ga0495671_0000232 | 3300046692 | Bacteria | 47998 |
| 487 | Ga0495671_0025069 | 3300046692 | Bacteria | 3102 |
| 488 | Ga0495649_0006145 | 3300046694 | Bacteria | 7504 |
| 489 | Ga0495649_0080542 | 3300046694 | Bacteria | 1741 |
| 490 | Ga0495589_0002642 | 3300046794 | Bacteria | 9924 |
| 491 | Ga0495589_0026443 | 3300046794 | Bacteria | 2939 |
| 492 | Ga0495589_0047006 | 3300046794 | Bacteria | 2140 |
| 493 | Ga0495589_0063341 | 3300046794 | Bacteria | 1814 |
| 494 | Ga0495589_0116085 | 3300046794 | Bacteria | 1290 |
| 495 | Ga0495600_0004960 | 3300046809 | Bacteria | 7992 |
| 496 | Ga0495600_0006113 | 3300046809 | Bacteria | 7292 |
| 497 | Ga0495660_0076592 | 3300046810 | Bacteria | 1762 |
| 498 | Ga0495581_0000497 | 3300047315 | Bacteria | 20079 |
| 499 | Ga0495581_0003043 | 3300047315 | Bacteria | 9603 |
| 500 | Ga0495581_0012929 | 3300047315 | Bacteria | 4838 |
| 501 | Ga0495581_0017288 | 3300047315 | Bacteria | 4190 |
| 502 | Ga0495604_0006557 | 3300047317 | Bacteria | 9227 |
| 503 | Ga0495604_0012959 | 3300047317 | Bacteria | 6644 |
| 504 | Ga0495604_0030671 | 3300047317 | Bacteria | 4269 |
| 505 | Ga0495604_0074166 | 3300047317 | Bacteria | 2565 |
| 506 | Ga0495604_0119590 | 3300047317 | Bacteria | 1908 |
| 507 | Ga0495674_0007070 | 3300047319 | Bacteria | 10735 |
| 508 | Ga0495674_0020471 | 3300047319 | Bacteria | 6123 |
| 509 | Ga0495674_0027093 | 3300047319 | Bacteria | 5241 |
| 510 | Ga0495674_0038867 | 3300047319 | Bacteria | 4268 |
| 511 | Ga0495674_0040987 | 3300047319 | Bacteria | 4138 |
| 512 | Ga0495674_0111666 | 3300047319 | Bacteria | 2316 |
| 513 | Ga0495674_0158665 | 3300047319 | Bacteria | 1893 |
| 514 | Ga0495674_0422532 | 3300047319 | Bacteria | 1074 |
| 515 | Ga0495672_0009363 | 3300047320 | Bacteria | 7105 |
| 516 | Ga0495672_0027948 | 3300047320 | Bacteria | 3577 |
| 517 | Ga0495672_0042048 | 3300047320 | Bacteria | 2758 |
| 518 | Ga0495672_0095199 | 3300047320 | Bacteria | 1626 |
| 519 | Ga0495672_0122473 | 3300047320 | Bacteria | 1380 |
| 520 | Ga0495676_0003897 | 3300047321 | Bacteria | 13565 |
| 521 | Ga0495676_0031199 | 3300047321 | Bacteria | 4510 |
| 522 | Ga0495676_0187349 | 3300047321 | Bacteria | 1445 |
| 523 | Ga0495676_0321912 | 3300047321 | Bacteria | 1038 |
| 524 | Ga0495680_0006673 | 3300047322 | Bacteria | 10688 |
| 525 | Ga0495680_0069392 | 3300047322 | Bacteria | 2689 |
| 526 | Ga0495680_0116517 | 3300047322 | Bacteria | 1975 |
| 527 | Ga0495680_0138733 | 3300047322 | Bacteria | 1780 |
| 528 | Ga0495683_0006194 | 3300047323 | Bacteria | 6550 |
| 529 | Ga0495683_0011576 | 3300047323 | Bacteria | 4640 |
| 530 | Ga0495683_0015976 | 3300047323 | Bacteria | 3899 |
| 531 | Ga0495687_009463 | 3300047443 | Bacteria | 5442 |
| 532 | Ga0495687_034369 | 3300047443 | Bacteria | 2291 |
| 533 | Ga0495687_042397 | 3300047443 | Bacteria | 1988 |
| 534 | Ga0495687_047113 | 3300047443 | Bacteria | 1857 |
| 535 | Ga0495675_0001013 | 3300047444 | Bacteria | 17088 |
| 536 | Ga0495675_0008541 | 3300047444 | Bacteria | 6346 |
| 537 | Ga0495675_0013701 | 3300047444 | Bacteria | 5124 |
| 538 | Ga0495675_0172333 | 3300047444 | Bacteria | 1328 |
| 539 | Ga0495675_0256624 | 3300047444 | Bacteria | 1048 |
| 540 | Ga0495679_000117 | 3300047446 | Bacteria | 69653 |
| 541 | Ga0495679_001343 | 3300047446 | Bacteria | 14201 |
| 542 | Ga0495679_001539 | 3300047446 | Bacteria | 13012 |
| 543 | Ga0495679_039979 | 3300047446 | Bacteria | 1460 |
| 544 | Ga0495679_075105 | 3300047446 | Bacteria | 967 |
| 545 | Ga0495685_005621 | 3300047447 | Bacteria | 4097 |
| 546 | Ga0495673_0006705 | 3300047469 | Bacteria | 6736 |
| 547 | Ga0495673_0039560 | 3300047469 | Bacteria | 2138 |
| 548 | Ga0495673_0051139 | 3300047469 | Bacteria | 1811 |
| 549 | Ga0495684_0017358 | 3300047471 | Bacteria | 5539 |
| 550 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 551 | Ga0495686_0041119 | 3300047472 | Bacteria | 2945 |
| 552 | Ga0495686_0054564 | 3300047472 | Bacteria | 2502 |
| 553 | Ga0495686_0128544 | 3300047472 | Bacteria | 1504 |
| 554 | Ga0495593_0026354 | 3300047673 | Bacteria | 3211 |
| 555 | Ga0495593_0031686 | 3300047673 | Bacteria | 2886 |
| 556 | Ga0495593_0041848 | 3300047673 | Bacteria | 2461 |
| 557 | Ga0495593_0052233 | 3300047673 | Bacteria | 2160 |
| 558 | Ga0495593_0094536 | 3300047673 | Bacteria | 1537 |
| 559 | Ga0495593_0101989 | 3300047673 | Bacteria | 1471 |
| 560 | Ga0495602_0002585 | 3300048088 | Bacteria | 18476 |
| 561 | Ga0495602_0006600 | 3300048088 | Bacteria | 12159 |
| 562 | Ga0495602_0047606 | 3300048088 | Bacteria | 3862 |
| 563 | Ga0495602_0132686 | 3300048088 | Bacteria | 1983 |
| 564 | Ga0495614_0010644 | 3300048089 | Bacteria | 4053 |
| 565 | Ga0495614_0017353 | 3300048089 | Bacteria | 3127 |
| 566 | Ga0495626_0018295 | 3300048091 | Bacteria | 3522 |
| 567 | Ga0496100_0000313 | 3300048903 | Bacteria | 24033 |
| 568 | Ga0496101_0001365 | 3300048904 | Bacteria | 14626 |
| 569 | Ga0496101_0008320 | 3300048904 | Bacteria | 6778 |
| 570 | Ga0496101_0013371 | 3300048904 | Bacteria | 5496 |
| 571 | Ga0496101_0120959 | 3300048904 | Bacteria | 1979 |
| 572 | Ga0496101_0132837 | 3300048904 | Bacteria | 1891 |
| 573 | Ga0496102_0002592 | 3300048905 | Bacteria | 15424 |
| 574 | Ga0496102_0031892 | 3300048905 | Bacteria | 4731 |
| 575 | Ga0496102_0075175 | 3300048905 | Bacteria | 3105 |
| 576 | Ga0496102_0113528 | 3300048905 | Bacteria | 2527 |
| 577 | Ga0496103_0000841 | 3300048906 | Bacteria | 22449 |
| 578 | Ga0496103_0003774 | 3300048906 | Bacteria | 9212 |
| 579 | Ga0496103_0097569 | 3300048906 | Bacteria | 1858 |
| 580 | Ga0496103_0113437 | 3300048906 | Bacteria | 1722 |
| 581 | Ga0496103_0123442 | 3300048906 | Bacteria | 1650 |
| 582 | Ga0496104_0199984 | 3300048907 | Bacteria | 1910 |
| 583 | Ga0496105_0016770 | 3300048908 | Bacteria | 5855 |
| 584 | Ga0496105_0023742 | 3300048908 | Bacteria | 4977 |
| 585 | Ga0496105_0242575 | 3300048908 | Bacteria | 1462 |
| 586 | Ga0496106_0000025 | 3300048909 | Bacteria | 154905 |
| 587 | Ga0496106_0026259 | 3300048909 | Bacteria | 4335 |
| 588 | Ga0496106_0038078 | 3300048909 | Bacteria | 3598 |
| 589 | Ga0496106_0081767 | 3300048909 | Bacteria | 2482 |
| 590 | Ga0496106_0214582 | 3300048909 | Bacteria | 1534 |
| 591 | Ga0496107_0022553 | 3300048910 | Bacteria | 4448 |
| 592 | Ga0496107_0026960 | 3300048910 | Bacteria | 4078 |
| 593 | Ga0496107_0065382 | 3300048910 | Bacteria | 2636 |
| 594 | Ga0496107_0117505 | 3300048910 | Bacteria | 1958 |
| 595 | Ga0496109_0157605 | 3300048912 | Bacteria | 2126 |
| 596 | Ga0496109_0391567 | 3300048912 | Bacteria | 1313 |
| 597 | Ga0496110_0006703 | 3300048913 | Bacteria | 9156 |
| 598 | Ga0496110_0035913 | 3300048913 | Bacteria | 4303 |
| 599 | Ga0496110_0610431 | 3300048913 | Bacteria | 989 |
| 600 | Ga0496111_0032157 | 3300048914 | Bacteria | 3740 |
| 601 | Ga0496111_0062847 | 3300048914 | Bacteria | 2692 |
| 602 | Ga0496112_0005011 | 3300048915 | Bacteria | 11368 |
| 603 | Ga0496112_0015117 | 3300048915 | Bacteria | 7191 |
| 604 | Ga0496112_0102413 | 3300048915 | Bacteria | 2833 |
| 605 | Ga0496113_0000580 | 3300048916 | Bacteria | 18226 |
| 606 | Ga0496113_0048511 | 3300048916 | Bacteria | 3159 |
| 607 | Ga0496114_0018555 | 3300048917 | Bacteria | 5626 |
| 608 | Ga0496114_0045493 | 3300048917 | Bacteria | 3646 |
| 609 | Ga0496115_0015791 | 3300048918 | Bacteria | 5734 |
| 610 | Ga0496115_0055943 | 3300048918 | Bacteria | 3170 |
| 611 | Ga0496115_0118311 | 3300048918 | Bacteria | 2179 |
| 612 | Ga0496115_0185087 | 3300048918 | Bacteria | 1721 |
| 613 | Ga0496115_0414442 | 3300048918 | Bacteria | 1092 |
| 614 | Ga0496116_0008695 | 3300048919 | Bacteria | 8775 |
| 615 | Ga0496116_0023149 | 3300048919 | Bacteria | 4634 |
| 616 | Ga0496117_0001465 | 3300048920 | Bacteria | 33966 |
| 617 | Ga0496117_0001575 | 3300048920 | Bacteria | 32376 |
| 618 | Ga0496117_0003919 | 3300048920 | Bacteria | 16853 |
| 619 | Ga0496117_0017415 | 3300048920 | Bacteria | 5998 |
| 620 | Ga0496117_0062182 | 3300048920 | Bacteria | 2560 |
| 621 | Ga0496118_0000215 | 3300048921 | Bacteria | 100753 |
| 622 | Ga0496118_0001565 | 3300048921 | Bacteria | 33985 |
| 623 | Ga0496118_0003868 | 3300048921 | Bacteria | 18395 |
| 624 | Ga0496118_0010590 | 3300048921 | Bacteria | 9112 |
| 625 | Ga0496118_0030359 | 3300048921 | Bacteria | 4512 |
| 626 | Ga0496118_0042769 | 3300048921 | Bacteria | 3570 |
| 627 | Ga0496118_0045149 | 3300048921 | Bacteria | 3443 |
| 628 | Ga0496119_0113403 | 3300048922 | Bacteria | 1501 |
| 629 | Ga0496119_0211102 | 3300048922 | Bacteria | 999 |
| 630 | Ga0496120_0000242 | 3300048923 | Bacteria | 93148 |
| 631 | Ga0496120_0062677 | 3300048923 | Bacteria | 2071 |
| 632 | Ga0496121_0001279 | 3300048924 | Bacteria | 43329 |
| 633 | Ga0496121_0001771 | 3300048924 | Bacteria | 35100 |
| 634 | Ga0496121_0001850 | 3300048924 | Bacteria | 34039 |
| 635 | Ga0496121_0004851 | 3300048924 | Bacteria | 17689 |
| 636 | Ga0496121_0006443 | 3300048924 | Bacteria | 14569 |
| 637 | Ga0496121_0027364 | 3300048924 | Bacteria | 5337 |
| 638 | Ga0496121_0031945 | 3300048924 | Bacteria | 4798 |
| 639 | Ga0496121_0094864 | 3300048924 | Bacteria | 2320 |
| 640 | Ga0496122_0002377 | 3300048925 | Bacteria | 26941 |
| 641 | Ga0496122_0004966 | 3300048925 | Bacteria | 16112 |
| 642 | Ga0496123_0000963 | 3300048926 | Bacteria | 44427 |
| 643 | Ga0496124_0016484 | 3300048927 | Bacteria | 7020 |
| 644 | Ga0496125_0012001 | 3300048928 | Bacteria | 8627 |
| 645 | Ga0496125_0013885 | 3300048928 | Bacteria | 7882 |
| 646 | Ga0496126_0000393 | 3300048929 | Bacteria | 89680 |
| 647 | Ga0496126_0002361 | 3300048929 | Bacteria | 25765 |
| 648 | Ga0496126_0002530 | 3300048929 | Bacteria | 24476 |
| 649 | Ga0496126_0005965 | 3300048929 | Bacteria | 13699 |
| 650 | Ga0496126_0431176 | 3300048929 | Bacteria | 1064 |
| 651 | Ga0496126_0627121 | 3300048929 | Bacteria | 844 |
| 652 | Ga0495682_0021538 | 3300049460 | Bacteria | 2414 |
| 653 | Ga0501043_0198078 | 3300049579 | Bacteria | 1560 |
| 654 | Ga0466962_0000511 | 3300061719 | Bacteria | 16910 |
| 655 | Ga0466962_0126597 | 3300061719 | Bacteria | 1233 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10315792 | Ga0207678_103157922 | 217 |
| 2 | 3300006173 | Ga0070716_100025956 | Ga0070716_1000259563 | 228 |
| 3 | 3300025939 | Ga0207665_10007330 | Ga0207665_100073302 | 228 |
| 4 | 3300013105 | Ga0157369_10005727 | Ga0157369_100057273 | 232 |
| 5 | 3300046543 | Ga0495645_0345046 | Ga0495645_0345046_28_729 | 233 |
| 6 | 3300009094 | Ga0111539_10825507 | Ga0111539_108255072 | 234 |
| 7 | 3300009098 | Ga0105245_10094629 | Ga0105245_100946292 | 234 |
| 8 | 3300025924 | Ga0207694_10090313 | Ga0207694_100903133 | 234 |
| 9 | 3300048923 | Ga0496120_0000242 | Ga0496120_0000242_44040_44768 | 234 |
| 10 | 3300009093 | Ga0105240_10076405 | Ga0105240_100764054 | 235 |
| 11 | 3300009551 | Ga0105238_10026930 | Ga0105238_100269303 | 235 |
| 12 | 3300028379 | Ga0268266_10003195 | Ga0268266_100031954 | 235 |
| 13 | 3300005335 | Ga0070666_10003402 | Ga0070666_100034027 | 236 |
| 14 | 3300005355 | Ga0070671_100000799 | Ga0070671_1000007998 | 236 |
| 15 | 3300005367 | Ga0070667_100029723 | Ga0070667_1000297234 | 236 |
| 16 | 3300005548 | Ga0070665_100004690 | Ga0070665_1000046902 | 236 |
| 17 | 3300005617 | Ga0068859_100003018 | Ga0068859_1000030184 | 236 |
| 18 | 3300005841 | Ga0068863_100004798 | Ga0068863_1000047985 | 236 |
| 19 | 3300005842 | Ga0068858_100002341 | Ga0068858_1000023419 | 236 |
| 20 | 3300005843 | Ga0068860_100038141 | Ga0068860_1000381414 | 236 |
| 21 | 3300006931 | Ga0097620_100003018 | Ga0097620_1000030184 | 236 |
| 22 | 3300009101 | Ga0105247_10000137 | Ga0105247_1000013749 | 236 |
| 23 | 3300009177 | Ga0105248_10013042 | Ga0105248_100130425 | 236 |
| 24 | 3300009553 | Ga0105249_10020381 | Ga0105249_100203814 | 236 |
| 25 | 3300013306 | Ga0163162_10120683 | Ga0163162_101206832 | 236 |
| 26 | 3300014325 | Ga0163163_10206787 | Ga0163163_102067873 | 236 |
| 27 | 3300014968 | Ga0157379_10006556 | Ga0157379_100065568 | 236 |
| 28 | 3300014969 | Ga0157376_10114666 | Ga0157376_101146662 | 236 |
| 29 | 3300025900 | Ga0207710_10001357 | Ga0207710_100013576 | 236 |
| 30 | 3300025903 | Ga0207680_10063030 | Ga0207680_100630303 | 236 |
| 31 | 3300025931 | Ga0207644_10000708 | Ga0207644_1000070813 | 236 |
| 32 | 3300025961 | Ga0207712_10086664 | Ga0207712_100866642 | 236 |
| 33 | 3300025986 | Ga0207658_10011861 | Ga0207658_100118615 | 236 |
| 34 | 3300026035 | Ga0207703_10000957 | Ga0207703_1000095719 | 236 |
| 35 | 3300026088 | Ga0207641_10006476 | Ga0207641_100064769 | 236 |
| 36 | 3300028381 | Ga0268264_10058724 | Ga0268264_100587243 | 236 |
| 37 | 3300031730 | Ga0307516_10004172 | Ga0307516_100041728 | 236 |
| 38 | 3300048905 | Ga0496102_0031892 | Ga0496102_0031892_1100_1810 | 236 |
| 39 | 3300048915 | Ga0496112_0102413 | Ga0496112_0102413_854_1564 | 236 |
| 40 | 3300048924 | Ga0496121_0001771 | Ga0496121_0001771_16957_17667 | 236 |
| 41 | 3300048928 | Ga0496125_0013885 | Ga0496125_0013885_5971_6681 | 236 |
| 42 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001366 | 237 |
| 43 | 3300030521 | Ga0307511_10000037 | Ga0307511_1000003779 | 238 |
| 44 | 3300031595 | Ga0265313_10068209 | Ga0265313_100682092 | 238 |
| 45 | 3300044684 | Ga0466966_0381918 | Ga0466966_0381918_24_764 | 238 |
| 46 | 3300045049 | Ga0466959_0056251 | Ga0466959_0056251_1004_1744 | 238 |
| 47 | 3300047443 | Ga0495687_047113 | Ga0495687_047113_792_1508 | 238 |
| 48 | 3300048912 | Ga0496109_0391567 | Ga0496109_0391567_17_736 | 238 |
| 49 | 3300049579 | Ga0501043_0198078 | Ga0501043_0198078_754_1518 | 239 |
| 50 | 3300006844 | Ga0075428_100512579 | Ga0075428_1005125792 | 240 |
| 51 | 3300035116 | Ga0373945_0039004 | Ga0373945_0039004_144_893 | 240 |
| 52 | 3300035724 | Ga0373933_0271631 | Ga0373933_0271631_232_981 | 240 |
| 53 | 3300048908 | Ga0496105_0016770 | Ga0496105_0016770_50_799 | 240 |
| 54 | 3300048917 | Ga0496114_0045493 | Ga0496114_0045493_2659_3408 | 240 |
| 55 | 3300048918 | Ga0496115_0118311 | Ga0496115_0118311_1372_2121 | 240 |
| 56 | 3300030878 | Ga0265770_1000507 | Ga0265770_10005073 | 241 |
| 57 | 3300031090 | Ga0265760_10000102 | Ga0265760_1000010217 | 241 |
| 58 | 3300035113 | Ga0373936_0003390 | Ga0373936_0003390_4025_4777 | 241 |
| 59 | 3300005530 | Ga0070679_100245769 | Ga0070679_1002457692 | 242 |
| 60 | 3300025906 | Ga0207699_10214020 | Ga0207699_102140202 | 242 |
| 61 | 3300025912 | Ga0207707_10001891 | Ga0207707_1000189115 | 242 |
| 62 | 3300025921 | Ga0207652_10133950 | Ga0207652_101339502 | 242 |
| 63 | 3300005330 | Ga0070690_100026950 | Ga0070690_1000269502 | 243 |
| 64 | 3300005334 | Ga0068869_100149149 | Ga0068869_1001491492 | 243 |
| 65 | 3300005335 | Ga0070666_10015929 | Ga0070666_100159294 | 243 |
| 66 | 3300005338 | Ga0068868_100014098 | Ga0068868_1000140984 | 243 |
| 67 | 3300005355 | Ga0070671_100115835 | Ga0070671_1001158352 | 243 |
| 68 | 3300005356 | Ga0070674_100155228 | Ga0070674_1001552281 | 243 |
| 69 | 3300005367 | Ga0070667_100009756 | Ga0070667_1000097562 | 243 |
| 70 | 3300005434 | Ga0070709_10109287 | Ga0070709_101092872 | 243 |
| 71 | 3300005459 | Ga0068867_100141927 | Ga0068867_1001419272 | 243 |
| 72 | 3300005546 | Ga0070696_100145052 | Ga0070696_1001450522 | 243 |
| 73 | 3300005614 | Ga0068856_100006988 | Ga0068856_1000069885 | 243 |
| 74 | 3300005840 | Ga0068870_10225532 | Ga0068870_102255322 | 243 |
| 75 | 3300005841 | Ga0068863_100045905 | Ga0068863_1000459055 | 243 |
| 76 | 3300005842 | Ga0068858_100040355 | Ga0068858_1000403552 | 243 |
| 77 | 3300006028 | Ga0070717_10727163 | Ga0070717_107271631 | 243 |
| 78 | 3300006163 | Ga0070715_10047205 | Ga0070715_100472052 | 243 |
| 79 | 3300006173 | Ga0070716_100017471 | Ga0070716_1000174714 | 243 |
| 80 | 3300006175 | Ga0070712_100029151 | Ga0070712_1000291512 | 243 |
| 81 | 3300006881 | Ga0068865_100050034 | Ga0068865_1000500342 | 243 |
| 82 | 3300009176 | Ga0105242_10006774 | Ga0105242_100067744 | 243 |
| 83 | 3300013296 | Ga0157374_10032044 | Ga0157374_100320444 | 243 |
| 84 | 3300013297 | Ga0157378_10016544 | Ga0157378_100165444 | 243 |
| 85 | 3300013306 | Ga0163162_10040088 | Ga0163162_100400883 | 243 |
| 86 | 3300013308 | Ga0157375_10116071 | Ga0157375_101160712 | 243 |
| 87 | 3300014325 | Ga0163163_10235976 | Ga0163163_102359762 | 243 |
| 88 | 3300025898 | Ga0207692_10279225 | Ga0207692_102792251 | 243 |
| 89 | 3300025899 | Ga0207642_10026019 | Ga0207642_100260193 | 243 |
| 90 | 3300025903 | Ga0207680_10108472 | Ga0207680_101084722 | 243 |
| 91 | 3300025915 | Ga0207693_10001490 | Ga0207693_1000149015 | 243 |
| 92 | 3300025938 | Ga0207704_10113048 | Ga0207704_101130482 | 243 |
| 93 | 3300025939 | Ga0207665_10003828 | Ga0207665_100038283 | 243 |
| 94 | 3300025941 | Ga0207711_10032076 | Ga0207711_100320763 | 243 |
| 95 | 3300025942 | Ga0207689_10129682 | Ga0207689_101296823 | 243 |
| 96 | 3300026088 | Ga0207641_10160927 | Ga0207641_101609272 | 243 |
| 97 | 3300026089 | Ga0207648_10066597 | Ga0207648_100665972 | 243 |
| 98 | 3300026121 | Ga0207683_10016674 | Ga0207683_100166745 | 243 |
| 99 | 3300035692 | Ga0373935_0160961 | Ga0373935_0160961_609_1364 | 243 |
| 100 | 3300035695 | Ga0373927_0017430 | Ga0373927_0017430_2130_2885 | 243 |
| 101 | 3300035724 | Ga0373933_0266681 | Ga0373933_0266681_132_887 | 243 |
| 102 | 3300036401 | Ga0373937_0132157 | Ga0373937_0132157_1362_2117 | 243 |
| 103 | 3300046472 | Ga0495580_0000532 | Ga0495580_0000532_18102_18857 | 243 |
| 104 | 3300046473 | Ga0495582_0229493 | Ga0495582_0229493_100_855 | 243 |
| 105 | 3300046518 | Ga0495631_0050321 | Ga0495631_0050321_1038_1802 | 243 |
| 106 | 3300046531 | Ga0495665_0199007 | Ga0495665_0199007_144_899 | 243 |
| 107 | 3300046683 | Ga0495658_0226025 | Ga0495658_0226025_154_909 | 243 |
| 108 | 3300047319 | Ga0495674_0422532 | Ga0495674_0422532_235_990 | 243 |
| 109 | 3300048905 | Ga0496102_0075175 | Ga0496102_0075175_751_1506 | 243 |
| 110 | 3300048909 | Ga0496106_0038078 | Ga0496106_0038078_576_1331 | 243 |
| 111 | 3300048910 | Ga0496107_0065382 | Ga0496107_0065382_1204_1959 | 243 |
| 112 | 3300048913 | Ga0496110_0035913 | Ga0496110_0035913_2892_3647 | 243 |
| 113 | 3300048914 | Ga0496111_0032157 | Ga0496111_0032157_897_1652 | 243 |
| 114 | 3300048915 | Ga0496112_0015117 | Ga0496112_0015117_604_1359 | 243 |
| 115 | 3300048918 | Ga0496115_0015791 | Ga0496115_0015791_2422_3177 | 243 |
| 116 | 3300048929 | Ga0496126_0005965 | Ga0496126_0005965_8577_9341 | 244 |
| 117 | iso_pu_bacteria | 2501025501 | 2501072086 | 244 |
| 118 | 3300005336 | Ga0070680_100079820 | Ga0070680_1000798202 | 245 |
| 119 | 3300005458 | Ga0070681_10000668 | Ga0070681_1000066818 | 245 |
| 120 | 3300005530 | Ga0070679_100000666 | Ga0070679_10000066613 | 245 |
| 121 | 3300005563 | Ga0068855_100001590 | Ga0068855_10000159018 | 245 |
| 122 | 3300005563 | Ga0068855_100013226 | Ga0068855_1000132263 | 245 |
| 123 | 3300009093 | Ga0105240_10010335 | Ga0105240_1001033512 | 245 |
| 124 | 3300009093 | Ga0105240_10015865 | Ga0105240_100158653 | 245 |
| 125 | 3300009551 | Ga0105238_10005358 | Ga0105238_1000535810 | 245 |
| 126 | 3300013104 | Ga0157370_10000919 | Ga0157370_1000091913 | 245 |
| 127 | 3300013105 | Ga0157369_10006041 | Ga0157369_100060418 | 245 |
| 128 | 3300025912 | Ga0207707_10000107 | Ga0207707_1000010730 | 245 |
| 129 | 3300025913 | Ga0207695_10004996 | Ga0207695_1000499614 | 245 |
| 130 | 3300025914 | Ga0207671_10104774 | Ga0207671_101047743 | 245 |
| 131 | 3300025917 | Ga0207660_10170240 | Ga0207660_101702402 | 245 |
| 132 | 3300025921 | Ga0207652_10000738 | Ga0207652_1000073811 | 245 |
| 133 | 3300025924 | Ga0207694_10003158 | Ga0207694_100031584 | 245 |
| 134 | 3300025949 | Ga0207667_10021321 | Ga0207667_100213215 | 245 |
| 135 | 3300026078 | Ga0207702_10163458 | Ga0207702_101634582 | 245 |
| 136 | 3300005356 | Ga0070674_100057507 | Ga0070674_1000575072 | 246 |
| 137 | 3300005458 | Ga0070681_10000460 | Ga0070681_1000046014 | 246 |
| 138 | 3300005459 | Ga0068867_100085067 | Ga0068867_1000850672 | 246 |
| 139 | 3300005530 | Ga0070679_100125757 | Ga0070679_1001257572 | 246 |
| 140 | 3300005548 | Ga0070665_100221638 | Ga0070665_1002216382 | 246 |
| 141 | 3300005615 | Ga0070702_100038788 | Ga0070702_1000387883 | 246 |
| 142 | 3300005718 | Ga0068866_10096886 | Ga0068866_100968862 | 246 |
| 143 | 3300010375 | Ga0105239_10531663 | Ga0105239_105316632 | 246 |
| 144 | 3300013297 | Ga0157378_10282324 | Ga0157378_102823242 | 246 |
| 145 | 3300013308 | Ga0157375_10182706 | Ga0157375_101827063 | 246 |
| 146 | 3300025912 | Ga0207707_10071391 | Ga0207707_100713913 | 246 |
| 147 | 3300025921 | Ga0207652_10181944 | Ga0207652_101819442 | 246 |
| 148 | 3300025937 | Ga0207669_10027269 | Ga0207669_100272693 | 246 |
| 149 | 3300025938 | Ga0207704_10068620 | Ga0207704_100686203 | 246 |
| 150 | iso_pu_bacteria | 2519103095 | 2519461829 | 247 |
| 151 | 3300003187 | JGI25151J46595_10001889 | JGI25151J46595_100018898 | 248 |
| 152 | 3300003771 | Ga0055526_1007508 | Ga0055526_10075085 | 248 |
| 153 | 3300003773 | Ga0055537_1002716 | Ga0055537_10027164 | 248 |
| 154 | 3300003775 | Ga0055524_1001249 | Ga0055524_10012496 | 248 |
| 155 | 3300003784 | Ga0055534_1002100 | Ga0055534_10021006 | 248 |
| 156 | 3300025263 | Ga0209565_1000529 | Ga0209565_10005297 | 248 |
| 157 | 3300025273 | Ga0209673_1014734 | Ga0209673_10147342 | 248 |
| 158 | 3300025291 | Ga0209675_1000906 | Ga0209675_100090613 | 248 |
| 159 | 3300025294 | Ga0209025_1002860 | Ga0209025_10028608 | 248 |
| 160 | 3300025295 | Ga0209564_1001298 | Ga0209564_10012987 | 248 |
| 161 | 3300025297 | Ga0209758_1023254 | Ga0209758_10232543 | 248 |
| 162 | 3300025299 | Ga0209256_1003779 | Ga0209256_10037795 | 248 |
| 163 | 3300047320 | Ga0495672_0009363 | Ga0495672_0009363_5249_6040 | 248 |
| 164 | 3300025924 | Ga0207694_10319943 | Ga0207694_103199432 | 249 |
| 165 | 3300046454 | Ga0495592_0076936 | Ga0495592_0076936_1619_2389 | 249 |
| 166 | 3300046810 | Ga0495660_0076592 | Ga0495660_0076592_790_1560 | 249 |
| 167 | 3300047323 | Ga0495683_0011576 | Ga0495683_0011576_796_1566 | 249 |
| 168 | 3300048091 | Ga0495626_0018295 | Ga0495626_0018295_1499_2269 | 249 |
| 169 | 3300048922 | Ga0496119_0113403 | Ga0496119_0113403_188_1006 | 250 |
| 170 | 3300010159 | Ga0099796_10000063 | Ga0099796_100000633 | 252 |
| 171 | 3300046462 | Ga0495651_0200182 | Ga0495651_0200182_539_1351 | 252 |
| 172 | 3300047317 | Ga0495604_0006557 | Ga0495604_0006557_3377_4189 | 252 |
| 173 | 3300047444 | Ga0495675_0013701 | Ga0495675_0013701_616_1428 | 252 |
| 174 | 3300048906 | Ga0496103_0003774 | Ga0496103_0003774_929_1744 | 252 |
| 175 | 3300048920 | Ga0496117_0003919 | Ga0496117_0003919_11287_12102 | 252 |
| 176 | 3300048921 | Ga0496118_0000215 | Ga0496118_0000215_88732_89547 | 252 |
| 177 | 3300048929 | Ga0496126_0431176 | Ga0496126_0431176_240_1031 | 252 |
| 178 | iso_pu_bacteria | 2501025502 | 2501084418 | 252 |
| 179 | iso_pu_bacteria | 2510917013 | 2511088502 | 252 |
| 180 | iso_pu_bacteria | 2904615490 | 2904622153 | 252 |
| 181 | 3300046454 | Ga0495592_0028665 | Ga0495592_0028665_1314_2129 | 253 |
| 182 | 3300046458 | Ga0495591_004355 | Ga0495591_004355_4998_5813 | 253 |
| 183 | 3300046459 | Ga0495629_0009512 | Ga0495629_0009512_4909_5724 | 253 |
| 184 | 3300046462 | Ga0495651_0013144 | Ga0495651_0013144_5050_5865 | 253 |
| 185 | 3300046463 | Ga0495653_0105974 | Ga0495653_0105974_435_1250 | 253 |
| 186 | 3300046472 | Ga0495580_0142296 | Ga0495580_0142296_664_1479 | 253 |
| 187 | 3300046476 | Ga0495662_0016718 | Ga0495662_0016718_909_1724 | 253 |
| 188 | 3300046516 | Ga0495628_0064189 | Ga0495628_0064189_910_1725 | 253 |
| 189 | 3300046524 | Ga0495648_0040367 | Ga0495648_0040367_1709_2524 | 253 |
| 190 | 3300046526 | Ga0495666_0013125 | Ga0495666_0013125_2137_2952 | 253 |
| 191 | 3300046529 | Ga0495652_0016081 | Ga0495652_0016081_4539_5354 | 253 |
| 192 | 3300046533 | Ga0495640_0012834 | Ga0495640_0012834_4925_5740 | 253 |
| 193 | 3300046536 | Ga0495587_0019491 | Ga0495587_0019491_1600_2415 | 253 |
| 194 | 3300046642 | Ga0495634_0076630 | Ga0495634_0076630_1070_1885 | 253 |
| 195 | 3300046663 | Ga0495635_0062940 | Ga0495635_0062940_651_1466 | 253 |
| 196 | 3300046665 | Ga0495661_0011321 | Ga0495661_0011321_436_1251 | 253 |
| 197 | 3300046678 | Ga0495599_0039347 | Ga0495599_0039347_2099_2914 | 253 |
| 198 | 3300046679 | Ga0495623_0009831 | Ga0495623_0009831_3521_4336 | 253 |
| 199 | 3300046680 | Ga0495646_0089898 | Ga0495646_0089898_310_1125 | 253 |
| 200 | 3300046689 | Ga0495613_0045430 | Ga0495613_0045430_779_1594 | 253 |
| 201 | 3300046690 | Ga0495624_0059864 | Ga0495624_0059864_910_1725 | 253 |
| 202 | 3300046794 | Ga0495589_0026443 | Ga0495589_0026443_664_1479 | 253 |
| 203 | 3300046809 | Ga0495600_0004960 | Ga0495600_0004960_759_1574 | 253 |
| 204 | 3300047315 | Ga0495581_0017288 | Ga0495581_0017288_1652_2467 | 253 |
| 205 | 3300047317 | Ga0495604_0012959 | Ga0495604_0012959_1163_1978 | 253 |
| 206 | 3300047319 | Ga0495674_0111666 | Ga0495674_0111666_216_1031 | 253 |
| 207 | 3300047321 | Ga0495676_0031199 | Ga0495676_0031199_1830_2645 | 253 |
| 208 | 3300047322 | Ga0495680_0069392 | Ga0495680_0069392_505_1320 | 253 |
| 209 | 3300047444 | Ga0495675_0001013 | Ga0495675_0001013_5102_5917 | 253 |
| 210 | 3300047446 | Ga0495679_001343 | Ga0495679_001343_11184_11999 | 253 |
| 211 | 3300047469 | Ga0495673_0006705 | Ga0495673_0006705_4101_4916 | 253 |
| 212 | 3300047673 | Ga0495593_0052233 | Ga0495593_0052233_910_1725 | 253 |
| 213 | 3300048088 | Ga0495602_0132686 | Ga0495602_0132686_664_1479 | 253 |
| 214 | 3300048089 | Ga0495614_0010644 | Ga0495614_0010644_1958_2773 | 253 |
| 215 | 3300048924 | Ga0496121_0001279 | Ga0496121_0001279_9129_9950 | 253 |
| 216 | 3300048929 | Ga0496126_0002530 | Ga0496126_0002530_10942_11763 | 253 |
| 217 | 3300013296 | Ga0157374_10000034 | Ga0157374_1000003459 | 254 |
| 218 | 3300025904 | Ga0207647_10020333 | Ga0207647_100203332 | 254 |
| 219 | iso_pu_bacteria | 2510917014 | 2511100896 | 254 |
| 220 | iso_pu_bacteria | 2510917015 | 2511107345 | 254 |
| 221 | iso_pu_bacteria | 2515154189 | 2516020496 | 254 |
| 222 | iso_pu_bacteria | 2582581311 | 2585293823 | 254 |
| 223 | iso_pu_bacteria | 2599185239 | 2599735331 | 254 |
| 224 | iso_pu_bacteria | 2599185240 | 2599743450 | 254 |
| 225 | iso_pu_bacteria | 2599185355 | 2600205318 | 254 |
| 226 | iso_pu_bacteria | 2675903129 | 2676740615 | 254 |
| 227 | iso_pu_bacteria | 2808606384 | 2808969467 | 254 |
| 228 | iso_pu_bacteria | 2808606390 | 2809004298 | 254 |
| 229 | iso_pu_bacteria | 2808606391 | 2809012876 | 254 |
| 230 | iso_pu_bacteria | 2816332253 | 2817258695 | 254 |
| 231 | iso_pu_bacteria | 2816332256 | 2817280874 | 254 |
| 232 | iso_pu_bacteria | 2816332286 | 2817453389 | 254 |
| 233 | iso_pu_bacteria | 2818991452 | 2819632239 | 254 |
| 234 | iso_pu_bacteria | 2863421361 | 2863422616 | 254 |
| 235 | iso_pu_bacteria | 2870068957 | 2870072832 | 254 |
| 236 | iso_pu_bacteria | 2883087390 | 2883089525 | 254 |
| 237 | iso_pu_bacteria | 2904564687 | 2904565118 | 254 |
| 238 | iso_pu_bacteria | 2904571731 | 2904572186 | 254 |
| 239 | iso_pu_bacteria | 2928157003 | 2928157312 | 254 |
| 240 | iso_pu_bacteria | 2928163908 | 2928165158 | 254 |
| 241 | iso_pu_bacteria | 2928170801 | 2928172410 | 254 |
| 242 | iso_pu_bacteria | 2928536128 | 2928537509 | 254 |
| 243 | iso_pu_bacteria | 2981990288 | 2981990295 | 254 |
| 244 | iso_pu_bacteria | 641736154 | 642417524 | 254 |
| 245 | iso_pu_bacteria | 8018845410 | 8018851687 | 254 |
| 246 | iso_pu_bacteria | 8020807995 | 8020812433 | 254 |
| 247 | iso_pu_bacteria | 8020938398 | 8020944289 | 254 |
| 248 | iso_pu_bacteria | 8020945358 | 8020952668 | 254 |
| 249 | iso_pu_bacteria | 8020953355 | 8020953978 | 254 |
| 250 | iso_pu_bacteria | 8021120328 | 8021120678 | 254 |
| 251 | iso_pu_bacteria | 8039098773 | 8039102948 | 254 |
| 252 | iso_pu_bacteria | 8040167225 | 8040169407 | 254 |
| 253 | iso_pu_bacteria | 8040173305 | 8040173800 | 254 |
| 254 | 3300005366 | Ga0070659_100441072 | Ga0070659_1004410721 | 255 |
| 255 | 3300013306 | Ga0163162_10005558 | Ga0163162_100055586 | 255 |
| 256 | 3300046471 | Ga0495650_0003550 | Ga0495650_0003550_4119_4934 | 255 |
| 257 | 3300046516 | Ga0495628_0258021 | Ga0495628_0258021_388_1206 | 255 |
| 258 | 3300047317 | Ga0495604_0030671 | Ga0495604_0030671_1411_2241 | 255 |
| 259 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_253069_253887 | 255 |
| 260 | 3300048920 | Ga0496117_0001575 | Ga0496117_0001575_25786_26634 | 255 |
| 261 | 3300048921 | Ga0496118_0010590 | Ga0496118_0010590_2506_3354 | 255 |
| 262 | 3300048929 | Ga0496126_0000393 | Ga0496126_0000393_45920_46768 | 255 |
| 263 | 3300009011 | Ga0105251_10000714 | Ga0105251_1000071413 | 257 |
| 264 | 3300009098 | Ga0105245_10031275 | Ga0105245_100312752 | 257 |
| 265 | 3300009174 | Ga0105241_10077514 | Ga0105241_100775142 | 257 |
| 266 | 3300009174 | Ga0105241_10216080 | Ga0105241_102160802 | 257 |
| 267 | 3300009545 | Ga0105237_10183206 | Ga0105237_101832062 | 257 |
| 268 | 3300009551 | Ga0105238_10191105 | Ga0105238_101911052 | 257 |
| 269 | 3300013296 | Ga0157374_10705339 | Ga0157374_107053391 | 257 |
| 270 | 3300025302 | Ga0207426_1001366 | Ga0207426_100136615 | 257 |
| 271 | 3300025735 | Ga0207713_1002233 | Ga0207713_10022334 | 257 |
| 272 | 3300025913 | Ga0207695_10434851 | Ga0207695_104348512 | 257 |
| 273 | 3300027312 | Ga0209371_1011628 | Ga0209371_10116283 | 257 |
| 274 | 3300030500 | Ga0268256_1010581 | Ga0268256_10105812 | 257 |
| 275 | 3300038443 | Ga0395901_0000004 | Ga0395901_0000004_606664_607473 | 257 |
| 276 | 3300046477 | Ga0495664_0007907 | Ga0495664_0007907_4829_5641 | 257 |
| 277 | 3300046491 | Ga0495584_0133439 | Ga0495584_0133439_238_1050 | 257 |
| 278 | 3300046517 | Ga0495630_0075101 | Ga0495630_0075101_1484_2296 | 257 |
| 279 | 3300046531 | Ga0495665_0086675 | Ga0495665_0086675_535_1347 | 257 |
| 280 | 3300046542 | Ga0495597_0004638 | Ga0495597_0004638_2041_2853 | 257 |
| 281 | 3300046543 | Ga0495645_0003992 | Ga0495645_0003992_5712_6524 | 257 |
| 282 | 3300046690 | Ga0495624_0018707 | Ga0495624_0018707_404_1216 | 257 |
| 283 | 3300047317 | Ga0495604_0074166 | Ga0495604_0074166_905_1717 | 257 |
| 284 | 3300047322 | Ga0495680_0006673 | Ga0495680_0006673_3013_3825 | 257 |
| 285 | 3300047323 | Ga0495683_0006194 | Ga0495683_0006194_2722_3534 | 257 |
| 286 | 3300047444 | Ga0495675_0172333 | Ga0495675_0172333_207_1019 | 257 |
| 287 | 3300047444 | Ga0495675_0256624 | Ga0495675_0256624_62_874 | 257 |
| 288 | 3300047469 | Ga0495673_0039560 | Ga0495673_0039560_43_855 | 257 |
| 289 | 3300047673 | Ga0495593_0031686 | Ga0495593_0031686_701_1513 | 257 |
| 290 | 3300047673 | Ga0495593_0101989 | Ga0495593_0101989_553_1365 | 257 |
| 291 | 3300048088 | Ga0495602_0047606 | Ga0495602_0047606_767_1579 | 257 |
| 292 | 3300048904 | Ga0496101_0008320 | Ga0496101_0008320_5947_6759 | 257 |
| 293 | 3300048904 | Ga0496101_0120959 | Ga0496101_0120959_17_829 | 257 |
| 294 | 3300048905 | Ga0496102_0113528 | Ga0496102_0113528_1696_2508 | 257 |
| 295 | 3300048906 | Ga0496103_0113437 | Ga0496103_0113437_761_1573 | 257 |
| 296 | 3300048907 | Ga0496104_0199984 | Ga0496104_0199984_736_1548 | 257 |
| 297 | 3300048909 | Ga0496106_0026259 | Ga0496106_0026259_377_1189 | 257 |
| 298 | 3300048909 | Ga0496106_0214582 | Ga0496106_0214582_375_1187 | 257 |
| 299 | 3300048910 | Ga0496107_0022553 | Ga0496107_0022553_1929_2741 | 257 |
| 300 | 3300048912 | Ga0496109_0157605 | Ga0496109_0157605_35_847 | 257 |
| 301 | 3300048913 | Ga0496110_0006703 | Ga0496110_0006703_1216_2028 | 257 |
| 302 | 3300048914 | Ga0496111_0062847 | Ga0496111_0062847_1262_2074 | 257 |
| 303 | 3300048915 | Ga0496112_0005011 | Ga0496112_0005011_4618_5430 | 257 |
| 304 | 3300048916 | Ga0496113_0048511 | Ga0496113_0048511_518_1330 | 257 |
| 305 | 3300048918 | Ga0496115_0414442 | Ga0496115_0414442_24_836 | 257 |
| 306 | 3300048919 | Ga0496116_0008695 | Ga0496116_0008695_4626_5438 | 257 |
| 307 | 3300048920 | Ga0496117_0062182 | Ga0496117_0062182_1730_2542 | 257 |
| 308 | 3300048921 | Ga0496118_0042769 | Ga0496118_0042769_642_1454 | 257 |
| 309 | 3300048922 | Ga0496119_0211102 | Ga0496119_0211102_166_978 | 257 |
| 310 | 3300048924 | Ga0496121_0004851 | Ga0496121_0004851_16093_16905 | 257 |
| 311 | 3300048925 | Ga0496122_0004966 | Ga0496122_0004966_12714_13526 | 257 |
| 312 | 3300048927 | Ga0496124_0016484 | Ga0496124_0016484_5773_6585 | 257 |
| 313 | 3300048928 | Ga0496125_0012001 | Ga0496125_0012001_5569_6381 | 257 |
| 314 | 3300048929 | Ga0496126_0627121 | Ga0496126_0627121_16_828 | 257 |
| 315 | 3300001979 | JGI24740J21852_10046178 | JGI24740J21852_100461782 | 258 |
| 316 | 3300003316 | rootH1_10087144 | rootH1_100871442 | 258 |
| 317 | 3300003758 | Ga0055532_1002398 | Ga0055532_10023983 | 258 |
| 318 | 3300003758 | Ga0055532_1002815 | Ga0055532_10028153 | 258 |
| 319 | 3300003758 | Ga0055532_1002986 | Ga0055532_10029862 | 258 |
| 320 | 3300003760 | Ga0055527_1002274 | Ga0055527_10022742 | 258 |
| 321 | 3300003760 | Ga0055527_1002647 | Ga0055527_10026473 | 258 |
| 322 | 3300003761 | Ga0055535_1004527 | Ga0055535_10045272 | 258 |
| 323 | 3300003761 | Ga0055535_1004823 | Ga0055535_10048232 | 258 |
| 324 | 3300003762 | Ga0055542_1004561 | Ga0055542_10045612 | 258 |
| 325 | 3300003762 | Ga0055542_1004854 | Ga0055542_10048542 | 258 |
| 326 | 3300003763 | Ga0055529_1002308 | Ga0055529_10023082 | 258 |
| 327 | 3300003790 | Ga0055528_1006793 | Ga0055528_10067933 | 258 |
| 328 | 3300003856 | Ga0058692_1006976 | Ga0058692_10069762 | 258 |
| 329 | 3300005339 | Ga0070660_100000002 | Ga0070660_100000002132 | 258 |
| 330 | 3300005366 | Ga0070659_100000007 | Ga0070659_100000007108 | 258 |
| 331 | 3300005455 | Ga0070663_100002432 | Ga0070663_1000024327 | 258 |
| 332 | 3300005563 | Ga0068855_100076194 | Ga0068855_1000761942 | 258 |
| 333 | 3300005564 | Ga0070664_100220927 | Ga0070664_1002209272 | 258 |
| 334 | 3300005614 | Ga0068856_100190786 | Ga0068856_1001907862 | 258 |
| 335 | 3300005616 | Ga0068852_100081166 | Ga0068852_1000811662 | 258 |
| 336 | 3300009093 | Ga0105240_10012433 | Ga0105240_100124339 | 258 |
| 337 | 3300009545 | Ga0105237_10019403 | Ga0105237_100194035 | 258 |
| 338 | 3300009551 | Ga0105238_10213466 | Ga0105238_102134662 | 258 |
| 339 | 3300010375 | Ga0105239_10014066 | Ga0105239_100140664 | 258 |
| 340 | 3300025225 | Ga0209566_100307 | Ga0209566_10030718 | 258 |
| 341 | 3300025228 | Ga0209672_100015 | Ga0209672_100015233 | 258 |
| 342 | 3300025228 | Ga0209672_100031 | Ga0209672_100031292 | 258 |
| 343 | 3300025229 | Ga0209147_100016 | Ga0209147_100016231 | 258 |
| 344 | 3300025229 | Ga0209147_100503 | Ga0209147_10050317 | 258 |
| 345 | 3300025229 | Ga0209147_100611 | Ga0209147_10061112 | 258 |
| 346 | 3300025242 | Ga0209258_100026 | Ga0209258_100026233 | 258 |
| 347 | 3300025242 | Ga0209258_100774 | Ga0209258_1007746 | 258 |
| 348 | 3300025254 | Ga0209148_1000070 | Ga0209148_10000706 | 258 |
| 349 | 3300025254 | Ga0209148_1001109 | Ga0209148_10011094 | 258 |
| 350 | 3300025263 | Ga0209565_1004340 | Ga0209565_10043404 | 258 |
| 351 | 3300025272 | Ga0209455_1000069 | Ga0209455_1000069272 | 258 |
| 352 | 3300025272 | Ga0209455_1005672 | Ga0209455_10056722 | 258 |
| 353 | 3300025273 | Ga0209673_1000028 | Ga0209673_1000028311 | 258 |
| 354 | 3300025904 | Ga0207647_10003311 | Ga0207647_1000331111 | 258 |
| 355 | 3300025909 | Ga0207705_10044905 | Ga0207705_100449053 | 258 |
| 356 | 3300025913 | Ga0207695_10031137 | Ga0207695_100311372 | 258 |
| 357 | 3300025914 | Ga0207671_10052985 | Ga0207671_100529853 | 258 |
| 358 | 3300025919 | Ga0207657_10000012 | Ga0207657_1000001226 | 258 |
| 359 | 3300025932 | Ga0207690_10000008 | Ga0207690_10000008196 | 258 |
| 360 | 3300025949 | Ga0207667_10334758 | Ga0207667_103347582 | 258 |
| 361 | 3300026067 | Ga0207678_10001382 | Ga0207678_100013829 | 258 |
| 362 | 3300026142 | Ga0207698_10007664 | Ga0207698_100076645 | 258 |
| 363 | 3300027312 | Ga0209371_1000670 | Ga0209371_100067012 | 258 |
| 364 | 3300030500 | Ga0268256_1000567 | Ga0268256_100056712 | 258 |
| 365 | 3300039437 | Ga0436365_1156792 | Ga0436365_1156792_919_1728 | 258 |
| 366 | 3300045976 | Ga0466967_0622360 | Ga0466967_0622360_201_1031 | 258 |
| 367 | 3300046557 | Ga0495622_0000140 | Ga0495622_0000140_8253_9083 | 258 |
| 368 | 3300046690 | Ga0495624_0025826 | Ga0495624_0025826_1141_1971 | 258 |
| 369 | 3300003771 | Ga0055526_1014101 | Ga0055526_10141013 | 259 |
| 370 | 3300003775 | Ga0055524_1007937 | Ga0055524_10079372 | 259 |
| 371 | 3300025291 | Ga0209675_1009780 | Ga0209675_10097802 | 259 |
| 372 | 3300025294 | Ga0209025_1010269 | Ga0209025_10102692 | 259 |
| 373 | 3300025295 | Ga0209564_1000615 | Ga0209564_100061552 | 259 |
| 374 | 3300025299 | Ga0209256_1000386 | Ga0209256_100038625 | 259 |
| 375 | 3300025303 | Ga0209051_1008382 | Ga0209051_10083824 | 259 |
| 376 | 3300027666 | Ga0209282_1000156 | Ga0209282_100015618 | 259 |
| 377 | 3300046474 | Ga0495605_0006271 | Ga0495605_0006271_2846_3673 | 259 |
| 378 | 3300046500 | Ga0495596_0000157 | Ga0495596_0000157_31523_32350 | 259 |
| 379 | 3300046512 | Ga0495610_0000623 | Ga0495610_0000623_31524_32351 | 259 |
| 380 | 3300046513 | Ga0495616_0006731 | Ga0495616_0006731_3470_4297 | 259 |
| 381 | 3300046524 | Ga0495648_0138951 | Ga0495648_0138951_425_1252 | 259 |
| 382 | 3300046538 | Ga0495609_0002254 | Ga0495609_0002254_8554_9381 | 259 |
| 383 | 3300046665 | Ga0495661_0007417 | Ga0495661_0007417_6064_6891 | 259 |
| 384 | 3300046692 | Ga0495671_0000232 | Ga0495671_0000232_44553_45380 | 259 |
| 385 | 3300046794 | Ga0495589_0047006 | Ga0495589_0047006_1224_2051 | 259 |
| 386 | 3300047320 | Ga0495672_0027948 | Ga0495672_0027948_251_1078 | 259 |
| 387 | 3300047447 | Ga0495685_005621 | Ga0495685_005621_2107_2934 | 259 |
| 388 | 3300047469 | Ga0495673_0051139 | Ga0495673_0051139_966_1793 | 259 |
| 389 | 3300048924 | Ga0496121_0006443 | Ga0496121_0006443_11059_11886 | 259 |
| 390 | 3300048925 | Ga0496122_0002377 | Ga0496122_0002377_23496_24323 | 259 |
| 391 | 3300048926 | Ga0496123_0000963 | Ga0496123_0000963_40860_41687 | 259 |
| 392 | iso_pu_bacteria | 2510065045 | 2510248666 | 259 |
| 393 | iso_pu_bacteria | 2512047030 | 2512349225 | 259 |
| 394 | iso_pu_bacteria | 2515154122 | 2515680092 | 259 |
| 395 | iso_pu_bacteria | 2718217991 | 2719642908 | 259 |
| 396 | iso_pu_bacteria | 2842324504 | 2842326641 | 259 |
| 397 | iso_pu_bacteria | 2842348783 | 2842350245 | 259 |
| 398 | iso_pu_bacteria | 2842454564 | 2842455894 | 259 |
| 399 | iso_pu_bacteria | 2900634093 | 2900638639 | 259 |
| 400 | iso_pu_bacteria | 2902682994 | 2902688063 | 259 |
| 401 | iso_pu_bacteria | 642555113 | 642615391 | 259 |
| 402 | 3300005327 | Ga0070658_10008169 | Ga0070658_100081693 | 260 |
| 403 | 3300005563 | Ga0068855_100014409 | Ga0068855_1000144093 | 260 |
| 404 | 3300009093 | Ga0105240_10129030 | Ga0105240_101290304 | 260 |
| 405 | 3300025909 | Ga0207705_10001880 | Ga0207705_1000188012 | 260 |
| 406 | 3300025913 | Ga0207695_10118654 | Ga0207695_101186543 | 260 |
| 407 | 3300025949 | Ga0207667_10009108 | Ga0207667_100091087 | 260 |
| 408 | 3300047673 | Ga0495593_0041848 | Ga0495593_0041848_1279_2112 | 260 |
| 409 | iso_pu_bacteria | 2791355137 | 2792837983 | 260 |
| 410 | iso_pu_bacteria | 2818991450 | 2819619383 | 260 |
| 411 | iso_pu_bacteria | 2928108538 | 2928111594 | 260 |
| 412 | iso_pu_bacteria | 2928135762 | 2928138396 | 260 |
| 413 | iso_pu_bacteria | 2928503688 | 2928504795 | 260 |
| 414 | 3300003187 | JGI25151J46595_10001559 | JGI25151J46595_1000155913 | 261 |
| 415 | 3300003354 | JGI25160J50197_1000891 | JGI25160J50197_10008915 | 261 |
| 416 | 3300003771 | Ga0055526_1014140 | Ga0055526_10141403 | 261 |
| 417 | 3300003781 | Ga0055536_1000151 | Ga0055536_10001518 | 261 |
| 418 | 3300003784 | Ga0055534_1000430 | Ga0055534_10004309 | 261 |
| 419 | 3300005262 | Ga0065165_1003328 | Ga0065165_10033285 | 261 |
| 420 | 3300005327 | Ga0070658_10132222 | Ga0070658_101322222 | 261 |
| 421 | 3300005339 | Ga0070660_100113586 | Ga0070660_1001135862 | 261 |
| 422 | 3300005353 | Ga0070669_100490953 | Ga0070669_1004909531 | 261 |
| 423 | 3300005455 | Ga0070663_100091781 | Ga0070663_1000917812 | 261 |
| 424 | 3300009011 | Ga0105251_10018195 | Ga0105251_100181953 | 261 |
| 425 | 3300009093 | Ga0105240_10054386 | Ga0105240_100543863 | 261 |
| 426 | 3300009545 | Ga0105237_10006678 | Ga0105237_100066787 | 261 |
| 427 | 3300009551 | Ga0105238_10205122 | Ga0105238_102051222 | 261 |
| 428 | 3300009553 | Ga0105249_10400139 | Ga0105249_104001392 | 261 |
| 429 | 3300010375 | Ga0105239_10011331 | Ga0105239_100113314 | 261 |
| 430 | 3300013104 | Ga0157370_10011490 | Ga0157370_100114904 | 261 |
| 431 | 3300013105 | Ga0157369_10003434 | Ga0157369_100034349 | 261 |
| 432 | 3300013105 | Ga0157369_10014340 | Ga0157369_100143402 | 261 |
| 433 | 3300013297 | Ga0157378_10388832 | Ga0157378_103888322 | 261 |
| 434 | 3300013306 | Ga0163162_10001260 | Ga0163162_1000126010 | 261 |
| 435 | 3300013307 | Ga0157372_10039719 | Ga0157372_100397192 | 261 |
| 436 | 3300013308 | Ga0157375_10032502 | Ga0157375_100325022 | 261 |
| 437 | 3300025284 | Ga0209130_1006892 | Ga0209130_10068922 | 261 |
| 438 | 3300025291 | Ga0209675_1000040 | Ga0209675_1000040143 | 261 |
| 439 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014510 | 261 |
| 440 | 3300025294 | Ga0209025_1000092 | Ga0209025_1000092144 | 261 |
| 441 | 3300025295 | Ga0209564_1000159 | Ga0209564_10001593 | 261 |
| 442 | 3300025302 | Ga0207426_1000180 | Ga0207426_1000180142 | 261 |
| 443 | 3300025903 | Ga0207680_10040799 | Ga0207680_100407993 | 261 |
| 444 | 3300025904 | Ga0207647_10000977 | Ga0207647_1000097718 | 261 |
| 445 | 3300025913 | Ga0207695_10071675 | Ga0207695_100716753 | 261 |
| 446 | 3300025914 | Ga0207671_10023359 | Ga0207671_100233594 | 261 |
| 447 | 3300025919 | Ga0207657_10157219 | Ga0207657_101572192 | 261 |
| 448 | 3300025923 | Ga0207681_10441913 | Ga0207681_104419132 | 261 |
| 449 | 3300025927 | Ga0207687_10301751 | Ga0207687_103017512 | 261 |
| 450 | 3300025949 | Ga0207667_10009509 | Ga0207667_100095096 | 261 |
| 451 | 3300025972 | Ga0207668_10093997 | Ga0207668_100939972 | 261 |
| 452 | 3300042005 | Ga0439448_0000018 | Ga0439448_0000018_11330_12166 | 261 |
| 453 | 3300046455 | Ga0495603_0002366 | Ga0495603_0002366_7467_8291 | 261 |
| 454 | 3300046459 | Ga0495629_0000247 | Ga0495629_0000247_38917_39741 | 261 |
| 455 | 3300046460 | Ga0495638_0000976 | Ga0495638_0000976_27823_28650 | 261 |
| 456 | 3300046462 | Ga0495651_0080039 | Ga0495651_0080039_753_1559 | 261 |
| 457 | 3300046471 | Ga0495650_0000554 | Ga0495650_0000554_34332_35156 | 261 |
| 458 | 3300046472 | Ga0495580_0001335 | Ga0495580_0001335_4902_5708 | 261 |
| 459 | 3300046472 | Ga0495580_0027655 | Ga0495580_0027655_128_952 | 261 |
| 460 | 3300046474 | Ga0495605_0001989 | Ga0495605_0001989_11096_11923 | 261 |
| 461 | 3300046477 | Ga0495664_0080606 | Ga0495664_0080606_460_1284 | 261 |
| 462 | 3300046500 | Ga0495596_0112912 | Ga0495596_0112912_123_947 | 261 |
| 463 | 3300046506 | Ga0495583_0054868 | Ga0495583_0054868_534_1358 | 261 |
| 464 | 3300046507 | Ga0495606_0009209 | Ga0495606_0009209_5955_6779 | 261 |
| 465 | 3300046507 | Ga0495606_0068135 | Ga0495606_0068135_1215_2039 | 261 |
| 466 | 3300046517 | Ga0495630_0010361 | Ga0495630_0010361_4763_5569 | 261 |
| 467 | 3300046526 | Ga0495666_0002384 | Ga0495666_0002384_3701_4507 | 261 |
| 468 | 3300046529 | Ga0495652_0052543 | Ga0495652_0052543_1258_2064 | 261 |
| 469 | 3300046529 | Ga0495652_0174517 | Ga0495652_0174517_542_1366 | 261 |
| 470 | 3300046530 | Ga0495654_0180202 | Ga0495654_0180202_27_851 | 261 |
| 471 | 3300046543 | Ga0495645_0043274 | Ga0495645_0043274_1945_2769 | 261 |
| 472 | 3300046559 | Ga0495667_0175210 | Ga0495667_0175210_169_993 | 261 |
| 473 | 3300046678 | Ga0495599_0016332 | Ga0495599_0016332_2417_3223 | 261 |
| 474 | 3300046680 | Ga0495646_0035805 | Ga0495646_0035805_1260_2066 | 261 |
| 475 | 3300046684 | Ga0495669_0000883 | Ga0495669_0000883_5997_6824 | 261 |
| 476 | 3300046690 | Ga0495624_0000346 | Ga0495624_0000346_21991_22797 | 261 |
| 477 | 3300046691 | Ga0495670_0092625 | Ga0495670_0092625_47_871 | 261 |
| 478 | 3300046694 | Ga0495649_0006145 | Ga0495649_0006145_658_1482 | 261 |
| 479 | 3300046794 | Ga0495589_0002642 | Ga0495589_0002642_3118_3945 | 261 |
| 480 | 3300046794 | Ga0495589_0063341 | Ga0495589_0063341_777_1601 | 261 |
| 481 | 3300046794 | Ga0495589_0116085 | Ga0495589_0116085_21_845 | 261 |
| 482 | 3300047315 | Ga0495581_0003043 | Ga0495581_0003043_113_937 | 261 |
| 483 | 3300047322 | Ga0495680_0138733 | Ga0495680_0138733_339_1145 | 261 |
| 484 | 3300047443 | Ga0495687_009463 | Ga0495687_009463_2503_3327 | 261 |
| 485 | 3300047446 | Ga0495679_039979 | Ga0495679_039979_624_1448 | 261 |
| 486 | 3300047446 | Ga0495679_075105 | Ga0495679_075105_33_860 | 261 |
| 487 | 3300047673 | Ga0495593_0026354 | Ga0495593_0026354_2251_3075 | 261 |
| 488 | 3300048903 | Ga0496100_0000313 | Ga0496100_0000313_19253_20107 | 261 |
| 489 | 3300048904 | Ga0496101_0001365 | Ga0496101_0001365_2458_3312 | 261 |
| 490 | 3300048904 | Ga0496101_0013371 | Ga0496101_0013371_2236_3060 | 261 |
| 491 | 3300048905 | Ga0496102_0002592 | Ga0496102_0002592_2190_3044 | 261 |
| 492 | 3300048906 | Ga0496103_0000841 | Ga0496103_0000841_12381_13235 | 261 |
| 493 | 3300048906 | Ga0496103_0123442 | Ga0496103_0123442_80_907 | 261 |
| 494 | 3300048908 | Ga0496105_0242575 | Ga0496105_0242575_426_1253 | 261 |
| 495 | 3300048909 | Ga0496106_0000025 | Ga0496106_0000025_82416_83264 | 261 |
| 496 | 3300048909 | Ga0496106_0081767 | Ga0496106_0081767_343_1170 | 261 |
| 497 | 3300048910 | Ga0496107_0117505 | Ga0496107_0117505_270_1097 | 261 |
| 498 | 3300048913 | Ga0496110_0610431 | Ga0496110_0610431_131_955 | 261 |
| 499 | 3300048917 | Ga0496114_0018555 | Ga0496114_0018555_2316_3140 | 261 |
| 500 | 3300048918 | Ga0496115_0055943 | Ga0496115_0055943_2310_3134 | 261 |
| 501 | 3300048918 | Ga0496115_0185087 | Ga0496115_0185087_181_1008 | 261 |
| 502 | 3300048920 | Ga0496117_0001465 | Ga0496117_0001465_20682_21536 | 261 |
| 503 | 3300048921 | Ga0496118_0001565 | Ga0496118_0001565_12418_13272 | 261 |
| 504 | 3300048924 | Ga0496121_0001850 | Ga0496121_0001850_12431_13285 | 261 |
| 505 | 3300048929 | Ga0496126_0002361 | Ga0496126_0002361_4923_5729 | 261 |
| 506 | iso_pu_bacteria | 2513237166 | 2514051927 | 261 |
| 507 | iso_pu_bacteria | 2562617112 | 2563058510 | 261 |
| 508 | iso_pu_bacteria | 2711768613 | 2713474952 | 261 |
| 509 | iso_pu_bacteria | 2921643360 | 2921653393 | 261 |
| 510 | iso_pu_bacteria | 642555112 | 642595643 | 261 |
| 511 | 3300003320 | rootH2_10030674 | rootH2_100306742 | 262 |
| 512 | 3300003322 | rootL2_10043099 | rootL2_100430992 | 262 |
| 513 | 3300003322 | rootL2_10052145 | rootL2_100521453 | 262 |
| 514 | 3300009177 | Ga0105248_10526183 | Ga0105248_105261832 | 262 |
| 515 | 3300013105 | Ga0157369_10000093 | Ga0157369_10000093105 | 262 |
| 516 | 3300020081 | Ga0206354_11101660 | Ga0206354_111016604 | 262 |
| 517 | 3300022467 | Ga0224712_10000105 | Ga0224712_100001053 | 262 |
| 518 | 3300025295 | Ga0209564_1033396 | Ga0209564_10333962 | 262 |
| 519 | 3300025941 | Ga0207711_10374484 | Ga0207711_103744842 | 262 |
| 520 | 3300031548 | Ga0307408_100024560 | Ga0307408_1000245603 | 262 |
| 521 | 3300037312 | Ga0395899_0000023 | Ga0395899_0000023_160772_161584 | 262 |
| 522 | 3300037312 | Ga0395899_0016219 | Ga0395899_0016219_561_1385 | 262 |
| 523 | 3300037418 | Ga0395900_0000019 | Ga0395900_0000019_205576_206388 | 262 |
| 524 | 3300037418 | Ga0395900_0216086 | Ga0395900_0216086_173_985 | 262 |
| 525 | 3300037466 | Ga0395898_0000016 | Ga0395898_0000016_200725_201537 | 262 |
| 526 | 3300037466 | Ga0395898_0012589 | Ga0395898_0012589_2890_3702 | 262 |
| 527 | 3300038443 | Ga0395901_0000326 | Ga0395901_0000326_9596_10408 | 262 |
| 528 | 3300045836 | Ga0466958_0005081 | Ga0466958_0005081_2045_2869 | 262 |
| 529 | 3300046455 | Ga0495603_0031577 | Ga0495603_0031577_1815_2669 | 262 |
| 530 | 3300046472 | Ga0495580_0002997 | Ga0495580_0002997_11990_12844 | 262 |
| 531 | 3300046506 | Ga0495583_0020605 | Ga0495583_0020605_1663_2517 | 262 |
| 532 | 3300046513 | Ga0495616_0025441 | Ga0495616_0025441_1765_2619 | 262 |
| 533 | 3300046524 | Ga0495648_0017371 | Ga0495648_0017371_4127_4981 | 262 |
| 534 | 3300046531 | Ga0495665_0005589 | Ga0495665_0005589_3953_4807 | 262 |
| 535 | 3300046557 | Ga0495622_0010112 | Ga0495622_0010112_1672_2526 | 262 |
| 536 | 3300047319 | Ga0495674_0007070 | Ga0495674_0007070_7874_8728 | 262 |
| 537 | 3300047320 | Ga0495672_0042048 | Ga0495672_0042048_983_1837 | 262 |
| 538 | 3300047472 | Ga0495686_0041119 | Ga0495686_0041119_1310_2128 | 262 |
| 539 | 3300048904 | Ga0496101_0132837 | Ga0496101_0132837_964_1818 | 262 |
| 540 | 3300048906 | Ga0496103_0097569 | Ga0496103_0097569_841_1695 | 262 |
| 541 | 3300048908 | Ga0496105_0023742 | Ga0496105_0023742_2165_3019 | 262 |
| 542 | 3300048910 | Ga0496107_0026960 | Ga0496107_0026960_1952_2806 | 262 |
| 543 | 3300048916 | Ga0496113_0000580 | Ga0496113_0000580_15609_16463 | 262 |
| 544 | 3300048923 | Ga0496120_0062677 | Ga0496120_0062677_567_1421 | 262 |
| 545 | 3300048924 | Ga0496121_0027364 | Ga0496121_0027364_1966_2820 | 262 |
| 546 | 3300048924 | Ga0496121_0094864 | Ga0496121_0094864_1047_1865 | 262 |
| 547 | 3300049460 | Ga0495682_0021538 | Ga0495682_0021538_736_1590 | 262 |
| 548 | 3300002705 | JGI25156J39149_1000388 | JGI25156J39149_10003883 | 263 |
| 549 | 3300025256 | Ga0209759_1000094 | Ga0209759_10000947 | 263 |
| 550 | 3300046457 | Ga0495590_0002819 | Ga0495590_0002819_106_918 | 263 |
| 551 | 3300046459 | Ga0495629_0000704 | Ga0495629_0000704_8392_9204 | 263 |
| 552 | 3300046460 | Ga0495638_0022862 | Ga0495638_0022862_1444_2256 | 263 |
| 553 | 3300046463 | Ga0495653_0001472 | Ga0495653_0001472_6565_7377 | 263 |
| 554 | 3300046471 | Ga0495650_0002743 | Ga0495650_0002743_7786_8598 | 263 |
| 555 | 3300046472 | Ga0495580_0015765 | Ga0495580_0015765_106_918 | 263 |
| 556 | 3300046472 | Ga0495580_0323732 | Ga0495580_0323732_106_918 | 263 |
| 557 | 3300046500 | Ga0495596_0017129 | Ga0495596_0017129_116_928 | 263 |
| 558 | 3300046506 | Ga0495583_0006948 | Ga0495583_0006948_5066_5878 | 263 |
| 559 | 3300046515 | Ga0495620_0007184 | Ga0495620_0007184_574_1386 | 263 |
| 560 | 3300046516 | Ga0495628_0014740 | Ga0495628_0014740_4128_4940 | 263 |
| 561 | 3300046517 | Ga0495630_0027150 | Ga0495630_0027150_2109_2921 | 263 |
| 562 | 3300046519 | Ga0495632_0039935 | Ga0495632_0039935_582_1394 | 263 |
| 563 | 3300046526 | Ga0495666_0029908 | Ga0495666_0029908_366_1178 | 263 |
| 564 | 3300046531 | Ga0495665_0014770 | Ga0495665_0014770_1371_2183 | 263 |
| 565 | 3300046538 | Ga0495609_0009119 | Ga0495609_0009119_3686_4498 | 263 |
| 566 | 3300046648 | Ga0495611_0031044 | Ga0495611_0031044_1424_2236 | 263 |
| 567 | 3300046665 | Ga0495661_0026177 | Ga0495661_0026177_1297_2109 | 263 |
| 568 | 3300046680 | Ga0495646_0006405 | Ga0495646_0006405_4740_5552 | 263 |
| 569 | 3300046690 | Ga0495624_0101474 | Ga0495624_0101474_305_1117 | 263 |
| 570 | 3300046690 | Ga0495624_0101484 | Ga0495624_0101484_305_1117 | 263 |
| 571 | 3300046692 | Ga0495671_0025069 | Ga0495671_0025069_863_1675 | 263 |
| 572 | 3300047319 | Ga0495674_0027093 | Ga0495674_0027093_4003_4815 | 263 |
| 573 | 3300047319 | Ga0495674_0158665 | Ga0495674_0158665_427_1239 | 263 |
| 574 | 3300047320 | Ga0495672_0095199 | Ga0495672_0095199_66_878 | 263 |
| 575 | 3300047321 | Ga0495676_0187349 | Ga0495676_0187349_520_1332 | 263 |
| 576 | 3300047443 | Ga0495687_034369 | Ga0495687_034369_1394_2206 | 263 |
| 577 | 3300047446 | Ga0495679_000117 | Ga0495679_000117_61967_62779 | 263 |
| 578 | 3300047472 | Ga0495686_0128544 | Ga0495686_0128544_237_1049 | 263 |
| 579 | 3300047673 | Ga0495593_0094536 | Ga0495593_0094536_557_1369 | 263 |
| 580 | 3300048921 | Ga0496118_0030359 | Ga0496118_0030359_1988_2800 | 263 |
| 581 | 3300048924 | Ga0496121_0031945 | Ga0496121_0031945_1094_1906 | 263 |
| 582 | iso_pu_bacteria | 2513237151 | 2513958275 | 263 |
| 583 | iso_pu_bacteria | 2857357740 | 2857367849 | 263 |
| 584 | 3300001989 | JGI24739J22299_10000666 | JGI24739J22299_100006669 | 264 |
| 585 | 3300005616 | Ga0068852_100289365 | Ga0068852_1002893652 | 264 |
| 586 | 3300009011 | Ga0105251_10001186 | Ga0105251_100011869 | 264 |
| 587 | 3300013102 | Ga0157371_10008061 | Ga0157371_100080615 | 264 |
| 588 | 3300013105 | Ga0157369_10000084 | Ga0157369_1000008454 | 264 |
| 589 | 3300015262 | Ga0182007_10000198 | Ga0182007_1000019835 | 264 |
| 590 | 3300020081 | Ga0206354_11661290 | Ga0206354_116612902 | 264 |
| 591 | 3300025735 | Ga0207713_1000590 | Ga0207713_100059019 | 264 |
| 592 | 3300037418 | Ga0395900_0000182 | Ga0395900_0000182_53504_54346 | 264 |
| 593 | 3300037466 | Ga0395898_0001753 | Ga0395898_0001753_5688_6518 | 264 |
| 594 | 3300037466 | Ga0395898_0006217 | Ga0395898_0006217_6336_7166 | 264 |
| 595 | 3300037471 | Ga0395905_0000004 | Ga0395905_0000004_530651_531520 | 264 |
| 596 | 3300038443 | Ga0395901_0000040 | Ga0395901_0000040_109424_110254 | 264 |
| 597 | 3300038443 | Ga0395901_0029069 | Ga0395901_0029069_1148_1978 | 264 |
| 598 | 3300044656 | Ga0466969_0001035 | Ga0466969_0001035_9838_10707 | 264 |
| 599 | 3300044659 | Ga0466973_0031288 | Ga0466973_0031288_1464_2333 | 264 |
| 600 | 3300044683 | Ga0466965_0001868 | Ga0466965_0001868_7676_8545 | 264 |
| 601 | 3300044684 | Ga0466966_0001688 | Ga0466966_0001688_5873_6703 | 264 |
| 602 | 3300044684 | Ga0466966_0017560 | Ga0466966_0017560_3132_4001 | 264 |
| 603 | 3300044693 | Ga0466961_0000909 | Ga0466961_0000909_15172_16041 | 264 |
| 604 | 3300044693 | Ga0466961_0254238 | Ga0466961_0254238_76_939 | 264 |
| 605 | 3300044694 | Ga0466963_0002294 | Ga0466963_0002294_9739_10569 | 264 |
| 606 | 3300044765 | Ga0466970_0023727 | Ga0466970_0023727_2263_3132 | 264 |
| 607 | 3300044842 | Ga0466957_0006925 | Ga0466957_0006925_3519_4349 | 264 |
| 608 | 3300046459 | Ga0495629_0002464 | Ga0495629_0002464_1120_1935 | 264 |
| 609 | 3300046461 | Ga0495641_0019953 | Ga0495641_0019953_1051_1866 | 264 |
| 610 | 3300046463 | Ga0495653_0002197 | Ga0495653_0002197_10330_11145 | 264 |
| 611 | 3300046472 | Ga0495580_0000008 | Ga0495580_0000008_14646_15461 | 264 |
| 612 | 3300046473 | Ga0495582_0000202 | Ga0495582_0000202_15459_16274 | 264 |
| 613 | 3300046477 | Ga0495664_0000389 | Ga0495664_0000389_11281_12096 | 264 |
| 614 | 3300046514 | Ga0495618_0002329 | Ga0495618_0002329_7767_8582 | 264 |
| 615 | 3300046516 | Ga0495628_0002415 | Ga0495628_0002415_1552_2367 | 264 |
| 616 | 3300046516 | Ga0495628_0159434 | Ga0495628_0159434_813_1628 | 264 |
| 617 | 3300046517 | Ga0495630_0001539 | Ga0495630_0001539_1836_2651 | 264 |
| 618 | 3300046524 | Ga0495648_0018461 | Ga0495648_0018461_575_1390 | 264 |
| 619 | 3300046526 | Ga0495666_0000247 | Ga0495666_0000247_9390_10205 | 264 |
| 620 | 3300046529 | Ga0495652_0034838 | Ga0495652_0034838_156_971 | 264 |
| 621 | 3300046531 | Ga0495665_0049906 | Ga0495665_0049906_156_971 | 264 |
| 622 | 3300046535 | Ga0495586_0019721 | Ga0495586_0019721_1120_1935 | 264 |
| 623 | 3300046536 | Ga0495587_0004211 | Ga0495587_0004211_2253_3068 | 264 |
| 624 | 3300046543 | Ga0495645_0000886 | Ga0495645_0000886_14844_15659 | 264 |
| 625 | 3300046663 | Ga0495635_0002465 | Ga0495635_0002465_10060_10875 | 264 |
| 626 | 3300046665 | Ga0495661_0003608 | Ga0495661_0003608_9389_10204 | 264 |
| 627 | 3300046680 | Ga0495646_0003240 | Ga0495646_0003240_28_843 | 264 |
| 628 | 3300046689 | Ga0495613_0048748 | Ga0495613_0048748_1193_2008 | 264 |
| 629 | 3300047315 | Ga0495581_0000497 | Ga0495581_0000497_6452_7267 | 264 |
| 630 | 3300047317 | Ga0495604_0119590 | Ga0495604_0119590_756_1571 | 264 |
| 631 | 3300047319 | Ga0495674_0020471 | Ga0495674_0020471_4249_5064 | 264 |
| 632 | 3300047319 | Ga0495674_0040987 | Ga0495674_0040987_2076_2891 | 264 |
| 633 | 3300047320 | Ga0495672_0122473 | Ga0495672_0122473_101_916 | 264 |
| 634 | 3300047321 | Ga0495676_0003897 | Ga0495676_0003897_2314_3129 | 264 |
| 635 | 3300047446 | Ga0495679_001539 | Ga0495679_001539_8911_9726 | 264 |
| 636 | 3300047471 | Ga0495684_0017358 | Ga0495684_0017358_3650_4465 | 264 |
| 637 | 3300048088 | Ga0495602_0002585 | Ga0495602_0002585_16152_16967 | 264 |
| 638 | 3300048089 | Ga0495614_0017353 | Ga0495614_0017353_1193_2008 | 264 |
| 639 | 3300048921 | Ga0496118_0003868 | Ga0496118_0003868_16901_17722 | 264 |
| 640 | 3300061719 | Ga0466962_0000511 | Ga0466962_0000511_7154_7984 | 264 |
| 641 | 3300003214 | JGI25165J46597_1001417 | JGI25165J46597_10014174 | 265 |
| 642 | 3300003756 | Ga0055533_1000094 | Ga0055533_100009444 | 265 |
| 643 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003195 | 265 |
| 644 | 3300003760 | Ga0055527_1000006 | Ga0055527_1000006260 | 265 |
| 645 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003195 | 265 |
| 646 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007195 | 265 |
| 647 | 3300003763 | Ga0055529_1000003 | Ga0055529_1000003260 | 265 |
| 648 | 3300009093 | Ga0105240_10391096 | Ga0105240_103910962 | 265 |
| 649 | 3300013105 | Ga0157369_10318274 | Ga0157369_103182742 | 265 |
| 650 | 3300025226 | Ga0209674_100025 | Ga0209674_100025190 | 265 |
| 651 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021093 | 265 |
| 652 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031093 | 265 |
| 653 | 3300025230 | Ga0209563_103475 | Ga0209563_1034754 | 265 |
| 654 | 3300025231 | Ga0207427_101251 | Ga0207427_1012516 | 265 |
| 655 | 3300025242 | Ga0209258_100005 | Ga0209258_100005735 | 265 |
| 656 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061093 | 265 |
| 657 | 3300025256 | Ga0209759_1000014 | Ga0209759_1000014262 | 265 |
| 658 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018260 | 265 |
| 659 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031093 | 265 |
| 660 | 3300025904 | Ga0207647_10044284 | Ga0207647_100442844 | 265 |
| 661 | 3300037466 | Ga0395898_0050606 | Ga0395898_0050606_2472_3323 | 265 |
| 662 | 3300038443 | Ga0395901_0692096 | Ga0395901_0692096_157_1008 | 265 |
| 663 | 3300044684 | Ga0466966_0063219 | Ga0466966_0063219_1394_2248 | 265 |
| 664 | 3300044706 | Ga0466964_0007403 | Ga0466964_0007403_2196_3050 | 265 |
| 665 | 3300044735 | Ga0466968_0041955 | Ga0466968_0041955_693_1547 | 265 |
| 666 | 3300044765 | Ga0466970_0007817 | Ga0466970_0007817_2263_3117 | 265 |
| 667 | 3300044842 | Ga0466957_0041079 | Ga0466957_0041079_801_1655 | 265 |
| 668 | 3300045836 | Ga0466958_0003557 | Ga0466958_0003557_2707_3561 | 265 |
| 669 | 3300046471 | Ga0495650_0114046 | Ga0495650_0114046_78_902 | 265 |
| 670 | 3300046472 | Ga0495580_0006979 | Ga0495580_0006979_6366_7190 | 265 |
| 671 | 3300046694 | Ga0495649_0080542 | Ga0495649_0080542_627_1460 | 265 |
| 672 | 3300047472 | Ga0495686_0054564 | Ga0495686_0054564_1530_2354 | 265 |
| 673 | 3300048919 | Ga0496116_0023149 | Ga0496116_0023149_1970_2797 | 265 |
| 674 | iso_pu_bacteria | 2508501125 | 2509126496 | 265 |
| 675 | 3300044694 | Ga0466963_0010154 | Ga0466963_0010154_2720_3577 | 266 |
| 676 | 3300044719 | Ga0466971_0036075 | Ga0466971_0036075_1014_1871 | 266 |
| 677 | 3300044842 | Ga0466957_0001477 | Ga0466957_0001477_10501_11358 | 266 |
| 678 | 3300045836 | Ga0466958_0003923 | Ga0466958_0003923_3438_4295 | 266 |
| 679 | 3300047319 | Ga0495674_0038867 | Ga0495674_0038867_1737_2558 | 266 |
| 680 | 3300061719 | Ga0466962_0126597 | Ga0466962_0126597_30_887 | 266 |
| 681 | iso_pu_bacteria | 2904483920 | 2904486850 | 266 |
| 682 | iso_pu_bacteria | 2919527303 | 2919528182 | 266 |
| 683 | 3300009011 | Ga0105251_10048349 | Ga0105251_100483492 | 267 |
| 684 | 3300048088 | Ga0495602_0006600 | Ga0495602_0006600_11073_11903 | 267 |
| 685 | 3300003756 | Ga0055533_1008302 | Ga0055533_10083022 | 268 |
| 686 | 3300016635 | Ga0183361_10003 | Ga0183361_10003401 | 268 |
| 687 | 3300025226 | Ga0209674_100144 | Ga0209674_10014472 | 268 |
| 688 | 3300025256 | Ga0209759_1000008 | Ga0209759_100000835 | 268 |
| 689 | iso_pu_bacteria | 2738541296 | 2738819350 | 268 |
| 690 | iso_pu_bacteria | 2738541298 | 2738831829 | 268 |
| 691 | iso_pu_bacteria | 2738541306 | 2738873357 | 268 |
| 692 | iso_pu_bacteria | 2738543002 | 2739184987 | 268 |
| 693 | iso_pu_bacteria | 2738543008 | 2739219956 | 268 |
| 694 | iso_pu_bacteria | 2945934425 | 2945940365 | 268 |
| 695 | iso_pu_bacteria | 2990703756 | 2990707493 | 268 |
| 696 | iso_pu_bacteria | 641736151 | 642423934 | 268 |
| 697 | 3300005539 | Ga0068853_100512113 | Ga0068853_1005121131 | 270 |
| 698 | 3300046459 | Ga0495629_0011681 | Ga0495629_0011681_1650_2483 | 270 |
| 699 | 3300046471 | Ga0495650_0006564 | Ga0495650_0006564_4711_5544 | 270 |
| 700 | 3300046477 | Ga0495664_0021180 | Ga0495664_0021180_309_1142 | 270 |
| 701 | 3300046511 | Ga0495608_0007370 | Ga0495608_0007370_2014_2847 | 270 |
| 702 | 3300046514 | Ga0495618_0002763 | Ga0495618_0002763_8244_9077 | 270 |
| 703 | 3300046516 | Ga0495628_0247585 | Ga0495628_0247585_412_1245 | 270 |
| 704 | 3300046517 | Ga0495630_0031126 | Ga0495630_0031126_2710_3543 | 270 |
| 705 | 3300046526 | Ga0495666_0012618 | Ga0495666_0012618_680_1513 | 270 |
| 706 | 3300046529 | Ga0495652_0043525 | Ga0495652_0043525_1774_2607 | 270 |
| 707 | 3300046533 | Ga0495640_0009866 | Ga0495640_0009866_2116_2949 | 270 |
| 708 | 3300046642 | Ga0495634_0018717 | Ga0495634_0018717_4008_4841 | 270 |
| 709 | 3300046663 | Ga0495635_0041278 | Ga0495635_0041278_1675_2508 | 270 |
| 710 | 3300046675 | Ga0495657_0015928 | Ga0495657_0015928_2736_3569 | 270 |
| 711 | 3300046680 | Ga0495646_0014935 | Ga0495646_0014935_1863_2696 | 270 |
| 712 | 3300046809 | Ga0495600_0006113 | Ga0495600_0006113_5694_6527 | 270 |
| 713 | 3300047315 | Ga0495581_0012929 | Ga0495581_0012929_2099_2932 | 270 |
| 714 | 3300047321 | Ga0495676_0321912 | Ga0495676_0321912_35_868 | 270 |
| 715 | 3300047322 | Ga0495680_0116517 | Ga0495680_0116517_611_1444 | 270 |
| 716 | 3300047444 | Ga0495675_0008541 | Ga0495675_0008541_5342_6175 | 270 |
| 717 | iso_pu_bacteria | 2526164713 | 2527077242 | 270 |
| 718 | iso_pu_bacteria | 8055266321 | 8055272104 | 270 |
| 719 | iso_pu_bacteria | 8055301274 | 8055304870 | 270 |
| 720 | 3300001979 | JGI24740J21852_10012066 | JGI24740J21852_100120664 | 272 |
| 721 | 3300025256 | Ga0209759_1006541 | Ga0209759_10065412 | 272 |
| 722 | 3300025919 | Ga0207657_10163893 | Ga0207657_101638932 | 272 |
| 723 | 3300026067 | Ga0207678_10035851 | Ga0207678_100358514 | 272 |
| 724 | 3300031911 | Ga0307412_10000039 | Ga0307412_1000003926 | 272 |
| 725 | 3300046500 | Ga0495596_0110299 | Ga0495596_0110299_185_1042 | 272 |
| 726 | 3300046512 | Ga0495610_0001301 | Ga0495610_0001301_19636_20493 | 272 |
| 727 | 3300046522 | Ga0495643_0028247 | Ga0495643_0028247_714_1571 | 272 |
| 728 | 3300047323 | Ga0495683_0015976 | Ga0495683_0015976_2469_3326 | 272 |
| 729 | 3300047443 | Ga0495687_042397 | Ga0495687_042397_827_1684 | 272 |
| 730 | 3300048920 | Ga0496117_0017415 | Ga0496117_0017415_942_1799 | 272 |
| 731 | 3300048921 | Ga0496118_0045149 | Ga0496118_0045149_924_1781 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7u6j-assembly3.cif.gz_C | halb with lysine and succinate | 0.827 | 23 | 229 |
| 7jsd-assembly1.cif.gz_A | hydroxylase homolog of besd with fe(ii), alpha-ketoglutarate, and lysine | 0.8184 | 24 | 227 |
| 7u6h-assembly4.cif.gz_D | hald with ornithine and alpha-ketoglutarate | 0.8029 | 24 | 234 |
| 6nie-assembly4.cif.gz_D | besd with fe(ii), chloride, and alpha-ketoglutarate | 0.7985 | 36 | 227 |
| 5ep9-assembly4.cif.gz_D | crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis | 0.7962 | 37 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ep9C00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.796 | 37 | 227 | 2.60.120.620 |
| af_Q09973_31_246_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7685 | 37 | 235 | 2.60.120.620 |
| 5epaF00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7544 | 31 | 232 | 2.60.120.620 |
| af_Q9I7H9_57_285_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7451 | 37 | 230 | 2.60.120.620 |
| af_Q8IL23_178_398_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7386 | 39 | 228 | 2.60.120.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7PAW2-F1-model_v4 | 2OG-Fe(II) oxygenase | 0.9682 | 24 | 210 |
|
| AF-A0A1Q7ADQ6-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9668 | 26 | 256 |
GO:0016491
GO:0046872 |
| AF-A0A1F7MWU2-F1-model_v4 | 2OG-Fe(II) oxygenase | 0.9641 | 23 | 194 |
|
| AF-A0A849TUS2-F1-model_v4 | 2OG-Fe(II) oxygenase | 0.9583 | 23 | 171 |
|
| AF-A0A354BKF6-F1-model_v4 | 2OG-Fe(II) oxygenase | 0.9569 | 56 | 204 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar