F477953

General Info

Members Datasets Scaffolds Average Seq Length
731 266 1462 228

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100260419|Ga0070698_1002604192
Length 266
Sequence MTLHLPGGQPGSVAKAGTAARGRARDSRRYHDITPRSVDVMNARVAIVAGAGGALGRATTAVLAAGGLTVVAVDRNERALRELPDHVRREVADTTDPAAATPLIDRIAGEVGPPEVLVNTIGAFRPGDAATTTPETLQLMIDVNLGTALWLSRAVAPYMQQQGTGVIVHVTARPGIEPSGGMAAYSTSKAALVHLTRILDIELRPHGIRVNAVAPQLLDIPANRATFPAEVMAHAVAPEAIAGVIAFLVSDAAAPVSGAILPAYGA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.14
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 6.57
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100260419 3300005471 Bacteria 1667
2 Ga0070658_10164299 3300005327 Bacteria 1864
3 Ga0070676_10305535 3300005328 Bacteria 1080
4 Ga0070683_100020631 3300005329 Bacteria 5865
5 Ga0068869_100087791 3300005334 Bacteria 2333
6 Ga0070666_10072635 3300005335 Bacteria 2342
7 Ga0070682_100224028 3300005337 Bacteria 1340
8 Ga0070682_100435392 3300005337 Bacteria 1000
9 Ga0070660_100140726 3300005339 Bacteria 1935
10 Ga0070691_10039712 3300005341 Bacteria 2223
11 Ga0070687_100037466 3300005343 Bacteria 2424
12 Ga0070661_100065335 3300005344 Bacteria 2673
13 Ga0070675_100012645 3300005354 Bacteria 6621
14 Ga0070671_100061275 3300005355 Bacteria 3133
15 Ga0070709_10000519 3300005434 Bacteria 22772
16 Ga0070709_10003556 3300005434 Bacteria 8373
17 Ga0070709_10027027 3300005434 Bacteria 3408
18 Ga0070709_10049576 3300005434 Bacteria 2626
19 Ga0070709_10292968 3300005434 Bacteria 1186
20 Ga0070709_10349897 3300005434 Bacteria 1091
21 Ga0070714_100007377 3300005435 Bacteria 8555
22 Ga0070714_100011224 3300005435 Bacteria 7104
23 Ga0070714_100020560 3300005435 Bacteria 5393
24 Ga0070714_100068935 3300005435 Bacteria 3053
25 Ga0070714_100130268 3300005435 Bacteria 2247
26 Ga0070714_100230003 3300005435 Bacteria 1708
27 Ga0070714_100299612 3300005435 Bacteria 1498
28 Ga0070714_100361788 3300005435 Bacteria 1364
29 Ga0070714_100493189 3300005435 Bacteria 1167
30 Ga0070714_100570017 3300005435 Unclassified 1085
31 Ga0070714_100595443 3300005435 Bacteria 1061
32 Ga0070714_100609994 3300005435 Bacteria 1048
33 Ga0070713_100003287 3300005436 Bacteria 10649
34 Ga0070713_100027643 3300005436 Bacteria 4468
35 Ga0070713_100049735 3300005436 Bacteria 3459
36 Ga0070713_100051364 3300005436 Bacteria 3409
37 Ga0070713_100073961 3300005436 Bacteria 2886
38 Ga0070713_100144635 3300005436 Bacteria 2109
39 Ga0070713_100218951 3300005436 Bacteria 1726
40 Ga0070713_100300186 3300005436 Bacteria 1478
41 Ga0070713_100446984 3300005436 Bacteria 1213
42 Ga0070713_100477540 3300005436 Bacteria 1174
43 Ga0070713_100546362 3300005436 Bacteria 1096
44 Ga0070713_100790301 3300005436 Bacteria 909
45 Ga0070710_10003326 3300005437 Bacteria 7630
46 Ga0070710_10005018 3300005437 Bacteria 6264
47 Ga0070710_10020819 3300005437 Bacteria 3409
48 Ga0070710_10023187 3300005437 Bacteria 3258
49 Ga0070710_10024557 3300005437 Bacteria 3181
50 Ga0070710_10042270 3300005437 Bacteria 2519
51 Ga0070710_10188133 3300005437 Bacteria 1297
52 Ga0070710_10214850 3300005437 Bacteria 1221
53 Ga0070710_10215672 3300005437 Bacteria 1218
54 Ga0070710_10237886 3300005437 Bacteria 1165
55 Ga0070710_10577714 3300005437 Bacteria 779
56 Ga0070711_100001617 3300005439 Bacteria 12437
57 Ga0070711_100018983 3300005439 Bacteria 4400
58 Ga0070711_100023028 3300005439 Bacteria 4045
59 Ga0070711_100063446 3300005439 Bacteria 2579
60 Ga0070711_100079709 3300005439 Bacteria 2329
61 Ga0070711_100111537 3300005439 Bacteria 2008
62 Ga0070711_100179689 3300005439 Bacteria 1619
63 Ga0070711_100206358 3300005439 Bacteria 1519
64 Ga0070711_100388200 3300005439 Bacteria 1130
65 Ga0070711_100447579 3300005439 Bacteria 1057
66 Ga0070711_100525591 3300005439 Bacteria 978
67 Ga0070694_100048632 3300005444 Bacteria 2853
68 Ga0070708_100040123 3300005445 Bacteria 4099
69 Ga0070708_100063046 3300005445 Bacteria 3317
70 Ga0070708_100147053 3300005445 Bacteria 2189
71 Ga0070708_100157146 3300005445 Bacteria 2118
72 Ga0070708_100434373 3300005445 Bacteria 1238
73 Ga0070663_100009043 3300005455 Bacteria 6154
74 Ga0068867_100116769 3300005459 Bacteria 2057
75 Ga0070685_10009118 3300005466 Bacteria 5120
76 Ga0070706_100011892 3300005467 Bacteria 8079
77 Ga0070706_100098408 3300005467 Bacteria 2718
78 Ga0070706_100344447 3300005467 Bacteria 1389
79 Ga0070706_100384681 3300005467 Bacteria 1306
80 Ga0070707_100071475 3300005468 Bacteria 3343
81 Ga0070707_100079023 3300005468 Bacteria 3175
82 Ga0070707_100122791 3300005468 Bacteria 2522
83 Ga0070707_100182048 3300005468 Bacteria 2048
84 Ga0070698_100003651 3300005471 Bacteria 16898
85 Ga0070698_100007107 3300005471 Bacteria 12124
86 Ga0070698_100018380 3300005471 Bacteria 7359
87 Ga0070698_100088610 3300005471 Bacteria 3079
88 Ga0070698_100095093 3300005471 Unclassified 2958
89 Ga0070698_100339772 3300005471 Bacteria 1433
90 Ga0070698_100672862 3300005471 Bacteria 977
91 Ga0070699_100001109 3300005518 Bacteria 25054
92 Ga0070699_100334504 3300005518 Bacteria 1362
93 Ga0070679_100088807 3300005530 Bacteria 3077
94 Ga0070679_100265096 3300005530 Unclassified 1673
95 Ga0070684_100061882 3300005535 Bacteria 3277
96 Ga0070684_100074897 3300005535 Bacteria 2984
97 Ga0070697_100006772 3300005536 Bacteria 8888
98 Ga0070697_100028961 3300005536 Bacteria 4438
99 Ga0070697_100062070 3300005536 Bacteria 3049
100 Ga0070672_100059725 3300005543 Bacteria 3000
101 Ga0070686_100117012 3300005544 Bacteria 1825
102 Ga0070695_100022206 3300005545 Bacteria 3890
103 Ga0070695_100187125 3300005545 Bacteria 1471
104 Ga0070696_100321015 3300005546 Bacteria 1192
105 Ga0070693_100011079 3300005547 Bacteria 4536
106 Ga0070693_100080034 3300005547 Bacteria 1946
107 Ga0070665_100346149 3300005548 Bacteria 1491
108 Ga0070704_100039219 3300005549 Bacteria 3250
109 Ga0070704_100510570 3300005549 Bacteria 1045
110 Ga0068855_100193110 3300005563 Bacteria 2295
111 Ga0068855_100228866 3300005563 Bacteria 2083
112 Ga0070664_100123436 3300005564 Bacteria 2269
113 Ga0068854_100069753 3300005578 Bacteria 2567
114 Ga0068856_100033830 3300005614 Bacteria 5005
115 Ga0068856_100254481 3300005614 Bacteria 1771
116 Ga0068856_100757388 3300005614 Bacteria 991
117 Ga0070702_100444152 3300005615 Bacteria 939
118 Ga0068864_100225622 3300005618 Bacteria 1730
119 Ga0068864_101113345 3300005618 Bacteria 786
120 Ga0068863_100743215 3300005841 Bacteria 976
121 Ga0068858_100111597 3300005842 Bacteria 2554
122 Ga0068860_100265220 3300005843 Bacteria 1675
123 Ga0081539_10014255 3300005985 Bacteria 5901
124 Ga0081539_10052386 3300005985 Bacteria 2292
125 Ga0070717_10039870 3300006028 Bacteria 3823
126 Ga0070717_10050438 3300006028 Bacteria 3420
127 Ga0070717_10053387 3300006028 Bacteria 3331
128 Ga0070717_10084127 3300006028 Bacteria 2676
129 Ga0070717_10194562 3300006028 Bacteria 1773
130 Ga0070717_10319776 3300006028 Bacteria 1382
131 Ga0070717_10327744 3300006028 Bacteria 1365
132 Ga0070717_10362417 3300006028 Bacteria 1298
133 Ga0070717_10365391 3300006028 Bacteria 1292
134 Ga0070717_10366036 3300006028 Bacteria 1291
135 Ga0070717_10458484 3300006028 Bacteria 1149
136 Ga0070717_10486574 3300006028 Bacteria 1114
137 Ga0070717_10721152 3300006028 Unclassified 906
138 Ga0070715_10046498 3300006163 Bacteria 1845
139 Ga0070716_100003362 3300006173 Bacteria 7524
140 Ga0070716_100021675 3300006173 Bacteria 3388
141 Ga0070716_100023254 3300006173 Bacteria 3284
142 Ga0070716_100023690 3300006173 Bacteria 3258
143 Ga0070716_100051410 3300006173 Bacteria 2342
144 Ga0070716_100287999 3300006173 Bacteria 1137
145 Ga0070712_100003688 3300006175 Bacteria 9439
146 Ga0070712_100005273 3300006175 Bacteria 7998
147 Ga0070712_100034961 3300006175 Bacteria 3408
148 Ga0070712_100068522 3300006175 Bacteria 2528
149 Ga0070712_100075631 3300006175 Bacteria 2422
150 Ga0070712_100149079 3300006175 Bacteria 1794
151 Ga0070712_100203652 3300006175 Bacteria 1556
152 Ga0070712_100231900 3300006175 Bacteria 1466
153 Ga0070712_100253865 3300006175 Bacteria 1406
154 Ga0070712_100383386 3300006175 Bacteria 1157
155 Ga0070712_100420371 3300006175 Bacteria 1108
156 Ga0070712_100483223 3300006175 Bacteria 1036
157 Ga0070712_100643300 3300006175 Bacteria 900
158 Ga0097621_100167706 3300006237 Bacteria 1891
159 Ga0097621_100416995 3300006237 Bacteria 1204
160 Ga0068871_100041269 3300006358 Bacteria 3699
161 Ga0075428_100258068 3300006844 Bacteria 1877
162 Ga0075433_10152520 3300006852 Bacteria 2055
163 Ga0075433_10251634 3300006852 Bacteria 1567
164 Ga0075434_100042469 3300006871 Bacteria 4507
165 Ga0075434_100046369 3300006871 Bacteria 4313
166 Ga0075434_100103875 3300006871 Bacteria 2850
167 Ga0075434_100160434 3300006871 Bacteria 2268
168 Ga0075434_100175900 3300006871 Bacteria 2160
169 Ga0075434_100211115 3300006871 Unclassified 1961
170 Ga0075434_100679968 3300006871 Unclassified 1047
171 Ga0068865_100196664 3300006881 Bacteria 1563
172 Ga0075436_100011304 3300006914 Bacteria 6124
173 Ga0075436_100438795 3300006914 Bacteria 949
174 Ga0075435_100004335 3300007076 Bacteria 9758
175 Ga0075435_100006530 3300007076 Bacteria 8249
176 Ga0075435_100105276 3300007076 Bacteria 2341
177 Ga0075435_100288048 3300007076 Bacteria 1403
178 Ga0099794_10049480 3300007265 Bacteria 2020
179 Ga0099795_10042114 3300007788 Bacteria 1629
180 Ga0099795_10044724 3300007788 Unclassified 1589
181 Ga0099795_10065244 3300007788 Bacteria 1361
182 Ga0105250_10110454 3300009092 Bacteria 1126
183 Ga0111539_10693624 3300009094 Bacteria 1185
184 Ga0105245_10203646 3300009098 Bacteria 1902
185 Ga0105247_10382607 3300009101 Bacteria 998
186 Ga0114129_10054553 3300009147 Bacteria 5603
187 Ga0114129_10103529 3300009147 Bacteria 3936
188 Ga0114129_10110025 3300009147 Bacteria 3803
189 Ga0114129_10454028 3300009147 Bacteria 1680
190 Ga0105243_10543950 3300009148 Bacteria 1108
191 Ga0105242_10017513 3300009176 Bacteria 5585
192 Ga0105248_10075506 3300009177 Bacteria 3788
193 Ga0105237_10245574 3300009545 Bacteria 1792
194 Ga0105237_10502599 3300009545 Unclassified 1219
195 Ga0105238_10413590 3300009551 Bacteria 1342
196 Ga0105249_10496445 3300009553 Bacteria 1265
197 Ga0099796_10029338 3300010159 Bacteria 1774
198 Ga0105239_10673657 3300010375 Bacteria 1182
199 Ga0157370_10129527 3300013104 Bacteria 2354
200 Ga0157370_10307545 3300013104 Bacteria 1463
201 Ga0157370_10785698 3300013104 Bacteria 867
202 Ga0157369_10162778 3300013105 Bacteria 2354
203 Ga0157369_10277498 3300013105 Bacteria 1745
204 Ga0157369_10299575 3300013105 Unclassified 1673
205 Ga0157374_10011866 3300013296 Bacteria 7559
206 Ga0157374_10108536 3300013296 Bacteria 2668
207 Ga0157374_10120997 3300013296 Bacteria 2526
208 Ga0157378_10070233 3300013297 Bacteria 3144
209 Ga0163162_10444677 3300013306 Bacteria 1428
210 Ga0157372_10529887 3300013307 Bacteria 1373
211 Ga0157372_10711908 3300013307 Bacteria 1168
212 Ga0163163_10218141 3300014325 Bacteria 1956
213 Ga0163163_10396634 3300014325 Bacteria 1438
214 Ga0157379_10168768 3300014968 Bacteria 1975
215 Ga0157376_10081231 3300014969 Unclassified 2783
216 Ga0163161_10333690 3300017792 Bacteria 1201
217 Ga0206354_10062606 3300020081 Bacteria 1717
218 Ga0207653_10006364 3300025885 Bacteria 3684
219 Ga0207653_10016302 3300025885 Bacteria 2334
220 Ga0207692_10001484 3300025898 Bacteria 8799
221 Ga0207692_10002038 3300025898 Bacteria 7708
222 Ga0207692_10005610 3300025898 Bacteria 5036
223 Ga0207692_10014954 3300025898 Bacteria 3403
224 Ga0207692_10027388 3300025898 Bacteria 2685
225 Ga0207692_10059765 3300025898 Bacteria 1969
226 Ga0207692_10103381 3300025898 Bacteria 1568
227 Ga0207692_10206214 3300025898 Bacteria 1158
228 Ga0207692_10254172 3300025898 Bacteria 1054
229 Ga0207688_10007763 3300025901 Bacteria 5842
230 Ga0207680_10399545 3300025903 Bacteria 971
231 Ga0207680_10406906 3300025903 Bacteria 962
232 Ga0207647_10077272 3300025904 Bacteria 2001
233 Ga0207685_10000265 3300025905 Bacteria 8269
234 Ga0207685_10015908 3300025905 Bacteria 2395
235 Ga0207685_10055014 3300025905 Bacteria 1552
236 Ga0207685_10168599 3300025905 Bacteria 1006
237 Ga0207699_10002179 3300025906 Bacteria 9247
238 Ga0207699_10002691 3300025906 Bacteria 8401
239 Ga0207699_10003494 3300025906 Bacteria 7500
240 Ga0207699_10008409 3300025906 Bacteria 5092
241 Ga0207699_10018567 3300025906 Bacteria 3688
242 Ga0207699_10022519 3300025906 Bacteria 3415
243 Ga0207699_10185136 3300025906 Bacteria 1402
244 Ga0207699_10256890 3300025906 Bacteria 1206
245 Ga0207643_10057441 3300025908 Bacteria 2215
246 Ga0207705_10022003 3300025909 Bacteria 4550
247 Ga0207684_10009226 3300025910 Bacteria 8720
248 Ga0207684_10053953 3300025910 Bacteria 3411
249 Ga0207684_10060888 3300025910 Bacteria 3206
250 Ga0207684_10118934 3300025910 Bacteria 2264
251 Ga0207695_10259454 3300025913 Bacteria 1636
252 Ga0207671_10057865 3300025914 Bacteria 2874
253 Ga0207671_10123046 3300025914 Bacteria 1984
254 Ga0207693_10002900 3300025915 Bacteria 14845
255 Ga0207693_10008646 3300025915 Bacteria 8331
256 Ga0207693_10017845 3300025915 Bacteria 5658
257 Ga0207693_10022280 3300025915 Bacteria 5035
258 Ga0207693_10029737 3300025915 Bacteria 4312
259 Ga0207693_10294901 3300025915 Bacteria 1270
260 Ga0207693_10355324 3300025915 Bacteria 1146
261 Ga0207693_10362719 3300025915 Bacteria 1134
262 Ga0207693_10555180 3300025915 Bacteria 895
263 Ga0207663_10003761 3300025916 Bacteria 7482
264 Ga0207663_10016851 3300025916 Bacteria 4062
265 Ga0207663_10027101 3300025916 Bacteria 3335
266 Ga0207663_10028663 3300025916 Bacteria 3261
267 Ga0207663_10051969 3300025916 Bacteria 2554
268 Ga0207663_10059419 3300025916 Bacteria 2418
269 Ga0207663_10068437 3300025916 Bacteria 2280
270 Ga0207663_10311272 3300025916 Bacteria 1180
271 Ga0207663_10350998 3300025916 Bacteria 1117
272 Ga0207663_10529284 3300025916 Bacteria 919
273 Ga0207657_10056925 3300025919 Bacteria 3372
274 Ga0207649_10110119 3300025920 Bacteria 1838
275 Ga0207646_10000056 3300025922 Bacteria 158385
276 Ga0207646_10009007 3300025922 Bacteria 9921
277 Ga0207646_10012767 3300025922 Bacteria 8056
278 Ga0207646_10038138 3300025922 Bacteria 4329
279 Ga0207646_10073878 3300025922 Bacteria 3046
280 Ga0207646_10192332 3300025922 Bacteria 1843
281 Ga0207646_10240598 3300025922 Bacteria 1635
282 Ga0207646_10561014 3300025922 Bacteria 1026
283 Ga0207694_10311225 3300025924 Bacteria 1298
284 Ga0207687_10134788 3300025927 Bacteria 1866
285 Ga0207687_10186552 3300025927 Bacteria 1611
286 Ga0207700_10002372 3300025928 Bacteria 10824
287 Ga0207700_10003978 3300025928 Bacteria 8651
288 Ga0207700_10022585 3300025928 Bacteria 4320
289 Ga0207700_10048980 3300025928 Bacteria 3140
290 Ga0207700_10053598 3300025928 Bacteria 3023
291 Ga0207700_10076018 3300025928 Bacteria 2604
292 Ga0207700_10115305 3300025928 Bacteria 2169
293 Ga0207700_10116759 3300025928 Bacteria 2157
294 Ga0207700_10128929 3300025928 Bacteria 2062
295 Ga0207700_10158551 3300025928 Bacteria 1877
296 Ga0207700_10591741 3300025928 Bacteria 987
297 Ga0207700_10664532 3300025928 Bacteria 929
298 Ga0207664_10002873 3300025929 Bacteria 11456
299 Ga0207664_10004444 3300025929 Bacteria 9497
300 Ga0207664_10013506 3300025929 Bacteria 5864
301 Ga0207664_10013555 3300025929 Bacteria 5856
302 Ga0207664_10039251 3300025929 Bacteria 3676
303 Ga0207664_10063337 3300025929 Bacteria 2955
304 Ga0207664_10092011 3300025929 Bacteria 2488
305 Ga0207664_10139898 3300025929 Bacteria 2046
306 Ga0207664_10164763 3300025929 Bacteria 1893
307 Ga0207664_10272062 3300025929 Bacteria 1484
308 Ga0207644_10173648 3300025931 Bacteria 1684
309 Ga0207686_10115091 3300025934 Bacteria 1821
310 Ga0207665_10004036 3300025939 Bacteria 9803
311 Ga0207665_10004304 3300025939 Bacteria 9459
312 Ga0207665_10004776 3300025939 Bacteria 9016
313 Ga0207665_10032360 3300025939 Bacteria 3462
314 Ga0207665_10265365 3300025939 Bacteria 1273
315 Ga0207665_10275589 3300025939 Unclassified 1250
316 Ga0207691_10057489 3300025940 Bacteria 3540
317 Ga0207711_10488054 3300025941 Bacteria 1148
318 Ga0207689_10010039 3300025942 Bacteria 8162
319 Ga0207661_10068020 3300025944 Bacteria 2899
320 Ga0207679_10047456 3300025945 Bacteria 3120
321 Ga0207667_10372292 3300025949 Bacteria 1456
322 Ga0207667_10563635 3300025949 Bacteria 1151
323 Ga0207667_10584307 3300025949 Bacteria 1127
324 Ga0207712_10347611 3300025961 Bacteria 1232
325 Ga0207712_10510257 3300025961 Bacteria 1029
326 Ga0207702_10003421 3300026078 Bacteria 14512
327 Ga0207702_10265259 3300026078 Bacteria 1618
328 Ga0207702_10403042 3300026078 Bacteria 1319
329 Ga0207641_10166411 3300026088 Bacteria 2008
330 Ga0207648_10113660 3300026089 Bacteria 2378
331 Ga0207676_10188017 3300026095 Bacteria 1815
332 Ga0207676_10615650 3300026095 Bacteria 1044
333 Ga0207674_10002514 3300026116 Bacteria 23121
334 Ga0207674_10169424 3300026116 Bacteria 2137
335 Ga0207675_100011261 3300026118 Bacteria 8375
336 Ga0207683_10003882 3300026121 Bacteria 12964
337 Ga0207428_10019154 3300027907 Bacteria 5835
338 Ga0207428_10063372 3300027907 Bacteria 2921
339 Ga0268265_10030286 3300028380 Bacteria 3896
340 Ga0268264_10117699 3300028381 Bacteria 2337
341 Ga0265326_10002763 3300028558 Bacteria 5882
342 Ga0265334_10002724 3300028573 Bacteria 8166
343 Ga0265323_10048022 3300028653 Bacteria 1525
344 Ga0307515_10000025 3300028794 Bacteria 390205
345 Ga0265338_10003321 3300028800 Bacteria 22756
346 Ga0265324_10001090 3300029957 Bacteria 16333
347 Ga0307512_10147525 3300030522 Bacteria 1418
348 Ga0307512_10148019 3300030522 Bacteria 1414
349 Ga0265332_10011997 3300031238 Bacteria 3847
350 Ga0265320_10009760 3300031240 Bacteria 5759
351 Ga0265325_10017636 3300031241 Bacteria 3967
352 Ga0265340_10002754 3300031247 Bacteria 10010
353 Ga0307509_10005795 3300031507 Bacteria 16965
354 Ga0307509_10024776 3300031507 Bacteria 6714
355 Ga0307509_10027298 3300031507 Bacteria 6352
356 Ga0307508_10044859 3300031616 Bacteria 3952
357 Ga0307514_10054033 3300031649 Bacteria 3097
358 Ga0265314_10052920 3300031711 Bacteria 2819
359 Ga0265342_10011942 3300031712 Bacteria 5903
360 Ga0307516_10020320 3300031730 Bacteria 6860
361 Ga0307518_10107206 3300031838 Bacteria 1993
362 Ga0307518_10191997 3300031838 Bacteria 1367
363 Ga0307507_10032048 3300033179 Bacteria 5500
364 Ga0307510_10031901 3300033180 Bacteria 5943
365 Ga0316214_1001741 3300033545 Bacteria 2595
366 Ga0373930_0006633 3300034816 Bacteria 1966
367 Ga0373930_0011325 3300034816 Bacteria 1609
368 Ga0373948_0016751 3300034817 Unclassified 1358
369 Ga0373948_0041943 3300034817 Unclassified 960
370 Ga0373958_0019561 3300034819 Bacteria 1239
371 Ga0373959_0005951 3300034820 Bacteria 2011
372 Ga0373959_0041693 3300034820 Bacteria 965
373 Ga0373926_0000563 3300035083 Bacteria 9979
374 Ga0373929_0053381 3300035085 Bacteria 929
375 Ga0373934_0002721 3300035086 Bacteria 6485
376 Ga0373934_0010227 3300035086 Bacteria 3521
377 Ga0373934_0071332 3300035086 Bacteria 1390
378 Ga0373934_0088389 3300035086 Bacteria 1248
379 Ga0373934_0112245 3300035086 Bacteria 1106
380 Ga0373940_0136341 3300035088 Bacteria 772
381 Ga0373944_0001459 3300035089 Bacteria 5971
382 Ga0373951_0024200 3300035091 Bacteria 1405
383 Ga0373952_0025029 3300035092 Bacteria 1286
384 Ga0373923_0000138 3300035111 Bacteria 13772
385 Ga0373923_0029016 3300035111 Bacteria 2216
386 Ga0373923_0210142 3300035111 Unclassified 902
387 Ga0373932_0035129 3300035112 Bacteria 1416
388 Ga0373932_0130883 3300035112 Bacteria 845
389 Ga0373936_0000260 3300035113 Bacteria 17309
390 Ga0373936_0014456 3300035113 Bacteria 3018
391 Ga0373936_0164002 3300035113 Bacteria 969
392 Ga0373939_0010441 3300035114 Bacteria 2322
393 Ga0373941_0048869 3300035115 Bacteria 1337
394 Ga0373945_0000382 3300035116 Bacteria 12689
395 Ga0373945_0029548 3300035116 Bacteria 1927
396 Ga0373945_0054879 3300035116 Bacteria 1474
397 Ga0373953_0040143 3300035117 Bacteria 1858
398 Ga0373953_0045145 3300035117 Bacteria 1764
399 Ga0373953_0145051 3300035117 Bacteria 1016
400 Ga0373954_0004738 3300035118 Bacteria 5864
401 Ga0373954_0066368 3300035118 Bacteria 1709
402 Ga0373954_0245910 3300035118 Unclassified 880
403 Ga0373956_0005544 3300035119 Bacteria 5047
404 Ga0373956_0040068 3300035119 Bacteria 2077
405 Ga0373956_0040069 3300035119 Bacteria 2077
406 Ga0373957_0004576 3300035120 Bacteria 4218
407 Ga0373957_0011022 3300035120 Bacteria 3005
408 Ga0373957_0048327 3300035120 Bacteria 1621
409 Ga0373960_0014084 3300035121 Bacteria 2019
410 Ga0373960_0032427 3300035121 Bacteria 1467
411 Ga0373960_0116654 3300035121 Bacteria 882
412 Ga0373943_0000338 3300035170 Bacteria 19583
413 Ga0373943_0128909 3300035170 Bacteria 1352
414 Ga0373943_0190316 3300035170 Bacteria 1131
415 Ga0373946_0000449 3300035171 Bacteria 13548
416 Ga0373946_0046455 3300035171 Bacteria 1799
417 Ga0373946_0140298 3300035171 Unclassified 1120
418 Ga0373955_0000247 3300035172 Bacteria 22475
419 Ga0373955_0005966 3300035172 Bacteria 5520
420 Ga0373955_0177934 3300035172 Bacteria 1261
421 Ga0373961_0058166 3300035241 Bacteria 1165
422 Ga0373961_0059228 3300035241 Bacteria 1157
423 Ga0373961_0069339 3300035241 Bacteria 1087
424 Ga0373962_0049264 3300035242 Bacteria 1210
425 Ga0373924_0007858 3300035410 Bacteria 3858
426 Ga0373924_0008335 3300035410 Bacteria 3762
427 Ga0373931_0011867 3300035691 Bacteria 4213
428 Ga0373931_0053170 3300035691 Bacteria 2161
429 Ga0373931_0173118 3300035691 Bacteria 1273
430 Ga0373931_0175253 3300035691 Unclassified 1266
431 Ga0373935_0002321 3300035692 Bacteria 10864
432 Ga0373935_0104689 3300035692 Bacteria 1870
433 Ga0373935_0130419 3300035692 Bacteria 1688
434 Ga0373935_0197921 3300035692 Bacteria 1387
435 Ga0373935_0204105 3300035692 Unclassified 1367
436 Ga0373935_0225374 3300035692 Bacteria 1304
437 Ga0373927_0002685 3300035695 Bacteria 12969
438 Ga0373927_0064934 3300035695 Bacteria 2361
439 Ga0373927_0257522 3300035695 Bacteria 1147
440 Ga0373933_0008868 3300035724 Bacteria 5483
441 Ga0373933_0052600 3300035724 Bacteria 2438
442 Ga0373933_0202153 3300035724 Bacteria 1271
443 Ga0373933_0325112 3300035724 Unclassified 997
444 Ga0373947_0000950 3300035725 Bacteria 17641
445 Ga0373947_0016693 3300035725 Bacteria 4219
446 Ga0373937_0022277 3300036401 Bacteria 5695
447 Ga0373937_0074449 3300036401 Bacteria 3133
448 Ga0373937_0188515 3300036401 Bacteria 1937
449 Ga0373937_0232435 3300036401 Bacteria 1736
450 Ga0373925_0002214 3300037068 Bacteria 15779
451 Ga0373925_0066728 3300037068 Unclassified 2712
452 Ga0373925_0113766 3300037068 Bacteria 2093
453 Ga0373925_0238610 3300037068 Bacteria 1455
454 Ga0373925_0262955 3300037068 Bacteria 1386
455 Ga0395898_0019149 3300037466 Bacteria 6969
456 Ga0395898_0420321 3300037466 Bacteria 1274
457 Ga0395901_0021898 3300038443 Bacteria 6551
458 Ga0395901_0842347 3300038443 Bacteria 903
459 Ga0242420_013948 3300038996 Unclassified 1374
460 Ga0495592_0004407 3300046454 Bacteria 10300
461 Ga0495592_0005094 3300046454 Bacteria 9679
462 Ga0495592_0029490 3300046454 Bacteria 4154
463 Ga0495592_0212262 3300046454 Bacteria 1299
464 Ga0495592_0337394 3300046454 Unclassified 970
465 Ga0495603_0000807 3300046455 Bacteria 17976
466 Ga0495603_0164204 3300046455 Bacteria 1288
467 Ga0495629_0003043 3300046459 Bacteria 12744
468 Ga0495629_0024282 3300046459 Bacteria 4316
469 Ga0495629_0024619 3300046459 Bacteria 4285
470 Ga0495641_0002812 3300046461 Bacteria 13463
471 Ga0495641_0017579 3300046461 Bacteria 3721
472 Ga0495641_0205926 3300046461 Bacteria 882
473 Ga0495651_0002068 3300046462 Bacteria 15476
474 Ga0495651_0003185 3300046462 Bacteria 12611
475 Ga0495651_0016723 3300046462 Bacteria 5680
476 Ga0495651_0029693 3300046462 Bacteria 4263
477 Ga0495651_0041666 3300046462 Bacteria 3566
478 Ga0495651_0113445 3300046462 Bacteria 2000
479 Ga0495651_0133021 3300046462 Bacteria 1813
480 Ga0495653_0005201 3300046463 Bacteria 10581
481 Ga0495653_0018949 3300046463 Bacteria 5585
482 Ga0495653_0020193 3300046463 Bacteria 5400
483 Ga0495653_0117354 3300046463 Bacteria 1901
484 Ga0495653_0146570 3300046463 Bacteria 1653
485 Ga0495580_0000900 3300046472 Bacteria 25880
486 Ga0495580_0373429 3300046472 Bacteria 964
487 Ga0495582_0001517 3300046473 Bacteria 13089
488 Ga0495582_0067596 3300046473 Bacteria 1975
489 Ga0495639_0002004 3300046475 Bacteria 9014
490 Ga0495639_0059348 3300046475 Bacteria 1751
491 Ga0495639_0301024 3300046475 Bacteria 800
492 Ga0495662_0000841 3300046476 Bacteria 14913
493 Ga0495662_0020363 3300046476 Bacteria 3208
494 Ga0495662_0082595 3300046476 Bacteria 1563
495 Ga0495662_0123812 3300046476 Bacteria 1270
496 Ga0495664_0005250 3300046477 Bacteria 7110
497 Ga0495664_0017309 3300046477 Bacteria 4118
498 Ga0495664_0044201 3300046477 Bacteria 2639
499 Ga0495664_0048796 3300046477 Bacteria 2513
500 Ga0495664_0137323 3300046477 Bacteria 1481
501 Ga0495594_0014289 3300046499 Bacteria 4155
502 Ga0495583_0089991 3300046506 Bacteria 1323
503 Ga0495608_0002059 3300046511 Bacteria 14472
504 Ga0495608_0004213 3300046511 Bacteria 10309
505 Ga0495608_0007093 3300046511 Bacteria 7926
506 Ga0495608_0023289 3300046511 Bacteria 4245
507 Ga0495608_0024191 3300046511 Bacteria 4155
508 Ga0495618_0002349 3300046514 Bacteria 12203
509 Ga0495618_0035706 3300046514 Bacteria 3120
510 Ga0495618_0188046 3300046514 Unclassified 1310
511 Ga0495628_0015167 3300046516 Bacteria 6437
512 Ga0495628_0017101 3300046516 Bacteria 6041
513 Ga0495628_0017671 3300046516 Bacteria 5929
514 Ga0495628_0043710 3300046516 Bacteria 3567
515 Ga0495628_0166918 3300046516 Bacteria 1670
516 Ga0495628_0234992 3300046516 Bacteria 1373
517 Ga0495630_0003797 3300046517 Bacteria 10533
518 Ga0495630_0019142 3300046517 Bacteria 5032
519 Ga0495630_0034335 3300046517 Bacteria 3788
520 Ga0495630_0122457 3300046517 Bacteria 1973
521 Ga0495630_0298528 3300046517 Bacteria 1231
522 Ga0495666_0004983 3300046526 Bacteria 6720
523 Ga0495652_0002650 3300046529 Bacteria 18240
524 Ga0495652_0007644 3300046529 Bacteria 9954
525 Ga0495652_0106784 3300046529 Bacteria 2260
526 Ga0495652_0123900 3300046529 Bacteria 2056
527 Ga0495652_0197131 3300046529 Bacteria 1531
528 Ga0495652_0279392 3300046529 Bacteria 1223
529 Ga0495665_0001060 3300046531 Bacteria 14599
530 Ga0495665_0154554 3300046531 Bacteria 1197
531 Ga0495640_0008444 3300046533 Bacteria 8077
532 Ga0495640_0035232 3300046533 Bacteria 3542
533 Ga0495640_0039115 3300046533 Unclassified 3331
534 Ga0495640_0079129 3300046533 Bacteria 2189
535 Ga0495640_0366150 3300046533 Bacteria 888
536 Ga0495586_0017689 3300046535 Bacteria 3791
537 Ga0495587_0004390 3300046536 Bacteria 9298
538 Ga0495587_0006464 3300046536 Bacteria 7637
539 Ga0495587_0007734 3300046536 Bacteria 6948
540 Ga0495587_0021862 3300046536 Bacteria 3945
541 Ga0495587_0036137 3300046536 Bacteria 2972
542 Ga0495587_0151360 3300046536 Bacteria 1322
543 Ga0495645_0004966 3300046543 Bacteria 9105
544 Ga0495645_0005579 3300046543 Bacteria 8657
545 Ga0495645_0015554 3300046543 Bacteria 5413
546 Ga0495645_0044950 3300046543 Bacteria 3221
547 Ga0495645_0096887 3300046543 Bacteria 2101
548 Ga0495645_0152117 3300046543 Bacteria 1606
549 Ga0495667_0000535 3300046559 Bacteria 24277
550 Ga0495667_0003519 3300046559 Bacteria 10510
551 Ga0495667_0006700 3300046559 Bacteria 7817
552 Ga0495667_0022592 3300046559 Bacteria 4238
553 Ga0495667_0231445 3300046559 Bacteria 1178
554 Ga0495667_0307202 3300046559 Bacteria 1004
555 Ga0495667_0355550 3300046559 Bacteria 925
556 Ga0495634_0002093 3300046642 Bacteria 16868
557 Ga0495634_0008783 3300046642 Bacteria 7491
558 Ga0495634_0059852 3300046642 Bacteria 2535
559 Ga0495634_0108400 3300046642 Bacteria 1788
560 Ga0495625_0042952 3300046660 Bacteria 3281
561 Ga0495635_0004803 3300046663 Bacteria 9397
562 Ga0495635_0011160 3300046663 Bacteria 6298
563 Ga0495635_0014678 3300046663 Bacteria 5480
564 Ga0495635_0016198 3300046663 Bacteria 5203
565 Ga0495635_0060631 3300046663 Bacteria 2599
566 Ga0495635_0076268 3300046663 Bacteria 2297
567 Ga0495635_0077629 3300046663 Bacteria 2274
568 Ga0495588_0021191 3300046674 Bacteria 3200
569 Ga0495657_0003052 3300046675 Bacteria 13857
570 Ga0495657_0003639 3300046675 Bacteria 12514
571 Ga0495657_0004393 3300046675 Bacteria 11252
572 Ga0495657_0013700 3300046675 Bacteria 5972
573 Ga0495657_0218126 3300046675 Unclassified 1157
574 Ga0495599_0008591 3300046678 Bacteria 6216
575 Ga0495599_0019855 3300046678 Bacteria 4185
576 Ga0495599_0076132 3300046678 Bacteria 2095
577 Ga0495623_0007377 3300046679 Bacteria 7138
578 Ga0495623_0010945 3300046679 Bacteria 5870
579 Ga0495623_0026213 3300046679 Bacteria 3753
580 Ga0495646_0012463 3300046680 Bacteria 5406
581 Ga0495646_0016915 3300046680 Bacteria 4630
582 Ga0495646_0018766 3300046680 Bacteria 4381
583 Ga0495646_0023331 3300046680 Bacteria 3896
584 Ga0495646_0061894 3300046680 Bacteria 2227
585 Ga0495646_0145344 3300046680 Bacteria 1322
586 Ga0495647_0092807 3300046681 Bacteria 1240
587 Ga0495647_0103195 3300046681 Bacteria 1183
588 Ga0495658_0002629 3300046683 Bacteria 9022
589 Ga0495658_0195001 3300046683 Bacteria 1261
590 Ga0495658_0259355 3300046683 Bacteria 1094
591 Ga0495613_0005707 3300046689 Bacteria 9332
592 Ga0495613_0055431 3300046689 Bacteria 2912
593 Ga0495624_0001642 3300046690 Bacteria 17151
594 Ga0495624_0080649 3300046690 Bacteria 2016
595 Ga0495624_0386267 3300046690 Bacteria 841
596 Ga0495671_0015064 3300046692 Bacteria 4151
597 Ga0495600_0002380 3300046809 Bacteria 10760
598 Ga0495600_0017431 3300046809 Bacteria 4568
599 Ga0495600_0054473 3300046809 Bacteria 2612
600 Ga0495600_0054496 3300046809 Bacteria 2612
601 Ga0495581_0000496 3300047315 Bacteria 20083
602 Ga0495581_0016685 3300047315 Bacteria 4269
603 Ga0495604_0009559 3300047317 Bacteria 7668
604 Ga0495604_0030248 3300047317 Bacteria 4302
605 Ga0495604_0030633 3300047317 Bacteria 4271
606 Ga0495636_0109717 3300047318 Bacteria 1213
607 Ga0495674_0009685 3300047319 Bacteria 9146
608 Ga0495674_0014906 3300047319 Bacteria 7273
609 Ga0495674_0026557 3300047319 Bacteria 5297
610 Ga0495674_0056522 3300047319 Bacteria 3436
611 Ga0495674_0058292 3300047319 Bacteria 3376
612 Ga0495674_0073406 3300047319 Bacteria 2949
613 Ga0495674_0102244 3300047319 Bacteria 2437
614 Ga0495674_0360174 3300047319 Bacteria 1179
615 Ga0495676_0000700 3300047321 Bacteria 27875
616 Ga0495676_0259659 3300047321 Bacteria 1182
617 Ga0495680_0001524 3300047322 Bacteria 24781
618 Ga0495680_0007765 3300047322 Bacteria 9794
619 Ga0495680_0022504 3300047322 Bacteria 5250
620 Ga0495680_0156798 3300047322 Bacteria 1655
621 Ga0495687_001618 3300047443 Bacteria 20303
622 Ga0495675_0002613 3300047444 Bacteria 10793
623 Ga0495675_0004210 3300047444 Bacteria 8706
624 Ga0495675_0009009 3300047444 Bacteria 6204
625 Ga0495675_0020655 3300047444 Bacteria 4192
626 Ga0495675_0073405 3300047444 Bacteria 2158
627 Ga0495681_0013509 3300047470 Bacteria 4732
628 Ga0495684_0000915 3300047471 Bacteria 23961
629 Ga0495684_0015546 3300047471 Bacteria 5859
630 Ga0495684_0034276 3300047471 Bacteria 3895
631 Ga0495684_0073856 3300047471 Bacteria 2590
632 Ga0495684_0098745 3300047471 Bacteria 2207
633 Ga0495684_0110704 3300047471 Bacteria 2072
634 Ga0495684_0119435 3300047471 Bacteria 1986
635 Ga0495684_0228208 3300047471 Unclassified 1363
636 Ga0495686_0026799 3300047472 Bacteria 3770
637 Ga0495593_0004441 3300047673 Bacteria 8330
638 Ga0495593_0048013 3300047673 Bacteria 2269
639 Ga0495602_0005369 3300048088 Bacteria 13451
640 Ga0495602_0071054 3300048088 Bacteria 2974
641 Ga0495602_0090441 3300048088 Bacteria 2542
642 Ga0495602_0119317 3300048088 Bacteria 2125
643 Ga0495602_0131341 3300048088 Bacteria 1997
644 Ga0495614_0001547 3300048089 Bacteria 9978
645 Ga0496100_0053451 3300048903 Bacteria 2630
646 Ga0496100_0420610 3300048903 Bacteria 1020
647 Ga0496101_0015820 3300048904 Bacteria 5091
648 Ga0496101_0115344 3300048904 Bacteria 2026
649 Ga0496101_0166700 3300048904 Bacteria 1691
650 Ga0496101_0183872 3300048904 Bacteria 1610
651 Ga0496102_0126181 3300048905 Bacteria 2392
652 Ga0496102_0187276 3300048905 Bacteria 1951
653 Ga0496104_0016301 3300048907 Bacteria 6746
654 Ga0496104_0023541 3300048907 Bacteria 5662
655 Ga0496104_0081059 3300048907 Bacteria 3094
656 Ga0496104_0087655 3300048907 Bacteria 2972
657 Ga0496105_0002382 3300048908 Bacteria 13618
658 Ga0496105_0008747 3300048908 Bacteria 7878
659 Ga0496105_0057654 3300048908 Bacteria 3206
660 Ga0496105_0139316 3300048908 Bacteria 1997
661 Ga0496105_0161660 3300048908 Bacteria 1838
662 Ga0496106_0074472 3300048909 Bacteria 2599
663 Ga0496106_0077155 3300048909 Bacteria 2554
664 Ga0496107_0133836 3300048910 Bacteria 1831
665 Ga0496107_0163054 3300048910 Unclassified 1653
666 Ga0496108_0027758 3300048911 Bacteria 4678
667 Ga0496108_0033511 3300048911 Bacteria 4267
668 Ga0496108_0035960 3300048911 Bacteria 4119
669 Ga0496108_0470150 3300048911 Bacteria 1098
670 Ga0496109_0053726 3300048912 Bacteria 3675
671 Ga0496109_0059825 3300048912 Bacteria 3480
672 Ga0496109_0093262 3300048912 Bacteria 2786
673 Ga0496109_0122305 3300048912 Bacteria 2425
674 Ga0496110_0009446 3300048913 Bacteria 7898
675 Ga0496110_0026291 3300048913 Bacteria 4978
676 Ga0496110_0075195 3300048913 Bacteria 3001
677 Ga0496110_0597873 3300048913 Bacteria 1001
678 Ga0496111_0010884 3300048914 Bacteria 6118
679 Ga0496111_0096881 3300048914 Bacteria 2165
680 Ga0496111_0100874 3300048914 Unclassified 2120
681 Ga0496112_0023220 3300048915 Bacteria 5921
682 Ga0496112_0030981 3300048915 Bacteria 5183
683 Ga0496112_0084094 3300048915 Bacteria 3147
684 Ga0496113_0010824 3300048916 Bacteria 6052
685 Ga0496113_0051788 3300048916 Bacteria 3064
686 Ga0496113_0199409 3300048916 Bacteria 1591
687 Ga0496113_0334964 3300048916 Bacteria 1213
688 Ga0496113_0367986 3300048916 Bacteria 1153
689 Ga0496114_0019457 3300048917 Bacteria 5500
690 Ga0496114_0255125 3300048917 Bacteria 1543
691 Ga0496115_0012296 3300048918 Bacteria 6437
692 Ga0496115_0054354 3300048918 Bacteria 3215
693 Ga0496126_0465835 3300048929 Bacteria 1015
694 Ga0501070_0527168 3300049586 Bacteria 947
695 nmdc:mga05p37_15272_c1 3300050507 Bacteria 9225
696 nmdc:mga05p37_36127_c1 3300050507 Bacteria 6062
697 nmdc:mga08y16_122497_c1 3300050511 Bacteria 2706
698 nmdc:mga08y16_597154_c1 3300050511 Bacteria 1113
699 nmdc:mga0n895_12070_c1 3300050512 Bacteria 7436
700 nmdc:mga0n895_132658_c1 3300050512 Bacteria 2517
701 nmdc:mga0rr50_10489_c1 3300050513 Bacteria 5881
702 nmdc:mga0rr50_162463_c1 3300050513 Bacteria 1814
703 nmdc:mga0rr50_285507_c1 3300050513 Bacteria 1378
704 nmdc:mga0rr50_291231_c1 3300050513 Bacteria 1364
705 nmdc:mga0rr50_7420_c1 3300050513 Bacteria 6763
706 nmdc:mga08x19_3432_c1 3300050514 Bacteria 9447
707 nmdc:mga08x19_79008_c1 3300050514 Bacteria 2157
708 nmdc:mga0a205_121677_c1 3300050515 Bacteria 2509
709 nmdc:mga0a205_14730_c1 3300050515 Bacteria 7296
710 nmdc:mga0a205_202254_c1 3300050515 Bacteria 1876
711 Ga0495601_0000170 3300053077 Bacteria 34639
712 Ga0495601_0010149 3300053077 Bacteria 5595
713 Ga0495601_0011922 3300053077 Bacteria 5210
714 Ga0495601_0094753 3300053077 Bacteria 1924
715 Ga0495601_0216695 3300053077 Bacteria 1250
716 Ga0495601_0500177 3300053077 Bacteria 784
717 Ga0495612_0002763 3300053078 Bacteria 7274
718 Ga0495612_0010441 3300053078 Bacteria 3756
719 Ga0495612_0062640 3300053078 Bacteria 1542
720 Ga0495612_0066327 3300053078 Bacteria 1500
721 Ga0495595_0002434 3300053084 Bacteria 7270
722 Ga0495595_0011782 3300053084 Bacteria 3663
723 Ga0495595_0052420 3300053084 Bacteria 1893
724 Ga0495595_0096431 3300053084 Bacteria 1423
725 Ga0495619_0010380 3300053085 Bacteria 5862
726 Ga0495619_0104282 3300053085 Bacteria 1932
727 Ga0495619_0151829 3300053085 Bacteria 1598
728 Ga0495619_0273579 3300053085 Bacteria 1170
729 Ga0495619_0433674 3300053085 Bacteria 906
730 Ga0500560_028337 3300053107 Bacteria 1671
731 2995469907 2995463766 Bacteria 8577691
732 Ga0070698_100260419
733 Ga0070658_10164299
734 Ga0070676_10305535
735 Ga0070683_100020631
736 Ga0068869_100087791
737 Ga0070666_10072635
738 Ga0070682_100224028
739 Ga0070682_100435392
740 Ga0070660_100140726
741 Ga0070691_10039712
742 Ga0070687_100037466
743 Ga0070661_100065335
744 Ga0070675_100012645
745 Ga0070671_100061275
746 Ga0070709_10000519
747 Ga0070709_10003556
748 Ga0070709_10027027
749 Ga0070709_10049576
750 Ga0070709_10292968
751 Ga0070709_10349897
752 Ga0070714_100007377
753 Ga0070714_100011224
754 Ga0070714_100020560
755 Ga0070714_100068935
756 Ga0070714_100130268
757 Ga0070714_100230003
758 Ga0070714_100299612
759 Ga0070714_100361788
760 Ga0070714_100493189
761 Ga0070714_100570017
762 Ga0070714_100595443
763 Ga0070714_100609994
764 Ga0070713_100003287
765 Ga0070713_100027643
766 Ga0070713_100049735
767 Ga0070713_100051364
768 Ga0070713_100073961
769 Ga0070713_100144635
770 Ga0070713_100218951
771 Ga0070713_100300186
772 Ga0070713_100446984
773 Ga0070713_100477540
774 Ga0070713_100546362
775 Ga0070713_100790301
776 Ga0070710_10003326
777 Ga0070710_10005018
778 Ga0070710_10020819
779 Ga0070710_10023187
780 Ga0070710_10024557
781 Ga0070710_10042270
782 Ga0070710_10188133
783 Ga0070710_10214850
784 Ga0070710_10215672
785 Ga0070710_10237886
786 Ga0070710_10577714
787 Ga0070711_100001617
788 Ga0070711_100018983
789 Ga0070711_100023028
790 Ga0070711_100063446
791 Ga0070711_100079709
792 Ga0070711_100111537
793 Ga0070711_100179689
794 Ga0070711_100206358
795 Ga0070711_100388200
796 Ga0070711_100447579
797 Ga0070711_100525591
798 Ga0070694_100048632
799 Ga0070708_100040123
800 Ga0070708_100063046
801 Ga0070708_100147053
802 Ga0070708_100157146
803 Ga0070708_100434373
804 Ga0070663_100009043
805 Ga0068867_100116769
806 Ga0070685_10009118
807 Ga0070706_100011892
808 Ga0070706_100098408
809 Ga0070706_100344447
810 Ga0070706_100384681
811 Ga0070707_100071475
812 Ga0070707_100079023
813 Ga0070707_100122791
814 Ga0070707_100182048
815 Ga0070698_100003651
816 Ga0070698_100007107
817 Ga0070698_100018380
818 Ga0070698_100088610
819 Ga0070698_100095093
820 Ga0070698_100339772
821 Ga0070698_100672862
822 Ga0070699_100001109
823 Ga0070699_100334504
824 Ga0070679_100088807
825 Ga0070679_100265096
826 Ga0070684_100061882
827 Ga0070684_100074897
828 Ga0070697_100006772
829 Ga0070697_100028961
830 Ga0070697_100062070
831 Ga0070672_100059725
832 Ga0070686_100117012
833 Ga0070695_100022206
834 Ga0070695_100187125
835 Ga0070696_100321015
836 Ga0070693_100011079
837 Ga0070693_100080034
838 Ga0070665_100346149
839 Ga0070704_100039219
840 Ga0070704_100510570
841 Ga0068855_100193110
842 Ga0068855_100228866
843 Ga0070664_100123436
844 Ga0068854_100069753
845 Ga0068856_100033830
846 Ga0068856_100254481
847 Ga0068856_100757388
848 Ga0070702_100444152
849 Ga0068864_100225622
850 Ga0068864_101113345
851 Ga0068863_100743215
852 Ga0068858_100111597
853 Ga0068860_100265220
854 Ga0081539_10014255
855 Ga0081539_10052386
856 Ga0070717_10039870
857 Ga0070717_10050438
858 Ga0070717_10053387
859 Ga0070717_10084127
860 Ga0070717_10194562
861 Ga0070717_10319776
862 Ga0070717_10327744
863 Ga0070717_10362417
864 Ga0070717_10365391
865 Ga0070717_10366036
866 Ga0070717_10458484
867 Ga0070717_10486574
868 Ga0070717_10721152
869 Ga0070715_10046498
870 Ga0070716_100003362
871 Ga0070716_100021675
872 Ga0070716_100023254
873 Ga0070716_100023690
874 Ga0070716_100051410
875 Ga0070716_100287999
876 Ga0070712_100003688
877 Ga0070712_100005273
878 Ga0070712_100034961
879 Ga0070712_100068522
880 Ga0070712_100075631
881 Ga0070712_100149079
882 Ga0070712_100203652
883 Ga0070712_100231900
884 Ga0070712_100253865
885 Ga0070712_100383386
886 Ga0070712_100420371
887 Ga0070712_100483223
888 Ga0070712_100643300
889 Ga0097621_100167706
890 Ga0097621_100416995
891 Ga0068871_100041269
892 Ga0075428_100258068
893 Ga0075433_10152520
894 Ga0075433_10251634
895 Ga0075434_100042469
896 Ga0075434_100046369
897 Ga0075434_100103875
898 Ga0075434_100160434
899 Ga0075434_100175900
900 Ga0075434_100211115
901 Ga0075434_100679968
902 Ga0068865_100196664
903 Ga0075436_100011304
904 Ga0075436_100438795
905 Ga0075435_100004335
906 Ga0075435_100006530
907 Ga0075435_100105276
908 Ga0075435_100288048
909 Ga0099794_10049480
910 Ga0099795_10042114
911 Ga0099795_10044724
912 Ga0099795_10065244
913 Ga0105250_10110454
914 Ga0111539_10693624
915 Ga0105245_10203646
916 Ga0105247_10382607
917 Ga0114129_10054553
918 Ga0114129_10103529
919 Ga0114129_10110025
920 Ga0114129_10454028
921 Ga0105243_10543950
922 Ga0105242_10017513
923 Ga0105248_10075506
924 Ga0105237_10245574
925 Ga0105237_10502599
926 Ga0105238_10413590
927 Ga0105249_10496445
928 Ga0099796_10029338
929 Ga0105239_10673657
930 Ga0157370_10129527
931 Ga0157370_10307545
932 Ga0157370_10785698
933 Ga0157369_10162778
934 Ga0157369_10277498
935 Ga0157369_10299575
936 Ga0157374_10011866
937 Ga0157374_10108536
938 Ga0157374_10120997
939 Ga0157378_10070233
940 Ga0163162_10444677
941 Ga0157372_10529887
942 Ga0157372_10711908
943 Ga0163163_10218141
944 Ga0163163_10396634
945 Ga0157379_10168768
946 Ga0157376_10081231
947 Ga0163161_10333690
948 Ga0206354_10062606
949 Ga0207653_10006364
950 Ga0207653_10016302
951 Ga0207692_10001484
952 Ga0207692_10002038
953 Ga0207692_10005610
954 Ga0207692_10014954
955 Ga0207692_10027388
956 Ga0207692_10059765
957 Ga0207692_10103381
958 Ga0207692_10206214
959 Ga0207692_10254172
960 Ga0207688_10007763
961 Ga0207680_10399545
962 Ga0207680_10406906
963 Ga0207647_10077272
964 Ga0207685_10000265
965 Ga0207685_10015908
966 Ga0207685_10055014
967 Ga0207685_10168599
968 Ga0207699_10002179
969 Ga0207699_10002691
970 Ga0207699_10003494
971 Ga0207699_10008409
972 Ga0207699_10018567
973 Ga0207699_10022519
974 Ga0207699_10185136
975 Ga0207699_10256890
976 Ga0207643_10057441
977 Ga0207705_10022003
978 Ga0207684_10009226
979 Ga0207684_10053953
980 Ga0207684_10060888
981 Ga0207684_10118934
982 Ga0207695_10259454
983 Ga0207671_10057865
984 Ga0207671_10123046
985 Ga0207693_10002900
986 Ga0207693_10008646
987 Ga0207693_10017845
988 Ga0207693_10022280
989 Ga0207693_10029737
990 Ga0207693_10294901
991 Ga0207693_10355324
992 Ga0207693_10362719
993 Ga0207693_10555180
994 Ga0207663_10003761
995 Ga0207663_10016851
996 Ga0207663_10027101
997 Ga0207663_10028663
998 Ga0207663_10051969
999 Ga0207663_10059419
1000 Ga0207663_10068437
1001 Ga0207663_10311272
1002 Ga0207663_10350998
1003 Ga0207663_10529284
1004 Ga0207657_10056925
1005 Ga0207649_10110119
1006 Ga0207646_10000056
1007 Ga0207646_10009007
1008 Ga0207646_10012767
1009 Ga0207646_10038138
1010 Ga0207646_10073878
1011 Ga0207646_10192332
1012 Ga0207646_10240598
1013 Ga0207646_10561014
1014 Ga0207694_10311225
1015 Ga0207687_10134788
1016 Ga0207687_10186552
1017 Ga0207700_10002372
1018 Ga0207700_10003978
1019 Ga0207700_10022585
1020 Ga0207700_10048980
1021 Ga0207700_10053598
1022 Ga0207700_10076018
1023 Ga0207700_10115305
1024 Ga0207700_10116759
1025 Ga0207700_10128929
1026 Ga0207700_10158551
1027 Ga0207700_10591741
1028 Ga0207700_10664532
1029 Ga0207664_10002873
1030 Ga0207664_10004444
1031 Ga0207664_10013506
1032 Ga0207664_10013555
1033 Ga0207664_10039251
1034 Ga0207664_10063337
1035 Ga0207664_10092011
1036 Ga0207664_10139898
1037 Ga0207664_10164763
1038 Ga0207664_10272062
1039 Ga0207644_10173648
1040 Ga0207686_10115091
1041 Ga0207665_10004036
1042 Ga0207665_10004304
1043 Ga0207665_10004776
1044 Ga0207665_10032360
1045 Ga0207665_10265365
1046 Ga0207665_10275589
1047 Ga0207691_10057489
1048 Ga0207711_10488054
1049 Ga0207689_10010039
1050 Ga0207661_10068020
1051 Ga0207679_10047456
1052 Ga0207667_10372292
1053 Ga0207667_10563635
1054 Ga0207667_10584307
1055 Ga0207712_10347611
1056 Ga0207712_10510257
1057 Ga0207702_10003421
1058 Ga0207702_10265259
1059 Ga0207702_10403042
1060 Ga0207641_10166411
1061 Ga0207648_10113660
1062 Ga0207676_10188017
1063 Ga0207676_10615650
1064 Ga0207674_10002514
1065 Ga0207674_10169424
1066 Ga0207675_100011261
1067 Ga0207683_10003882
1068 Ga0207428_10019154
1069 Ga0207428_10063372
1070 Ga0268265_10030286
1071 Ga0268264_10117699
1072 Ga0265326_10002763
1073 Ga0265334_10002724
1074 Ga0265323_10048022
1075 Ga0307515_10000025
1076 Ga0265338_10003321
1077 Ga0265324_10001090
1078 Ga0307512_10147525
1079 Ga0307512_10148019
1080 Ga0265332_10011997
1081 Ga0265320_10009760
1082 Ga0265325_10017636
1083 Ga0265340_10002754
1084 Ga0307509_10005795
1085 Ga0307509_10024776
1086 Ga0307509_10027298
1087 Ga0307508_10044859
1088 Ga0307514_10054033
1089 Ga0265314_10052920
1090 Ga0265342_10011942
1091 Ga0307516_10020320
1092 Ga0307518_10107206
1093 Ga0307518_10191997
1094 Ga0307507_10032048
1095 Ga0307510_10031901
1096 Ga0316214_1001741
1097 Ga0373930_0006633
1098 Ga0373930_0011325
1099 Ga0373948_0016751
1100 Ga0373948_0041943
1101 Ga0373958_0019561
1102 Ga0373959_0005951
1103 Ga0373959_0041693
1104 Ga0373926_0000563
1105 Ga0373929_0053381
1106 Ga0373934_0002721
1107 Ga0373934_0010227
1108 Ga0373934_0071332
1109 Ga0373934_0088389
1110 Ga0373934_0112245
1111 Ga0373940_0136341
1112 Ga0373944_0001459
1113 Ga0373951_0024200
1114 Ga0373952_0025029
1115 Ga0373923_0000138
1116 Ga0373923_0029016
1117 Ga0373923_0210142
1118 Ga0373932_0035129
1119 Ga0373932_0130883
1120 Ga0373936_0000260
1121 Ga0373936_0014456
1122 Ga0373936_0164002
1123 Ga0373939_0010441
1124 Ga0373941_0048869
1125 Ga0373945_0000382
1126 Ga0373945_0029548
1127 Ga0373945_0054879
1128 Ga0373953_0040143
1129 Ga0373953_0045145
1130 Ga0373953_0145051
1131 Ga0373954_0004738
1132 Ga0373954_0066368
1133 Ga0373954_0245910
1134 Ga0373956_0005544
1135 Ga0373956_0040068
1136 Ga0373956_0040069
1137 Ga0373957_0004576
1138 Ga0373957_0011022
1139 Ga0373957_0048327
1140 Ga0373960_0014084
1141 Ga0373960_0032427
1142 Ga0373960_0116654
1143 Ga0373943_0000338
1144 Ga0373943_0128909
1145 Ga0373943_0190316
1146 Ga0373946_0000449
1147 Ga0373946_0046455
1148 Ga0373946_0140298
1149 Ga0373955_0000247
1150 Ga0373955_0005966
1151 Ga0373955_0177934
1152 Ga0373961_0058166
1153 Ga0373961_0059228
1154 Ga0373961_0069339
1155 Ga0373962_0049264
1156 Ga0373924_0007858
1157 Ga0373924_0008335
1158 Ga0373931_0011867
1159 Ga0373931_0053170
1160 Ga0373931_0173118
1161 Ga0373931_0175253
1162 Ga0373935_0002321
1163 Ga0373935_0104689
1164 Ga0373935_0130419
1165 Ga0373935_0197921
1166 Ga0373935_0204105
1167 Ga0373935_0225374
1168 Ga0373927_0002685
1169 Ga0373927_0064934
1170 Ga0373927_0257522
1171 Ga0373933_0008868
1172 Ga0373933_0052600
1173 Ga0373933_0202153
1174 Ga0373933_0325112
1175 Ga0373947_0000950
1176 Ga0373947_0016693
1177 Ga0373937_0022277
1178 Ga0373937_0074449
1179 Ga0373937_0188515
1180 Ga0373937_0232435
1181 Ga0373925_0002214
1182 Ga0373925_0066728
1183 Ga0373925_0113766
1184 Ga0373925_0238610
1185 Ga0373925_0262955
1186 Ga0395898_0019149
1187 Ga0395898_0420321
1188 Ga0395901_0021898
1189 Ga0395901_0842347
1190 Ga0242420_013948
1191 Ga0495592_0004407
1192 Ga0495592_0005094
1193 Ga0495592_0029490
1194 Ga0495592_0212262
1195 Ga0495592_0337394
1196 Ga0495603_0000807
1197 Ga0495603_0164204
1198 Ga0495629_0003043
1199 Ga0495629_0024282
1200 Ga0495629_0024619
1201 Ga0495641_0002812
1202 Ga0495641_0017579
1203 Ga0495641_0205926
1204 Ga0495651_0002068
1205 Ga0495651_0003185
1206 Ga0495651_0016723
1207 Ga0495651_0029693
1208 Ga0495651_0041666
1209 Ga0495651_0113445
1210 Ga0495651_0133021
1211 Ga0495653_0005201
1212 Ga0495653_0018949
1213 Ga0495653_0020193
1214 Ga0495653_0117354
1215 Ga0495653_0146570
1216 Ga0495580_0000900
1217 Ga0495580_0373429
1218 Ga0495582_0001517
1219 Ga0495582_0067596
1220 Ga0495639_0002004
1221 Ga0495639_0059348
1222 Ga0495639_0301024
1223 Ga0495662_0000841
1224 Ga0495662_0020363
1225 Ga0495662_0082595
1226 Ga0495662_0123812
1227 Ga0495664_0005250
1228 Ga0495664_0017309
1229 Ga0495664_0044201
1230 Ga0495664_0048796
1231 Ga0495664_0137323
1232 Ga0495594_0014289
1233 Ga0495583_0089991
1234 Ga0495608_0002059
1235 Ga0495608_0004213
1236 Ga0495608_0007093
1237 Ga0495608_0023289
1238 Ga0495608_0024191
1239 Ga0495618_0002349
1240 Ga0495618_0035706
1241 Ga0495618_0188046
1242 Ga0495628_0015167
1243 Ga0495628_0017101
1244 Ga0495628_0017671
1245 Ga0495628_0043710
1246 Ga0495628_0166918
1247 Ga0495628_0234992
1248 Ga0495630_0003797
1249 Ga0495630_0019142
1250 Ga0495630_0034335
1251 Ga0495630_0122457
1252 Ga0495630_0298528
1253 Ga0495666_0004983
1254 Ga0495652_0002650
1255 Ga0495652_0007644
1256 Ga0495652_0106784
1257 Ga0495652_0123900
1258 Ga0495652_0197131
1259 Ga0495652_0279392
1260 Ga0495665_0001060
1261 Ga0495665_0154554
1262 Ga0495640_0008444
1263 Ga0495640_0035232
1264 Ga0495640_0039115
1265 Ga0495640_0079129
1266 Ga0495640_0366150
1267 Ga0495586_0017689
1268 Ga0495587_0004390
1269 Ga0495587_0006464
1270 Ga0495587_0007734
1271 Ga0495587_0021862
1272 Ga0495587_0036137
1273 Ga0495587_0151360
1274 Ga0495645_0004966
1275 Ga0495645_0005579
1276 Ga0495645_0015554
1277 Ga0495645_0044950
1278 Ga0495645_0096887
1279 Ga0495645_0152117
1280 Ga0495667_0000535
1281 Ga0495667_0003519
1282 Ga0495667_0006700
1283 Ga0495667_0022592
1284 Ga0495667_0231445
1285 Ga0495667_0307202
1286 Ga0495667_0355550
1287 Ga0495634_0002093
1288 Ga0495634_0008783
1289 Ga0495634_0059852
1290 Ga0495634_0108400
1291 Ga0495625_0042952
1292 Ga0495635_0004803
1293 Ga0495635_0011160
1294 Ga0495635_0014678
1295 Ga0495635_0016198
1296 Ga0495635_0060631
1297 Ga0495635_0076268
1298 Ga0495635_0077629
1299 Ga0495588_0021191
1300 Ga0495657_0003052
1301 Ga0495657_0003639
1302 Ga0495657_0004393
1303 Ga0495657_0013700
1304 Ga0495657_0218126
1305 Ga0495599_0008591
1306 Ga0495599_0019855
1307 Ga0495599_0076132
1308 Ga0495623_0007377
1309 Ga0495623_0010945
1310 Ga0495623_0026213
1311 Ga0495646_0012463
1312 Ga0495646_0016915
1313 Ga0495646_0018766
1314 Ga0495646_0023331
1315 Ga0495646_0061894
1316 Ga0495646_0145344
1317 Ga0495647_0092807
1318 Ga0495647_0103195
1319 Ga0495658_0002629
1320 Ga0495658_0195001
1321 Ga0495658_0259355
1322 Ga0495613_0005707
1323 Ga0495613_0055431
1324 Ga0495624_0001642
1325 Ga0495624_0080649
1326 Ga0495624_0386267
1327 Ga0495671_0015064
1328 Ga0495600_0002380
1329 Ga0495600_0017431
1330 Ga0495600_0054473
1331 Ga0495600_0054496
1332 Ga0495581_0000496
1333 Ga0495581_0016685
1334 Ga0495604_0009559
1335 Ga0495604_0030248
1336 Ga0495604_0030633
1337 Ga0495636_0109717
1338 Ga0495674_0009685
1339 Ga0495674_0014906
1340 Ga0495674_0026557
1341 Ga0495674_0056522
1342 Ga0495674_0058292
1343 Ga0495674_0073406
1344 Ga0495674_0102244
1345 Ga0495674_0360174
1346 Ga0495676_0000700
1347 Ga0495676_0259659
1348 Ga0495680_0001524
1349 Ga0495680_0007765
1350 Ga0495680_0022504
1351 Ga0495680_0156798
1352 Ga0495687_001618
1353 Ga0495675_0002613
1354 Ga0495675_0004210
1355 Ga0495675_0009009
1356 Ga0495675_0020655
1357 Ga0495675_0073405
1358 Ga0495681_0013509
1359 Ga0495684_0000915
1360 Ga0495684_0015546
1361 Ga0495684_0034276
1362 Ga0495684_0073856
1363 Ga0495684_0098745
1364 Ga0495684_0110704
1365 Ga0495684_0119435
1366 Ga0495684_0228208
1367 Ga0495686_0026799
1368 Ga0495593_0004441
1369 Ga0495593_0048013
1370 Ga0495602_0005369
1371 Ga0495602_0071054
1372 Ga0495602_0090441
1373 Ga0495602_0119317
1374 Ga0495602_0131341
1375 Ga0495614_0001547
1376 Ga0496100_0053451
1377 Ga0496100_0420610
1378 Ga0496101_0015820
1379 Ga0496101_0115344
1380 Ga0496101_0166700
1381 Ga0496101_0183872
1382 Ga0496102_0126181
1383 Ga0496102_0187276
1384 Ga0496104_0016301
1385 Ga0496104_0023541
1386 Ga0496104_0081059
1387 Ga0496104_0087655
1388 Ga0496105_0002382
1389 Ga0496105_0008747
1390 Ga0496105_0057654
1391 Ga0496105_0139316
1392 Ga0496105_0161660
1393 Ga0496106_0074472
1394 Ga0496106_0077155
1395 Ga0496107_0133836
1396 Ga0496107_0163054
1397 Ga0496108_0027758
1398 Ga0496108_0033511
1399 Ga0496108_0035960
1400 Ga0496108_0470150
1401 Ga0496109_0053726
1402 Ga0496109_0059825
1403 Ga0496109_0093262
1404 Ga0496109_0122305
1405 Ga0496110_0009446
1406 Ga0496110_0026291
1407 Ga0496110_0075195
1408 Ga0496110_0597873
1409 Ga0496111_0010884
1410 Ga0496111_0096881
1411 Ga0496111_0100874
1412 Ga0496112_0023220
1413 Ga0496112_0030981
1414 Ga0496112_0084094
1415 Ga0496113_0010824
1416 Ga0496113_0051788
1417 Ga0496113_0199409
1418 Ga0496113_0334964
1419 Ga0496113_0367986
1420 Ga0496114_0019457
1421 Ga0496114_0255125
1422 Ga0496115_0012296
1423 Ga0496115_0054354
1424 Ga0496126_0465835
1425 Ga0501070_0527168
1426 nmdc:mga05p37_15272_c1
1427 nmdc:mga05p37_36127_c1
1428 nmdc:mga08y16_122497_c1
1429 nmdc:mga08y16_597154_c1
1430 nmdc:mga0n895_12070_c1
1431 nmdc:mga0n895_132658_c1
1432 nmdc:mga0rr50_10489_c1
1433 nmdc:mga0rr50_162463_c1
1434 nmdc:mga0rr50_285507_c1
1435 nmdc:mga0rr50_291231_c1
1436 nmdc:mga0rr50_7420_c1
1437 nmdc:mga08x19_3432_c1
1438 nmdc:mga08x19_79008_c1
1439 nmdc:mga0a205_121677_c1
1440 nmdc:mga0a205_14730_c1
1441 nmdc:mga0a205_202254_c1
1442 Ga0495601_0000170
1443 Ga0495601_0010149
1444 Ga0495601_0011922
1445 Ga0495601_0094753
1446 Ga0495601_0216695
1447 Ga0495601_0500177
1448 Ga0495612_0002763
1449 Ga0495612_0010441
1450 Ga0495612_0062640
1451 Ga0495612_0066327
1452 Ga0495595_0002434
1453 Ga0495595_0011782
1454 Ga0495595_0052420
1455 Ga0495595_0096431
1456 Ga0495619_0010380
1457 Ga0495619_0104282
1458 Ga0495619_0151829
1459 Ga0495619_0273579
1460 Ga0495619_0433674
1461 Ga0500560_028337
1462 2995469907

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

231

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

265

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

46

200

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jc8-assembly1.cif.gz_B crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.94 3 225
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9387 3 222
3gvc-assembly2.cif.gz_D-3 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.9345 3 225
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9329 3 223
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9326 3 223
ID Description Score Start End Superfamily
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9359 3 222 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9326 3 223 3.40.50.720
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 3 223 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 1 222 3.40.50.720
5jlaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 4 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R2C060-F1-model_v4 Short-subunit dehydrogenase 0.9796 1 226 GO:0016491
AF-A0A7Y5KWS0-F1-model_v4 SDR family oxidoreductase 0.9521 4 226 GO:0016491
AF-A0A4D7QV48-F1-model_v4 SDR family oxidoreductase 0.9521 4 225 GO:0016491
AF-A0A535MBX9-F1-model_v4 SDR family oxidoreductase 0.9491 4 226 GO:0016616
GO:0030497
AF-A0A1U9UZ77-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9465 3 223 GO:0016491

Map