F477953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 266 | 1462 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100260419|Ga0070698_1002604192 |
| Length | 266 |
| Sequence | MTLHLPGGQPGSVAKAGTAARGRARDSRRYHDITPRSVDVMNARVAIVAGAGGALGRATTAVLAAGGLTVVAVDRNERALRELPDHVRREVADTTDPAAATPLIDRIAGEVGPPEVLVNTIGAFRPGDAATTTPETLQLMIDVNLGTALWLSRAVAPYMQQQGTGVIVHVTARPGIEPSGGMAAYSTSKAALVHLTRILDIELRPHGIRVNAVAPQLLDIPANRATFPAEVMAHAVAPEAIAGVIAFLVSDAAAPVSGAILPAYGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 133 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 144 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 147 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 150 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 152 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 153 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 266 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 6.57 |
| Rhizosphere | 91.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070698_100260419 | 3300005471 | Bacteria | 1667 |
| 2 | Ga0070658_10164299 | 3300005327 | Bacteria | 1864 |
| 3 | Ga0070676_10305535 | 3300005328 | Bacteria | 1080 |
| 4 | Ga0070683_100020631 | 3300005329 | Bacteria | 5865 |
| 5 | Ga0068869_100087791 | 3300005334 | Bacteria | 2333 |
| 6 | Ga0070666_10072635 | 3300005335 | Bacteria | 2342 |
| 7 | Ga0070682_100224028 | 3300005337 | Bacteria | 1340 |
| 8 | Ga0070682_100435392 | 3300005337 | Bacteria | 1000 |
| 9 | Ga0070660_100140726 | 3300005339 | Bacteria | 1935 |
| 10 | Ga0070691_10039712 | 3300005341 | Bacteria | 2223 |
| 11 | Ga0070687_100037466 | 3300005343 | Bacteria | 2424 |
| 12 | Ga0070661_100065335 | 3300005344 | Bacteria | 2673 |
| 13 | Ga0070675_100012645 | 3300005354 | Bacteria | 6621 |
| 14 | Ga0070671_100061275 | 3300005355 | Bacteria | 3133 |
| 15 | Ga0070709_10000519 | 3300005434 | Bacteria | 22772 |
| 16 | Ga0070709_10003556 | 3300005434 | Bacteria | 8373 |
| 17 | Ga0070709_10027027 | 3300005434 | Bacteria | 3408 |
| 18 | Ga0070709_10049576 | 3300005434 | Bacteria | 2626 |
| 19 | Ga0070709_10292968 | 3300005434 | Bacteria | 1186 |
| 20 | Ga0070709_10349897 | 3300005434 | Bacteria | 1091 |
| 21 | Ga0070714_100007377 | 3300005435 | Bacteria | 8555 |
| 22 | Ga0070714_100011224 | 3300005435 | Bacteria | 7104 |
| 23 | Ga0070714_100020560 | 3300005435 | Bacteria | 5393 |
| 24 | Ga0070714_100068935 | 3300005435 | Bacteria | 3053 |
| 25 | Ga0070714_100130268 | 3300005435 | Bacteria | 2247 |
| 26 | Ga0070714_100230003 | 3300005435 | Bacteria | 1708 |
| 27 | Ga0070714_100299612 | 3300005435 | Bacteria | 1498 |
| 28 | Ga0070714_100361788 | 3300005435 | Bacteria | 1364 |
| 29 | Ga0070714_100493189 | 3300005435 | Bacteria | 1167 |
| 30 | Ga0070714_100570017 | 3300005435 | Unclassified | 1085 |
| 31 | Ga0070714_100595443 | 3300005435 | Bacteria | 1061 |
| 32 | Ga0070714_100609994 | 3300005435 | Bacteria | 1048 |
| 33 | Ga0070713_100003287 | 3300005436 | Bacteria | 10649 |
| 34 | Ga0070713_100027643 | 3300005436 | Bacteria | 4468 |
| 35 | Ga0070713_100049735 | 3300005436 | Bacteria | 3459 |
| 36 | Ga0070713_100051364 | 3300005436 | Bacteria | 3409 |
| 37 | Ga0070713_100073961 | 3300005436 | Bacteria | 2886 |
| 38 | Ga0070713_100144635 | 3300005436 | Bacteria | 2109 |
| 39 | Ga0070713_100218951 | 3300005436 | Bacteria | 1726 |
| 40 | Ga0070713_100300186 | 3300005436 | Bacteria | 1478 |
| 41 | Ga0070713_100446984 | 3300005436 | Bacteria | 1213 |
| 42 | Ga0070713_100477540 | 3300005436 | Bacteria | 1174 |
| 43 | Ga0070713_100546362 | 3300005436 | Bacteria | 1096 |
| 44 | Ga0070713_100790301 | 3300005436 | Bacteria | 909 |
| 45 | Ga0070710_10003326 | 3300005437 | Bacteria | 7630 |
| 46 | Ga0070710_10005018 | 3300005437 | Bacteria | 6264 |
| 47 | Ga0070710_10020819 | 3300005437 | Bacteria | 3409 |
| 48 | Ga0070710_10023187 | 3300005437 | Bacteria | 3258 |
| 49 | Ga0070710_10024557 | 3300005437 | Bacteria | 3181 |
| 50 | Ga0070710_10042270 | 3300005437 | Bacteria | 2519 |
| 51 | Ga0070710_10188133 | 3300005437 | Bacteria | 1297 |
| 52 | Ga0070710_10214850 | 3300005437 | Bacteria | 1221 |
| 53 | Ga0070710_10215672 | 3300005437 | Bacteria | 1218 |
| 54 | Ga0070710_10237886 | 3300005437 | Bacteria | 1165 |
| 55 | Ga0070710_10577714 | 3300005437 | Bacteria | 779 |
| 56 | Ga0070711_100001617 | 3300005439 | Bacteria | 12437 |
| 57 | Ga0070711_100018983 | 3300005439 | Bacteria | 4400 |
| 58 | Ga0070711_100023028 | 3300005439 | Bacteria | 4045 |
| 59 | Ga0070711_100063446 | 3300005439 | Bacteria | 2579 |
| 60 | Ga0070711_100079709 | 3300005439 | Bacteria | 2329 |
| 61 | Ga0070711_100111537 | 3300005439 | Bacteria | 2008 |
| 62 | Ga0070711_100179689 | 3300005439 | Bacteria | 1619 |
| 63 | Ga0070711_100206358 | 3300005439 | Bacteria | 1519 |
| 64 | Ga0070711_100388200 | 3300005439 | Bacteria | 1130 |
| 65 | Ga0070711_100447579 | 3300005439 | Bacteria | 1057 |
| 66 | Ga0070711_100525591 | 3300005439 | Bacteria | 978 |
| 67 | Ga0070694_100048632 | 3300005444 | Bacteria | 2853 |
| 68 | Ga0070708_100040123 | 3300005445 | Bacteria | 4099 |
| 69 | Ga0070708_100063046 | 3300005445 | Bacteria | 3317 |
| 70 | Ga0070708_100147053 | 3300005445 | Bacteria | 2189 |
| 71 | Ga0070708_100157146 | 3300005445 | Bacteria | 2118 |
| 72 | Ga0070708_100434373 | 3300005445 | Bacteria | 1238 |
| 73 | Ga0070663_100009043 | 3300005455 | Bacteria | 6154 |
| 74 | Ga0068867_100116769 | 3300005459 | Bacteria | 2057 |
| 75 | Ga0070685_10009118 | 3300005466 | Bacteria | 5120 |
| 76 | Ga0070706_100011892 | 3300005467 | Bacteria | 8079 |
| 77 | Ga0070706_100098408 | 3300005467 | Bacteria | 2718 |
| 78 | Ga0070706_100344447 | 3300005467 | Bacteria | 1389 |
| 79 | Ga0070706_100384681 | 3300005467 | Bacteria | 1306 |
| 80 | Ga0070707_100071475 | 3300005468 | Bacteria | 3343 |
| 81 | Ga0070707_100079023 | 3300005468 | Bacteria | 3175 |
| 82 | Ga0070707_100122791 | 3300005468 | Bacteria | 2522 |
| 83 | Ga0070707_100182048 | 3300005468 | Bacteria | 2048 |
| 84 | Ga0070698_100003651 | 3300005471 | Bacteria | 16898 |
| 85 | Ga0070698_100007107 | 3300005471 | Bacteria | 12124 |
| 86 | Ga0070698_100018380 | 3300005471 | Bacteria | 7359 |
| 87 | Ga0070698_100088610 | 3300005471 | Bacteria | 3079 |
| 88 | Ga0070698_100095093 | 3300005471 | Unclassified | 2958 |
| 89 | Ga0070698_100339772 | 3300005471 | Bacteria | 1433 |
| 90 | Ga0070698_100672862 | 3300005471 | Bacteria | 977 |
| 91 | Ga0070699_100001109 | 3300005518 | Bacteria | 25054 |
| 92 | Ga0070699_100334504 | 3300005518 | Bacteria | 1362 |
| 93 | Ga0070679_100088807 | 3300005530 | Bacteria | 3077 |
| 94 | Ga0070679_100265096 | 3300005530 | Unclassified | 1673 |
| 95 | Ga0070684_100061882 | 3300005535 | Bacteria | 3277 |
| 96 | Ga0070684_100074897 | 3300005535 | Bacteria | 2984 |
| 97 | Ga0070697_100006772 | 3300005536 | Bacteria | 8888 |
| 98 | Ga0070697_100028961 | 3300005536 | Bacteria | 4438 |
| 99 | Ga0070697_100062070 | 3300005536 | Bacteria | 3049 |
| 100 | Ga0070672_100059725 | 3300005543 | Bacteria | 3000 |
| 101 | Ga0070686_100117012 | 3300005544 | Bacteria | 1825 |
| 102 | Ga0070695_100022206 | 3300005545 | Bacteria | 3890 |
| 103 | Ga0070695_100187125 | 3300005545 | Bacteria | 1471 |
| 104 | Ga0070696_100321015 | 3300005546 | Bacteria | 1192 |
| 105 | Ga0070693_100011079 | 3300005547 | Bacteria | 4536 |
| 106 | Ga0070693_100080034 | 3300005547 | Bacteria | 1946 |
| 107 | Ga0070665_100346149 | 3300005548 | Bacteria | 1491 |
| 108 | Ga0070704_100039219 | 3300005549 | Bacteria | 3250 |
| 109 | Ga0070704_100510570 | 3300005549 | Bacteria | 1045 |
| 110 | Ga0068855_100193110 | 3300005563 | Bacteria | 2295 |
| 111 | Ga0068855_100228866 | 3300005563 | Bacteria | 2083 |
| 112 | Ga0070664_100123436 | 3300005564 | Bacteria | 2269 |
| 113 | Ga0068854_100069753 | 3300005578 | Bacteria | 2567 |
| 114 | Ga0068856_100033830 | 3300005614 | Bacteria | 5005 |
| 115 | Ga0068856_100254481 | 3300005614 | Bacteria | 1771 |
| 116 | Ga0068856_100757388 | 3300005614 | Bacteria | 991 |
| 117 | Ga0070702_100444152 | 3300005615 | Bacteria | 939 |
| 118 | Ga0068864_100225622 | 3300005618 | Bacteria | 1730 |
| 119 | Ga0068864_101113345 | 3300005618 | Bacteria | 786 |
| 120 | Ga0068863_100743215 | 3300005841 | Bacteria | 976 |
| 121 | Ga0068858_100111597 | 3300005842 | Bacteria | 2554 |
| 122 | Ga0068860_100265220 | 3300005843 | Bacteria | 1675 |
| 123 | Ga0081539_10014255 | 3300005985 | Bacteria | 5901 |
| 124 | Ga0081539_10052386 | 3300005985 | Bacteria | 2292 |
| 125 | Ga0070717_10039870 | 3300006028 | Bacteria | 3823 |
| 126 | Ga0070717_10050438 | 3300006028 | Bacteria | 3420 |
| 127 | Ga0070717_10053387 | 3300006028 | Bacteria | 3331 |
| 128 | Ga0070717_10084127 | 3300006028 | Bacteria | 2676 |
| 129 | Ga0070717_10194562 | 3300006028 | Bacteria | 1773 |
| 130 | Ga0070717_10319776 | 3300006028 | Bacteria | 1382 |
| 131 | Ga0070717_10327744 | 3300006028 | Bacteria | 1365 |
| 132 | Ga0070717_10362417 | 3300006028 | Bacteria | 1298 |
| 133 | Ga0070717_10365391 | 3300006028 | Bacteria | 1292 |
| 134 | Ga0070717_10366036 | 3300006028 | Bacteria | 1291 |
| 135 | Ga0070717_10458484 | 3300006028 | Bacteria | 1149 |
| 136 | Ga0070717_10486574 | 3300006028 | Bacteria | 1114 |
| 137 | Ga0070717_10721152 | 3300006028 | Unclassified | 906 |
| 138 | Ga0070715_10046498 | 3300006163 | Bacteria | 1845 |
| 139 | Ga0070716_100003362 | 3300006173 | Bacteria | 7524 |
| 140 | Ga0070716_100021675 | 3300006173 | Bacteria | 3388 |
| 141 | Ga0070716_100023254 | 3300006173 | Bacteria | 3284 |
| 142 | Ga0070716_100023690 | 3300006173 | Bacteria | 3258 |
| 143 | Ga0070716_100051410 | 3300006173 | Bacteria | 2342 |
| 144 | Ga0070716_100287999 | 3300006173 | Bacteria | 1137 |
| 145 | Ga0070712_100003688 | 3300006175 | Bacteria | 9439 |
| 146 | Ga0070712_100005273 | 3300006175 | Bacteria | 7998 |
| 147 | Ga0070712_100034961 | 3300006175 | Bacteria | 3408 |
| 148 | Ga0070712_100068522 | 3300006175 | Bacteria | 2528 |
| 149 | Ga0070712_100075631 | 3300006175 | Bacteria | 2422 |
| 150 | Ga0070712_100149079 | 3300006175 | Bacteria | 1794 |
| 151 | Ga0070712_100203652 | 3300006175 | Bacteria | 1556 |
| 152 | Ga0070712_100231900 | 3300006175 | Bacteria | 1466 |
| 153 | Ga0070712_100253865 | 3300006175 | Bacteria | 1406 |
| 154 | Ga0070712_100383386 | 3300006175 | Bacteria | 1157 |
| 155 | Ga0070712_100420371 | 3300006175 | Bacteria | 1108 |
| 156 | Ga0070712_100483223 | 3300006175 | Bacteria | 1036 |
| 157 | Ga0070712_100643300 | 3300006175 | Bacteria | 900 |
| 158 | Ga0097621_100167706 | 3300006237 | Bacteria | 1891 |
| 159 | Ga0097621_100416995 | 3300006237 | Bacteria | 1204 |
| 160 | Ga0068871_100041269 | 3300006358 | Bacteria | 3699 |
| 161 | Ga0075428_100258068 | 3300006844 | Bacteria | 1877 |
| 162 | Ga0075433_10152520 | 3300006852 | Bacteria | 2055 |
| 163 | Ga0075433_10251634 | 3300006852 | Bacteria | 1567 |
| 164 | Ga0075434_100042469 | 3300006871 | Bacteria | 4507 |
| 165 | Ga0075434_100046369 | 3300006871 | Bacteria | 4313 |
| 166 | Ga0075434_100103875 | 3300006871 | Bacteria | 2850 |
| 167 | Ga0075434_100160434 | 3300006871 | Bacteria | 2268 |
| 168 | Ga0075434_100175900 | 3300006871 | Bacteria | 2160 |
| 169 | Ga0075434_100211115 | 3300006871 | Unclassified | 1961 |
| 170 | Ga0075434_100679968 | 3300006871 | Unclassified | 1047 |
| 171 | Ga0068865_100196664 | 3300006881 | Bacteria | 1563 |
| 172 | Ga0075436_100011304 | 3300006914 | Bacteria | 6124 |
| 173 | Ga0075436_100438795 | 3300006914 | Bacteria | 949 |
| 174 | Ga0075435_100004335 | 3300007076 | Bacteria | 9758 |
| 175 | Ga0075435_100006530 | 3300007076 | Bacteria | 8249 |
| 176 | Ga0075435_100105276 | 3300007076 | Bacteria | 2341 |
| 177 | Ga0075435_100288048 | 3300007076 | Bacteria | 1403 |
| 178 | Ga0099794_10049480 | 3300007265 | Bacteria | 2020 |
| 179 | Ga0099795_10042114 | 3300007788 | Bacteria | 1629 |
| 180 | Ga0099795_10044724 | 3300007788 | Unclassified | 1589 |
| 181 | Ga0099795_10065244 | 3300007788 | Bacteria | 1361 |
| 182 | Ga0105250_10110454 | 3300009092 | Bacteria | 1126 |
| 183 | Ga0111539_10693624 | 3300009094 | Bacteria | 1185 |
| 184 | Ga0105245_10203646 | 3300009098 | Bacteria | 1902 |
| 185 | Ga0105247_10382607 | 3300009101 | Bacteria | 998 |
| 186 | Ga0114129_10054553 | 3300009147 | Bacteria | 5603 |
| 187 | Ga0114129_10103529 | 3300009147 | Bacteria | 3936 |
| 188 | Ga0114129_10110025 | 3300009147 | Bacteria | 3803 |
| 189 | Ga0114129_10454028 | 3300009147 | Bacteria | 1680 |
| 190 | Ga0105243_10543950 | 3300009148 | Bacteria | 1108 |
| 191 | Ga0105242_10017513 | 3300009176 | Bacteria | 5585 |
| 192 | Ga0105248_10075506 | 3300009177 | Bacteria | 3788 |
| 193 | Ga0105237_10245574 | 3300009545 | Bacteria | 1792 |
| 194 | Ga0105237_10502599 | 3300009545 | Unclassified | 1219 |
| 195 | Ga0105238_10413590 | 3300009551 | Bacteria | 1342 |
| 196 | Ga0105249_10496445 | 3300009553 | Bacteria | 1265 |
| 197 | Ga0099796_10029338 | 3300010159 | Bacteria | 1774 |
| 198 | Ga0105239_10673657 | 3300010375 | Bacteria | 1182 |
| 199 | Ga0157370_10129527 | 3300013104 | Bacteria | 2354 |
| 200 | Ga0157370_10307545 | 3300013104 | Bacteria | 1463 |
| 201 | Ga0157370_10785698 | 3300013104 | Bacteria | 867 |
| 202 | Ga0157369_10162778 | 3300013105 | Bacteria | 2354 |
| 203 | Ga0157369_10277498 | 3300013105 | Bacteria | 1745 |
| 204 | Ga0157369_10299575 | 3300013105 | Unclassified | 1673 |
| 205 | Ga0157374_10011866 | 3300013296 | Bacteria | 7559 |
| 206 | Ga0157374_10108536 | 3300013296 | Bacteria | 2668 |
| 207 | Ga0157374_10120997 | 3300013296 | Bacteria | 2526 |
| 208 | Ga0157378_10070233 | 3300013297 | Bacteria | 3144 |
| 209 | Ga0163162_10444677 | 3300013306 | Bacteria | 1428 |
| 210 | Ga0157372_10529887 | 3300013307 | Bacteria | 1373 |
| 211 | Ga0157372_10711908 | 3300013307 | Bacteria | 1168 |
| 212 | Ga0163163_10218141 | 3300014325 | Bacteria | 1956 |
| 213 | Ga0163163_10396634 | 3300014325 | Bacteria | 1438 |
| 214 | Ga0157379_10168768 | 3300014968 | Bacteria | 1975 |
| 215 | Ga0157376_10081231 | 3300014969 | Unclassified | 2783 |
| 216 | Ga0163161_10333690 | 3300017792 | Bacteria | 1201 |
| 217 | Ga0206354_10062606 | 3300020081 | Bacteria | 1717 |
| 218 | Ga0207653_10006364 | 3300025885 | Bacteria | 3684 |
| 219 | Ga0207653_10016302 | 3300025885 | Bacteria | 2334 |
| 220 | Ga0207692_10001484 | 3300025898 | Bacteria | 8799 |
| 221 | Ga0207692_10002038 | 3300025898 | Bacteria | 7708 |
| 222 | Ga0207692_10005610 | 3300025898 | Bacteria | 5036 |
| 223 | Ga0207692_10014954 | 3300025898 | Bacteria | 3403 |
| 224 | Ga0207692_10027388 | 3300025898 | Bacteria | 2685 |
| 225 | Ga0207692_10059765 | 3300025898 | Bacteria | 1969 |
| 226 | Ga0207692_10103381 | 3300025898 | Bacteria | 1568 |
| 227 | Ga0207692_10206214 | 3300025898 | Bacteria | 1158 |
| 228 | Ga0207692_10254172 | 3300025898 | Bacteria | 1054 |
| 229 | Ga0207688_10007763 | 3300025901 | Bacteria | 5842 |
| 230 | Ga0207680_10399545 | 3300025903 | Bacteria | 971 |
| 231 | Ga0207680_10406906 | 3300025903 | Bacteria | 962 |
| 232 | Ga0207647_10077272 | 3300025904 | Bacteria | 2001 |
| 233 | Ga0207685_10000265 | 3300025905 | Bacteria | 8269 |
| 234 | Ga0207685_10015908 | 3300025905 | Bacteria | 2395 |
| 235 | Ga0207685_10055014 | 3300025905 | Bacteria | 1552 |
| 236 | Ga0207685_10168599 | 3300025905 | Bacteria | 1006 |
| 237 | Ga0207699_10002179 | 3300025906 | Bacteria | 9247 |
| 238 | Ga0207699_10002691 | 3300025906 | Bacteria | 8401 |
| 239 | Ga0207699_10003494 | 3300025906 | Bacteria | 7500 |
| 240 | Ga0207699_10008409 | 3300025906 | Bacteria | 5092 |
| 241 | Ga0207699_10018567 | 3300025906 | Bacteria | 3688 |
| 242 | Ga0207699_10022519 | 3300025906 | Bacteria | 3415 |
| 243 | Ga0207699_10185136 | 3300025906 | Bacteria | 1402 |
| 244 | Ga0207699_10256890 | 3300025906 | Bacteria | 1206 |
| 245 | Ga0207643_10057441 | 3300025908 | Bacteria | 2215 |
| 246 | Ga0207705_10022003 | 3300025909 | Bacteria | 4550 |
| 247 | Ga0207684_10009226 | 3300025910 | Bacteria | 8720 |
| 248 | Ga0207684_10053953 | 3300025910 | Bacteria | 3411 |
| 249 | Ga0207684_10060888 | 3300025910 | Bacteria | 3206 |
| 250 | Ga0207684_10118934 | 3300025910 | Bacteria | 2264 |
| 251 | Ga0207695_10259454 | 3300025913 | Bacteria | 1636 |
| 252 | Ga0207671_10057865 | 3300025914 | Bacteria | 2874 |
| 253 | Ga0207671_10123046 | 3300025914 | Bacteria | 1984 |
| 254 | Ga0207693_10002900 | 3300025915 | Bacteria | 14845 |
| 255 | Ga0207693_10008646 | 3300025915 | Bacteria | 8331 |
| 256 | Ga0207693_10017845 | 3300025915 | Bacteria | 5658 |
| 257 | Ga0207693_10022280 | 3300025915 | Bacteria | 5035 |
| 258 | Ga0207693_10029737 | 3300025915 | Bacteria | 4312 |
| 259 | Ga0207693_10294901 | 3300025915 | Bacteria | 1270 |
| 260 | Ga0207693_10355324 | 3300025915 | Bacteria | 1146 |
| 261 | Ga0207693_10362719 | 3300025915 | Bacteria | 1134 |
| 262 | Ga0207693_10555180 | 3300025915 | Bacteria | 895 |
| 263 | Ga0207663_10003761 | 3300025916 | Bacteria | 7482 |
| 264 | Ga0207663_10016851 | 3300025916 | Bacteria | 4062 |
| 265 | Ga0207663_10027101 | 3300025916 | Bacteria | 3335 |
| 266 | Ga0207663_10028663 | 3300025916 | Bacteria | 3261 |
| 267 | Ga0207663_10051969 | 3300025916 | Bacteria | 2554 |
| 268 | Ga0207663_10059419 | 3300025916 | Bacteria | 2418 |
| 269 | Ga0207663_10068437 | 3300025916 | Bacteria | 2280 |
| 270 | Ga0207663_10311272 | 3300025916 | Bacteria | 1180 |
| 271 | Ga0207663_10350998 | 3300025916 | Bacteria | 1117 |
| 272 | Ga0207663_10529284 | 3300025916 | Bacteria | 919 |
| 273 | Ga0207657_10056925 | 3300025919 | Bacteria | 3372 |
| 274 | Ga0207649_10110119 | 3300025920 | Bacteria | 1838 |
| 275 | Ga0207646_10000056 | 3300025922 | Bacteria | 158385 |
| 276 | Ga0207646_10009007 | 3300025922 | Bacteria | 9921 |
| 277 | Ga0207646_10012767 | 3300025922 | Bacteria | 8056 |
| 278 | Ga0207646_10038138 | 3300025922 | Bacteria | 4329 |
| 279 | Ga0207646_10073878 | 3300025922 | Bacteria | 3046 |
| 280 | Ga0207646_10192332 | 3300025922 | Bacteria | 1843 |
| 281 | Ga0207646_10240598 | 3300025922 | Bacteria | 1635 |
| 282 | Ga0207646_10561014 | 3300025922 | Bacteria | 1026 |
| 283 | Ga0207694_10311225 | 3300025924 | Bacteria | 1298 |
| 284 | Ga0207687_10134788 | 3300025927 | Bacteria | 1866 |
| 285 | Ga0207687_10186552 | 3300025927 | Bacteria | 1611 |
| 286 | Ga0207700_10002372 | 3300025928 | Bacteria | 10824 |
| 287 | Ga0207700_10003978 | 3300025928 | Bacteria | 8651 |
| 288 | Ga0207700_10022585 | 3300025928 | Bacteria | 4320 |
| 289 | Ga0207700_10048980 | 3300025928 | Bacteria | 3140 |
| 290 | Ga0207700_10053598 | 3300025928 | Bacteria | 3023 |
| 291 | Ga0207700_10076018 | 3300025928 | Bacteria | 2604 |
| 292 | Ga0207700_10115305 | 3300025928 | Bacteria | 2169 |
| 293 | Ga0207700_10116759 | 3300025928 | Bacteria | 2157 |
| 294 | Ga0207700_10128929 | 3300025928 | Bacteria | 2062 |
| 295 | Ga0207700_10158551 | 3300025928 | Bacteria | 1877 |
| 296 | Ga0207700_10591741 | 3300025928 | Bacteria | 987 |
| 297 | Ga0207700_10664532 | 3300025928 | Bacteria | 929 |
| 298 | Ga0207664_10002873 | 3300025929 | Bacteria | 11456 |
| 299 | Ga0207664_10004444 | 3300025929 | Bacteria | 9497 |
| 300 | Ga0207664_10013506 | 3300025929 | Bacteria | 5864 |
| 301 | Ga0207664_10013555 | 3300025929 | Bacteria | 5856 |
| 302 | Ga0207664_10039251 | 3300025929 | Bacteria | 3676 |
| 303 | Ga0207664_10063337 | 3300025929 | Bacteria | 2955 |
| 304 | Ga0207664_10092011 | 3300025929 | Bacteria | 2488 |
| 305 | Ga0207664_10139898 | 3300025929 | Bacteria | 2046 |
| 306 | Ga0207664_10164763 | 3300025929 | Bacteria | 1893 |
| 307 | Ga0207664_10272062 | 3300025929 | Bacteria | 1484 |
| 308 | Ga0207644_10173648 | 3300025931 | Bacteria | 1684 |
| 309 | Ga0207686_10115091 | 3300025934 | Bacteria | 1821 |
| 310 | Ga0207665_10004036 | 3300025939 | Bacteria | 9803 |
| 311 | Ga0207665_10004304 | 3300025939 | Bacteria | 9459 |
| 312 | Ga0207665_10004776 | 3300025939 | Bacteria | 9016 |
| 313 | Ga0207665_10032360 | 3300025939 | Bacteria | 3462 |
| 314 | Ga0207665_10265365 | 3300025939 | Bacteria | 1273 |
| 315 | Ga0207665_10275589 | 3300025939 | Unclassified | 1250 |
| 316 | Ga0207691_10057489 | 3300025940 | Bacteria | 3540 |
| 317 | Ga0207711_10488054 | 3300025941 | Bacteria | 1148 |
| 318 | Ga0207689_10010039 | 3300025942 | Bacteria | 8162 |
| 319 | Ga0207661_10068020 | 3300025944 | Bacteria | 2899 |
| 320 | Ga0207679_10047456 | 3300025945 | Bacteria | 3120 |
| 321 | Ga0207667_10372292 | 3300025949 | Bacteria | 1456 |
| 322 | Ga0207667_10563635 | 3300025949 | Bacteria | 1151 |
| 323 | Ga0207667_10584307 | 3300025949 | Bacteria | 1127 |
| 324 | Ga0207712_10347611 | 3300025961 | Bacteria | 1232 |
| 325 | Ga0207712_10510257 | 3300025961 | Bacteria | 1029 |
| 326 | Ga0207702_10003421 | 3300026078 | Bacteria | 14512 |
| 327 | Ga0207702_10265259 | 3300026078 | Bacteria | 1618 |
| 328 | Ga0207702_10403042 | 3300026078 | Bacteria | 1319 |
| 329 | Ga0207641_10166411 | 3300026088 | Bacteria | 2008 |
| 330 | Ga0207648_10113660 | 3300026089 | Bacteria | 2378 |
| 331 | Ga0207676_10188017 | 3300026095 | Bacteria | 1815 |
| 332 | Ga0207676_10615650 | 3300026095 | Bacteria | 1044 |
| 333 | Ga0207674_10002514 | 3300026116 | Bacteria | 23121 |
| 334 | Ga0207674_10169424 | 3300026116 | Bacteria | 2137 |
| 335 | Ga0207675_100011261 | 3300026118 | Bacteria | 8375 |
| 336 | Ga0207683_10003882 | 3300026121 | Bacteria | 12964 |
| 337 | Ga0207428_10019154 | 3300027907 | Bacteria | 5835 |
| 338 | Ga0207428_10063372 | 3300027907 | Bacteria | 2921 |
| 339 | Ga0268265_10030286 | 3300028380 | Bacteria | 3896 |
| 340 | Ga0268264_10117699 | 3300028381 | Bacteria | 2337 |
| 341 | Ga0265326_10002763 | 3300028558 | Bacteria | 5882 |
| 342 | Ga0265334_10002724 | 3300028573 | Bacteria | 8166 |
| 343 | Ga0265323_10048022 | 3300028653 | Bacteria | 1525 |
| 344 | Ga0307515_10000025 | 3300028794 | Bacteria | 390205 |
| 345 | Ga0265338_10003321 | 3300028800 | Bacteria | 22756 |
| 346 | Ga0265324_10001090 | 3300029957 | Bacteria | 16333 |
| 347 | Ga0307512_10147525 | 3300030522 | Bacteria | 1418 |
| 348 | Ga0307512_10148019 | 3300030522 | Bacteria | 1414 |
| 349 | Ga0265332_10011997 | 3300031238 | Bacteria | 3847 |
| 350 | Ga0265320_10009760 | 3300031240 | Bacteria | 5759 |
| 351 | Ga0265325_10017636 | 3300031241 | Bacteria | 3967 |
| 352 | Ga0265340_10002754 | 3300031247 | Bacteria | 10010 |
| 353 | Ga0307509_10005795 | 3300031507 | Bacteria | 16965 |
| 354 | Ga0307509_10024776 | 3300031507 | Bacteria | 6714 |
| 355 | Ga0307509_10027298 | 3300031507 | Bacteria | 6352 |
| 356 | Ga0307508_10044859 | 3300031616 | Bacteria | 3952 |
| 357 | Ga0307514_10054033 | 3300031649 | Bacteria | 3097 |
| 358 | Ga0265314_10052920 | 3300031711 | Bacteria | 2819 |
| 359 | Ga0265342_10011942 | 3300031712 | Bacteria | 5903 |
| 360 | Ga0307516_10020320 | 3300031730 | Bacteria | 6860 |
| 361 | Ga0307518_10107206 | 3300031838 | Bacteria | 1993 |
| 362 | Ga0307518_10191997 | 3300031838 | Bacteria | 1367 |
| 363 | Ga0307507_10032048 | 3300033179 | Bacteria | 5500 |
| 364 | Ga0307510_10031901 | 3300033180 | Bacteria | 5943 |
| 365 | Ga0316214_1001741 | 3300033545 | Bacteria | 2595 |
| 366 | Ga0373930_0006633 | 3300034816 | Bacteria | 1966 |
| 367 | Ga0373930_0011325 | 3300034816 | Bacteria | 1609 |
| 368 | Ga0373948_0016751 | 3300034817 | Unclassified | 1358 |
| 369 | Ga0373948_0041943 | 3300034817 | Unclassified | 960 |
| 370 | Ga0373958_0019561 | 3300034819 | Bacteria | 1239 |
| 371 | Ga0373959_0005951 | 3300034820 | Bacteria | 2011 |
| 372 | Ga0373959_0041693 | 3300034820 | Bacteria | 965 |
| 373 | Ga0373926_0000563 | 3300035083 | Bacteria | 9979 |
| 374 | Ga0373929_0053381 | 3300035085 | Bacteria | 929 |
| 375 | Ga0373934_0002721 | 3300035086 | Bacteria | 6485 |
| 376 | Ga0373934_0010227 | 3300035086 | Bacteria | 3521 |
| 377 | Ga0373934_0071332 | 3300035086 | Bacteria | 1390 |
| 378 | Ga0373934_0088389 | 3300035086 | Bacteria | 1248 |
| 379 | Ga0373934_0112245 | 3300035086 | Bacteria | 1106 |
| 380 | Ga0373940_0136341 | 3300035088 | Bacteria | 772 |
| 381 | Ga0373944_0001459 | 3300035089 | Bacteria | 5971 |
| 382 | Ga0373951_0024200 | 3300035091 | Bacteria | 1405 |
| 383 | Ga0373952_0025029 | 3300035092 | Bacteria | 1286 |
| 384 | Ga0373923_0000138 | 3300035111 | Bacteria | 13772 |
| 385 | Ga0373923_0029016 | 3300035111 | Bacteria | 2216 |
| 386 | Ga0373923_0210142 | 3300035111 | Unclassified | 902 |
| 387 | Ga0373932_0035129 | 3300035112 | Bacteria | 1416 |
| 388 | Ga0373932_0130883 | 3300035112 | Bacteria | 845 |
| 389 | Ga0373936_0000260 | 3300035113 | Bacteria | 17309 |
| 390 | Ga0373936_0014456 | 3300035113 | Bacteria | 3018 |
| 391 | Ga0373936_0164002 | 3300035113 | Bacteria | 969 |
| 392 | Ga0373939_0010441 | 3300035114 | Bacteria | 2322 |
| 393 | Ga0373941_0048869 | 3300035115 | Bacteria | 1337 |
| 394 | Ga0373945_0000382 | 3300035116 | Bacteria | 12689 |
| 395 | Ga0373945_0029548 | 3300035116 | Bacteria | 1927 |
| 396 | Ga0373945_0054879 | 3300035116 | Bacteria | 1474 |
| 397 | Ga0373953_0040143 | 3300035117 | Bacteria | 1858 |
| 398 | Ga0373953_0045145 | 3300035117 | Bacteria | 1764 |
| 399 | Ga0373953_0145051 | 3300035117 | Bacteria | 1016 |
| 400 | Ga0373954_0004738 | 3300035118 | Bacteria | 5864 |
| 401 | Ga0373954_0066368 | 3300035118 | Bacteria | 1709 |
| 402 | Ga0373954_0245910 | 3300035118 | Unclassified | 880 |
| 403 | Ga0373956_0005544 | 3300035119 | Bacteria | 5047 |
| 404 | Ga0373956_0040068 | 3300035119 | Bacteria | 2077 |
| 405 | Ga0373956_0040069 | 3300035119 | Bacteria | 2077 |
| 406 | Ga0373957_0004576 | 3300035120 | Bacteria | 4218 |
| 407 | Ga0373957_0011022 | 3300035120 | Bacteria | 3005 |
| 408 | Ga0373957_0048327 | 3300035120 | Bacteria | 1621 |
| 409 | Ga0373960_0014084 | 3300035121 | Bacteria | 2019 |
| 410 | Ga0373960_0032427 | 3300035121 | Bacteria | 1467 |
| 411 | Ga0373960_0116654 | 3300035121 | Bacteria | 882 |
| 412 | Ga0373943_0000338 | 3300035170 | Bacteria | 19583 |
| 413 | Ga0373943_0128909 | 3300035170 | Bacteria | 1352 |
| 414 | Ga0373943_0190316 | 3300035170 | Bacteria | 1131 |
| 415 | Ga0373946_0000449 | 3300035171 | Bacteria | 13548 |
| 416 | Ga0373946_0046455 | 3300035171 | Bacteria | 1799 |
| 417 | Ga0373946_0140298 | 3300035171 | Unclassified | 1120 |
| 418 | Ga0373955_0000247 | 3300035172 | Bacteria | 22475 |
| 419 | Ga0373955_0005966 | 3300035172 | Bacteria | 5520 |
| 420 | Ga0373955_0177934 | 3300035172 | Bacteria | 1261 |
| 421 | Ga0373961_0058166 | 3300035241 | Bacteria | 1165 |
| 422 | Ga0373961_0059228 | 3300035241 | Bacteria | 1157 |
| 423 | Ga0373961_0069339 | 3300035241 | Bacteria | 1087 |
| 424 | Ga0373962_0049264 | 3300035242 | Bacteria | 1210 |
| 425 | Ga0373924_0007858 | 3300035410 | Bacteria | 3858 |
| 426 | Ga0373924_0008335 | 3300035410 | Bacteria | 3762 |
| 427 | Ga0373931_0011867 | 3300035691 | Bacteria | 4213 |
| 428 | Ga0373931_0053170 | 3300035691 | Bacteria | 2161 |
| 429 | Ga0373931_0173118 | 3300035691 | Bacteria | 1273 |
| 430 | Ga0373931_0175253 | 3300035691 | Unclassified | 1266 |
| 431 | Ga0373935_0002321 | 3300035692 | Bacteria | 10864 |
| 432 | Ga0373935_0104689 | 3300035692 | Bacteria | 1870 |
| 433 | Ga0373935_0130419 | 3300035692 | Bacteria | 1688 |
| 434 | Ga0373935_0197921 | 3300035692 | Bacteria | 1387 |
| 435 | Ga0373935_0204105 | 3300035692 | Unclassified | 1367 |
| 436 | Ga0373935_0225374 | 3300035692 | Bacteria | 1304 |
| 437 | Ga0373927_0002685 | 3300035695 | Bacteria | 12969 |
| 438 | Ga0373927_0064934 | 3300035695 | Bacteria | 2361 |
| 439 | Ga0373927_0257522 | 3300035695 | Bacteria | 1147 |
| 440 | Ga0373933_0008868 | 3300035724 | Bacteria | 5483 |
| 441 | Ga0373933_0052600 | 3300035724 | Bacteria | 2438 |
| 442 | Ga0373933_0202153 | 3300035724 | Bacteria | 1271 |
| 443 | Ga0373933_0325112 | 3300035724 | Unclassified | 997 |
| 444 | Ga0373947_0000950 | 3300035725 | Bacteria | 17641 |
| 445 | Ga0373947_0016693 | 3300035725 | Bacteria | 4219 |
| 446 | Ga0373937_0022277 | 3300036401 | Bacteria | 5695 |
| 447 | Ga0373937_0074449 | 3300036401 | Bacteria | 3133 |
| 448 | Ga0373937_0188515 | 3300036401 | Bacteria | 1937 |
| 449 | Ga0373937_0232435 | 3300036401 | Bacteria | 1736 |
| 450 | Ga0373925_0002214 | 3300037068 | Bacteria | 15779 |
| 451 | Ga0373925_0066728 | 3300037068 | Unclassified | 2712 |
| 452 | Ga0373925_0113766 | 3300037068 | Bacteria | 2093 |
| 453 | Ga0373925_0238610 | 3300037068 | Bacteria | 1455 |
| 454 | Ga0373925_0262955 | 3300037068 | Bacteria | 1386 |
| 455 | Ga0395898_0019149 | 3300037466 | Bacteria | 6969 |
| 456 | Ga0395898_0420321 | 3300037466 | Bacteria | 1274 |
| 457 | Ga0395901_0021898 | 3300038443 | Bacteria | 6551 |
| 458 | Ga0395901_0842347 | 3300038443 | Bacteria | 903 |
| 459 | Ga0242420_013948 | 3300038996 | Unclassified | 1374 |
| 460 | Ga0495592_0004407 | 3300046454 | Bacteria | 10300 |
| 461 | Ga0495592_0005094 | 3300046454 | Bacteria | 9679 |
| 462 | Ga0495592_0029490 | 3300046454 | Bacteria | 4154 |
| 463 | Ga0495592_0212262 | 3300046454 | Bacteria | 1299 |
| 464 | Ga0495592_0337394 | 3300046454 | Unclassified | 970 |
| 465 | Ga0495603_0000807 | 3300046455 | Bacteria | 17976 |
| 466 | Ga0495603_0164204 | 3300046455 | Bacteria | 1288 |
| 467 | Ga0495629_0003043 | 3300046459 | Bacteria | 12744 |
| 468 | Ga0495629_0024282 | 3300046459 | Bacteria | 4316 |
| 469 | Ga0495629_0024619 | 3300046459 | Bacteria | 4285 |
| 470 | Ga0495641_0002812 | 3300046461 | Bacteria | 13463 |
| 471 | Ga0495641_0017579 | 3300046461 | Bacteria | 3721 |
| 472 | Ga0495641_0205926 | 3300046461 | Bacteria | 882 |
| 473 | Ga0495651_0002068 | 3300046462 | Bacteria | 15476 |
| 474 | Ga0495651_0003185 | 3300046462 | Bacteria | 12611 |
| 475 | Ga0495651_0016723 | 3300046462 | Bacteria | 5680 |
| 476 | Ga0495651_0029693 | 3300046462 | Bacteria | 4263 |
| 477 | Ga0495651_0041666 | 3300046462 | Bacteria | 3566 |
| 478 | Ga0495651_0113445 | 3300046462 | Bacteria | 2000 |
| 479 | Ga0495651_0133021 | 3300046462 | Bacteria | 1813 |
| 480 | Ga0495653_0005201 | 3300046463 | Bacteria | 10581 |
| 481 | Ga0495653_0018949 | 3300046463 | Bacteria | 5585 |
| 482 | Ga0495653_0020193 | 3300046463 | Bacteria | 5400 |
| 483 | Ga0495653_0117354 | 3300046463 | Bacteria | 1901 |
| 484 | Ga0495653_0146570 | 3300046463 | Bacteria | 1653 |
| 485 | Ga0495580_0000900 | 3300046472 | Bacteria | 25880 |
| 486 | Ga0495580_0373429 | 3300046472 | Bacteria | 964 |
| 487 | Ga0495582_0001517 | 3300046473 | Bacteria | 13089 |
| 488 | Ga0495582_0067596 | 3300046473 | Bacteria | 1975 |
| 489 | Ga0495639_0002004 | 3300046475 | Bacteria | 9014 |
| 490 | Ga0495639_0059348 | 3300046475 | Bacteria | 1751 |
| 491 | Ga0495639_0301024 | 3300046475 | Bacteria | 800 |
| 492 | Ga0495662_0000841 | 3300046476 | Bacteria | 14913 |
| 493 | Ga0495662_0020363 | 3300046476 | Bacteria | 3208 |
| 494 | Ga0495662_0082595 | 3300046476 | Bacteria | 1563 |
| 495 | Ga0495662_0123812 | 3300046476 | Bacteria | 1270 |
| 496 | Ga0495664_0005250 | 3300046477 | Bacteria | 7110 |
| 497 | Ga0495664_0017309 | 3300046477 | Bacteria | 4118 |
| 498 | Ga0495664_0044201 | 3300046477 | Bacteria | 2639 |
| 499 | Ga0495664_0048796 | 3300046477 | Bacteria | 2513 |
| 500 | Ga0495664_0137323 | 3300046477 | Bacteria | 1481 |
| 501 | Ga0495594_0014289 | 3300046499 | Bacteria | 4155 |
| 502 | Ga0495583_0089991 | 3300046506 | Bacteria | 1323 |
| 503 | Ga0495608_0002059 | 3300046511 | Bacteria | 14472 |
| 504 | Ga0495608_0004213 | 3300046511 | Bacteria | 10309 |
| 505 | Ga0495608_0007093 | 3300046511 | Bacteria | 7926 |
| 506 | Ga0495608_0023289 | 3300046511 | Bacteria | 4245 |
| 507 | Ga0495608_0024191 | 3300046511 | Bacteria | 4155 |
| 508 | Ga0495618_0002349 | 3300046514 | Bacteria | 12203 |
| 509 | Ga0495618_0035706 | 3300046514 | Bacteria | 3120 |
| 510 | Ga0495618_0188046 | 3300046514 | Unclassified | 1310 |
| 511 | Ga0495628_0015167 | 3300046516 | Bacteria | 6437 |
| 512 | Ga0495628_0017101 | 3300046516 | Bacteria | 6041 |
| 513 | Ga0495628_0017671 | 3300046516 | Bacteria | 5929 |
| 514 | Ga0495628_0043710 | 3300046516 | Bacteria | 3567 |
| 515 | Ga0495628_0166918 | 3300046516 | Bacteria | 1670 |
| 516 | Ga0495628_0234992 | 3300046516 | Bacteria | 1373 |
| 517 | Ga0495630_0003797 | 3300046517 | Bacteria | 10533 |
| 518 | Ga0495630_0019142 | 3300046517 | Bacteria | 5032 |
| 519 | Ga0495630_0034335 | 3300046517 | Bacteria | 3788 |
| 520 | Ga0495630_0122457 | 3300046517 | Bacteria | 1973 |
| 521 | Ga0495630_0298528 | 3300046517 | Bacteria | 1231 |
| 522 | Ga0495666_0004983 | 3300046526 | Bacteria | 6720 |
| 523 | Ga0495652_0002650 | 3300046529 | Bacteria | 18240 |
| 524 | Ga0495652_0007644 | 3300046529 | Bacteria | 9954 |
| 525 | Ga0495652_0106784 | 3300046529 | Bacteria | 2260 |
| 526 | Ga0495652_0123900 | 3300046529 | Bacteria | 2056 |
| 527 | Ga0495652_0197131 | 3300046529 | Bacteria | 1531 |
| 528 | Ga0495652_0279392 | 3300046529 | Bacteria | 1223 |
| 529 | Ga0495665_0001060 | 3300046531 | Bacteria | 14599 |
| 530 | Ga0495665_0154554 | 3300046531 | Bacteria | 1197 |
| 531 | Ga0495640_0008444 | 3300046533 | Bacteria | 8077 |
| 532 | Ga0495640_0035232 | 3300046533 | Bacteria | 3542 |
| 533 | Ga0495640_0039115 | 3300046533 | Unclassified | 3331 |
| 534 | Ga0495640_0079129 | 3300046533 | Bacteria | 2189 |
| 535 | Ga0495640_0366150 | 3300046533 | Bacteria | 888 |
| 536 | Ga0495586_0017689 | 3300046535 | Bacteria | 3791 |
| 537 | Ga0495587_0004390 | 3300046536 | Bacteria | 9298 |
| 538 | Ga0495587_0006464 | 3300046536 | Bacteria | 7637 |
| 539 | Ga0495587_0007734 | 3300046536 | Bacteria | 6948 |
| 540 | Ga0495587_0021862 | 3300046536 | Bacteria | 3945 |
| 541 | Ga0495587_0036137 | 3300046536 | Bacteria | 2972 |
| 542 | Ga0495587_0151360 | 3300046536 | Bacteria | 1322 |
| 543 | Ga0495645_0004966 | 3300046543 | Bacteria | 9105 |
| 544 | Ga0495645_0005579 | 3300046543 | Bacteria | 8657 |
| 545 | Ga0495645_0015554 | 3300046543 | Bacteria | 5413 |
| 546 | Ga0495645_0044950 | 3300046543 | Bacteria | 3221 |
| 547 | Ga0495645_0096887 | 3300046543 | Bacteria | 2101 |
| 548 | Ga0495645_0152117 | 3300046543 | Bacteria | 1606 |
| 549 | Ga0495667_0000535 | 3300046559 | Bacteria | 24277 |
| 550 | Ga0495667_0003519 | 3300046559 | Bacteria | 10510 |
| 551 | Ga0495667_0006700 | 3300046559 | Bacteria | 7817 |
| 552 | Ga0495667_0022592 | 3300046559 | Bacteria | 4238 |
| 553 | Ga0495667_0231445 | 3300046559 | Bacteria | 1178 |
| 554 | Ga0495667_0307202 | 3300046559 | Bacteria | 1004 |
| 555 | Ga0495667_0355550 | 3300046559 | Bacteria | 925 |
| 556 | Ga0495634_0002093 | 3300046642 | Bacteria | 16868 |
| 557 | Ga0495634_0008783 | 3300046642 | Bacteria | 7491 |
| 558 | Ga0495634_0059852 | 3300046642 | Bacteria | 2535 |
| 559 | Ga0495634_0108400 | 3300046642 | Bacteria | 1788 |
| 560 | Ga0495625_0042952 | 3300046660 | Bacteria | 3281 |
| 561 | Ga0495635_0004803 | 3300046663 | Bacteria | 9397 |
| 562 | Ga0495635_0011160 | 3300046663 | Bacteria | 6298 |
| 563 | Ga0495635_0014678 | 3300046663 | Bacteria | 5480 |
| 564 | Ga0495635_0016198 | 3300046663 | Bacteria | 5203 |
| 565 | Ga0495635_0060631 | 3300046663 | Bacteria | 2599 |
| 566 | Ga0495635_0076268 | 3300046663 | Bacteria | 2297 |
| 567 | Ga0495635_0077629 | 3300046663 | Bacteria | 2274 |
| 568 | Ga0495588_0021191 | 3300046674 | Bacteria | 3200 |
| 569 | Ga0495657_0003052 | 3300046675 | Bacteria | 13857 |
| 570 | Ga0495657_0003639 | 3300046675 | Bacteria | 12514 |
| 571 | Ga0495657_0004393 | 3300046675 | Bacteria | 11252 |
| 572 | Ga0495657_0013700 | 3300046675 | Bacteria | 5972 |
| 573 | Ga0495657_0218126 | 3300046675 | Unclassified | 1157 |
| 574 | Ga0495599_0008591 | 3300046678 | Bacteria | 6216 |
| 575 | Ga0495599_0019855 | 3300046678 | Bacteria | 4185 |
| 576 | Ga0495599_0076132 | 3300046678 | Bacteria | 2095 |
| 577 | Ga0495623_0007377 | 3300046679 | Bacteria | 7138 |
| 578 | Ga0495623_0010945 | 3300046679 | Bacteria | 5870 |
| 579 | Ga0495623_0026213 | 3300046679 | Bacteria | 3753 |
| 580 | Ga0495646_0012463 | 3300046680 | Bacteria | 5406 |
| 581 | Ga0495646_0016915 | 3300046680 | Bacteria | 4630 |
| 582 | Ga0495646_0018766 | 3300046680 | Bacteria | 4381 |
| 583 | Ga0495646_0023331 | 3300046680 | Bacteria | 3896 |
| 584 | Ga0495646_0061894 | 3300046680 | Bacteria | 2227 |
| 585 | Ga0495646_0145344 | 3300046680 | Bacteria | 1322 |
| 586 | Ga0495647_0092807 | 3300046681 | Bacteria | 1240 |
| 587 | Ga0495647_0103195 | 3300046681 | Bacteria | 1183 |
| 588 | Ga0495658_0002629 | 3300046683 | Bacteria | 9022 |
| 589 | Ga0495658_0195001 | 3300046683 | Bacteria | 1261 |
| 590 | Ga0495658_0259355 | 3300046683 | Bacteria | 1094 |
| 591 | Ga0495613_0005707 | 3300046689 | Bacteria | 9332 |
| 592 | Ga0495613_0055431 | 3300046689 | Bacteria | 2912 |
| 593 | Ga0495624_0001642 | 3300046690 | Bacteria | 17151 |
| 594 | Ga0495624_0080649 | 3300046690 | Bacteria | 2016 |
| 595 | Ga0495624_0386267 | 3300046690 | Bacteria | 841 |
| 596 | Ga0495671_0015064 | 3300046692 | Bacteria | 4151 |
| 597 | Ga0495600_0002380 | 3300046809 | Bacteria | 10760 |
| 598 | Ga0495600_0017431 | 3300046809 | Bacteria | 4568 |
| 599 | Ga0495600_0054473 | 3300046809 | Bacteria | 2612 |
| 600 | Ga0495600_0054496 | 3300046809 | Bacteria | 2612 |
| 601 | Ga0495581_0000496 | 3300047315 | Bacteria | 20083 |
| 602 | Ga0495581_0016685 | 3300047315 | Bacteria | 4269 |
| 603 | Ga0495604_0009559 | 3300047317 | Bacteria | 7668 |
| 604 | Ga0495604_0030248 | 3300047317 | Bacteria | 4302 |
| 605 | Ga0495604_0030633 | 3300047317 | Bacteria | 4271 |
| 606 | Ga0495636_0109717 | 3300047318 | Bacteria | 1213 |
| 607 | Ga0495674_0009685 | 3300047319 | Bacteria | 9146 |
| 608 | Ga0495674_0014906 | 3300047319 | Bacteria | 7273 |
| 609 | Ga0495674_0026557 | 3300047319 | Bacteria | 5297 |
| 610 | Ga0495674_0056522 | 3300047319 | Bacteria | 3436 |
| 611 | Ga0495674_0058292 | 3300047319 | Bacteria | 3376 |
| 612 | Ga0495674_0073406 | 3300047319 | Bacteria | 2949 |
| 613 | Ga0495674_0102244 | 3300047319 | Bacteria | 2437 |
| 614 | Ga0495674_0360174 | 3300047319 | Bacteria | 1179 |
| 615 | Ga0495676_0000700 | 3300047321 | Bacteria | 27875 |
| 616 | Ga0495676_0259659 | 3300047321 | Bacteria | 1182 |
| 617 | Ga0495680_0001524 | 3300047322 | Bacteria | 24781 |
| 618 | Ga0495680_0007765 | 3300047322 | Bacteria | 9794 |
| 619 | Ga0495680_0022504 | 3300047322 | Bacteria | 5250 |
| 620 | Ga0495680_0156798 | 3300047322 | Bacteria | 1655 |
| 621 | Ga0495687_001618 | 3300047443 | Bacteria | 20303 |
| 622 | Ga0495675_0002613 | 3300047444 | Bacteria | 10793 |
| 623 | Ga0495675_0004210 | 3300047444 | Bacteria | 8706 |
| 624 | Ga0495675_0009009 | 3300047444 | Bacteria | 6204 |
| 625 | Ga0495675_0020655 | 3300047444 | Bacteria | 4192 |
| 626 | Ga0495675_0073405 | 3300047444 | Bacteria | 2158 |
| 627 | Ga0495681_0013509 | 3300047470 | Bacteria | 4732 |
| 628 | Ga0495684_0000915 | 3300047471 | Bacteria | 23961 |
| 629 | Ga0495684_0015546 | 3300047471 | Bacteria | 5859 |
| 630 | Ga0495684_0034276 | 3300047471 | Bacteria | 3895 |
| 631 | Ga0495684_0073856 | 3300047471 | Bacteria | 2590 |
| 632 | Ga0495684_0098745 | 3300047471 | Bacteria | 2207 |
| 633 | Ga0495684_0110704 | 3300047471 | Bacteria | 2072 |
| 634 | Ga0495684_0119435 | 3300047471 | Bacteria | 1986 |
| 635 | Ga0495684_0228208 | 3300047471 | Unclassified | 1363 |
| 636 | Ga0495686_0026799 | 3300047472 | Bacteria | 3770 |
| 637 | Ga0495593_0004441 | 3300047673 | Bacteria | 8330 |
| 638 | Ga0495593_0048013 | 3300047673 | Bacteria | 2269 |
| 639 | Ga0495602_0005369 | 3300048088 | Bacteria | 13451 |
| 640 | Ga0495602_0071054 | 3300048088 | Bacteria | 2974 |
| 641 | Ga0495602_0090441 | 3300048088 | Bacteria | 2542 |
| 642 | Ga0495602_0119317 | 3300048088 | Bacteria | 2125 |
| 643 | Ga0495602_0131341 | 3300048088 | Bacteria | 1997 |
| 644 | Ga0495614_0001547 | 3300048089 | Bacteria | 9978 |
| 645 | Ga0496100_0053451 | 3300048903 | Bacteria | 2630 |
| 646 | Ga0496100_0420610 | 3300048903 | Bacteria | 1020 |
| 647 | Ga0496101_0015820 | 3300048904 | Bacteria | 5091 |
| 648 | Ga0496101_0115344 | 3300048904 | Bacteria | 2026 |
| 649 | Ga0496101_0166700 | 3300048904 | Bacteria | 1691 |
| 650 | Ga0496101_0183872 | 3300048904 | Bacteria | 1610 |
| 651 | Ga0496102_0126181 | 3300048905 | Bacteria | 2392 |
| 652 | Ga0496102_0187276 | 3300048905 | Bacteria | 1951 |
| 653 | Ga0496104_0016301 | 3300048907 | Bacteria | 6746 |
| 654 | Ga0496104_0023541 | 3300048907 | Bacteria | 5662 |
| 655 | Ga0496104_0081059 | 3300048907 | Bacteria | 3094 |
| 656 | Ga0496104_0087655 | 3300048907 | Bacteria | 2972 |
| 657 | Ga0496105_0002382 | 3300048908 | Bacteria | 13618 |
| 658 | Ga0496105_0008747 | 3300048908 | Bacteria | 7878 |
| 659 | Ga0496105_0057654 | 3300048908 | Bacteria | 3206 |
| 660 | Ga0496105_0139316 | 3300048908 | Bacteria | 1997 |
| 661 | Ga0496105_0161660 | 3300048908 | Bacteria | 1838 |
| 662 | Ga0496106_0074472 | 3300048909 | Bacteria | 2599 |
| 663 | Ga0496106_0077155 | 3300048909 | Bacteria | 2554 |
| 664 | Ga0496107_0133836 | 3300048910 | Bacteria | 1831 |
| 665 | Ga0496107_0163054 | 3300048910 | Unclassified | 1653 |
| 666 | Ga0496108_0027758 | 3300048911 | Bacteria | 4678 |
| 667 | Ga0496108_0033511 | 3300048911 | Bacteria | 4267 |
| 668 | Ga0496108_0035960 | 3300048911 | Bacteria | 4119 |
| 669 | Ga0496108_0470150 | 3300048911 | Bacteria | 1098 |
| 670 | Ga0496109_0053726 | 3300048912 | Bacteria | 3675 |
| 671 | Ga0496109_0059825 | 3300048912 | Bacteria | 3480 |
| 672 | Ga0496109_0093262 | 3300048912 | Bacteria | 2786 |
| 673 | Ga0496109_0122305 | 3300048912 | Bacteria | 2425 |
| 674 | Ga0496110_0009446 | 3300048913 | Bacteria | 7898 |
| 675 | Ga0496110_0026291 | 3300048913 | Bacteria | 4978 |
| 676 | Ga0496110_0075195 | 3300048913 | Bacteria | 3001 |
| 677 | Ga0496110_0597873 | 3300048913 | Bacteria | 1001 |
| 678 | Ga0496111_0010884 | 3300048914 | Bacteria | 6118 |
| 679 | Ga0496111_0096881 | 3300048914 | Bacteria | 2165 |
| 680 | Ga0496111_0100874 | 3300048914 | Unclassified | 2120 |
| 681 | Ga0496112_0023220 | 3300048915 | Bacteria | 5921 |
| 682 | Ga0496112_0030981 | 3300048915 | Bacteria | 5183 |
| 683 | Ga0496112_0084094 | 3300048915 | Bacteria | 3147 |
| 684 | Ga0496113_0010824 | 3300048916 | Bacteria | 6052 |
| 685 | Ga0496113_0051788 | 3300048916 | Bacteria | 3064 |
| 686 | Ga0496113_0199409 | 3300048916 | Bacteria | 1591 |
| 687 | Ga0496113_0334964 | 3300048916 | Bacteria | 1213 |
| 688 | Ga0496113_0367986 | 3300048916 | Bacteria | 1153 |
| 689 | Ga0496114_0019457 | 3300048917 | Bacteria | 5500 |
| 690 | Ga0496114_0255125 | 3300048917 | Bacteria | 1543 |
| 691 | Ga0496115_0012296 | 3300048918 | Bacteria | 6437 |
| 692 | Ga0496115_0054354 | 3300048918 | Bacteria | 3215 |
| 693 | Ga0496126_0465835 | 3300048929 | Bacteria | 1015 |
| 694 | Ga0501070_0527168 | 3300049586 | Bacteria | 947 |
| 695 | nmdc:mga05p37_15272_c1 | 3300050507 | Bacteria | 9225 |
| 696 | nmdc:mga05p37_36127_c1 | 3300050507 | Bacteria | 6062 |
| 697 | nmdc:mga08y16_122497_c1 | 3300050511 | Bacteria | 2706 |
| 698 | nmdc:mga08y16_597154_c1 | 3300050511 | Bacteria | 1113 |
| 699 | nmdc:mga0n895_12070_c1 | 3300050512 | Bacteria | 7436 |
| 700 | nmdc:mga0n895_132658_c1 | 3300050512 | Bacteria | 2517 |
| 701 | nmdc:mga0rr50_10489_c1 | 3300050513 | Bacteria | 5881 |
| 702 | nmdc:mga0rr50_162463_c1 | 3300050513 | Bacteria | 1814 |
| 703 | nmdc:mga0rr50_285507_c1 | 3300050513 | Bacteria | 1378 |
| 704 | nmdc:mga0rr50_291231_c1 | 3300050513 | Bacteria | 1364 |
| 705 | nmdc:mga0rr50_7420_c1 | 3300050513 | Bacteria | 6763 |
| 706 | nmdc:mga08x19_3432_c1 | 3300050514 | Bacteria | 9447 |
| 707 | nmdc:mga08x19_79008_c1 | 3300050514 | Bacteria | 2157 |
| 708 | nmdc:mga0a205_121677_c1 | 3300050515 | Bacteria | 2509 |
| 709 | nmdc:mga0a205_14730_c1 | 3300050515 | Bacteria | 7296 |
| 710 | nmdc:mga0a205_202254_c1 | 3300050515 | Bacteria | 1876 |
| 711 | Ga0495601_0000170 | 3300053077 | Bacteria | 34639 |
| 712 | Ga0495601_0010149 | 3300053077 | Bacteria | 5595 |
| 713 | Ga0495601_0011922 | 3300053077 | Bacteria | 5210 |
| 714 | Ga0495601_0094753 | 3300053077 | Bacteria | 1924 |
| 715 | Ga0495601_0216695 | 3300053077 | Bacteria | 1250 |
| 716 | Ga0495601_0500177 | 3300053077 | Bacteria | 784 |
| 717 | Ga0495612_0002763 | 3300053078 | Bacteria | 7274 |
| 718 | Ga0495612_0010441 | 3300053078 | Bacteria | 3756 |
| 719 | Ga0495612_0062640 | 3300053078 | Bacteria | 1542 |
| 720 | Ga0495612_0066327 | 3300053078 | Bacteria | 1500 |
| 721 | Ga0495595_0002434 | 3300053084 | Bacteria | 7270 |
| 722 | Ga0495595_0011782 | 3300053084 | Bacteria | 3663 |
| 723 | Ga0495595_0052420 | 3300053084 | Bacteria | 1893 |
| 724 | Ga0495595_0096431 | 3300053084 | Bacteria | 1423 |
| 725 | Ga0495619_0010380 | 3300053085 | Bacteria | 5862 |
| 726 | Ga0495619_0104282 | 3300053085 | Bacteria | 1932 |
| 727 | Ga0495619_0151829 | 3300053085 | Bacteria | 1598 |
| 728 | Ga0495619_0273579 | 3300053085 | Bacteria | 1170 |
| 729 | Ga0495619_0433674 | 3300053085 | Bacteria | 906 |
| 730 | Ga0500560_028337 | 3300053107 | Bacteria | 1671 |
| 731 | 2995469907 | 2995463766 | Bacteria | 8577691 |
| 732 | Ga0070698_100260419 | |||
| 733 | Ga0070658_10164299 | |||
| 734 | Ga0070676_10305535 | |||
| 735 | Ga0070683_100020631 | |||
| 736 | Ga0068869_100087791 | |||
| 737 | Ga0070666_10072635 | |||
| 738 | Ga0070682_100224028 | |||
| 739 | Ga0070682_100435392 | |||
| 740 | Ga0070660_100140726 | |||
| 741 | Ga0070691_10039712 | |||
| 742 | Ga0070687_100037466 | |||
| 743 | Ga0070661_100065335 | |||
| 744 | Ga0070675_100012645 | |||
| 745 | Ga0070671_100061275 | |||
| 746 | Ga0070709_10000519 | |||
| 747 | Ga0070709_10003556 | |||
| 748 | Ga0070709_10027027 | |||
| 749 | Ga0070709_10049576 | |||
| 750 | Ga0070709_10292968 | |||
| 751 | Ga0070709_10349897 | |||
| 752 | Ga0070714_100007377 | |||
| 753 | Ga0070714_100011224 | |||
| 754 | Ga0070714_100020560 | |||
| 755 | Ga0070714_100068935 | |||
| 756 | Ga0070714_100130268 | |||
| 757 | Ga0070714_100230003 | |||
| 758 | Ga0070714_100299612 | |||
| 759 | Ga0070714_100361788 | |||
| 760 | Ga0070714_100493189 | |||
| 761 | Ga0070714_100570017 | |||
| 762 | Ga0070714_100595443 | |||
| 763 | Ga0070714_100609994 | |||
| 764 | Ga0070713_100003287 | |||
| 765 | Ga0070713_100027643 | |||
| 766 | Ga0070713_100049735 | |||
| 767 | Ga0070713_100051364 | |||
| 768 | Ga0070713_100073961 | |||
| 769 | Ga0070713_100144635 | |||
| 770 | Ga0070713_100218951 | |||
| 771 | Ga0070713_100300186 | |||
| 772 | Ga0070713_100446984 | |||
| 773 | Ga0070713_100477540 | |||
| 774 | Ga0070713_100546362 | |||
| 775 | Ga0070713_100790301 | |||
| 776 | Ga0070710_10003326 | |||
| 777 | Ga0070710_10005018 | |||
| 778 | Ga0070710_10020819 | |||
| 779 | Ga0070710_10023187 | |||
| 780 | Ga0070710_10024557 | |||
| 781 | Ga0070710_10042270 | |||
| 782 | Ga0070710_10188133 | |||
| 783 | Ga0070710_10214850 | |||
| 784 | Ga0070710_10215672 | |||
| 785 | Ga0070710_10237886 | |||
| 786 | Ga0070710_10577714 | |||
| 787 | Ga0070711_100001617 | |||
| 788 | Ga0070711_100018983 | |||
| 789 | Ga0070711_100023028 | |||
| 790 | Ga0070711_100063446 | |||
| 791 | Ga0070711_100079709 | |||
| 792 | Ga0070711_100111537 | |||
| 793 | Ga0070711_100179689 | |||
| 794 | Ga0070711_100206358 | |||
| 795 | Ga0070711_100388200 | |||
| 796 | Ga0070711_100447579 | |||
| 797 | Ga0070711_100525591 | |||
| 798 | Ga0070694_100048632 | |||
| 799 | Ga0070708_100040123 | |||
| 800 | Ga0070708_100063046 | |||
| 801 | Ga0070708_100147053 | |||
| 802 | Ga0070708_100157146 | |||
| 803 | Ga0070708_100434373 | |||
| 804 | Ga0070663_100009043 | |||
| 805 | Ga0068867_100116769 | |||
| 806 | Ga0070685_10009118 | |||
| 807 | Ga0070706_100011892 | |||
| 808 | Ga0070706_100098408 | |||
| 809 | Ga0070706_100344447 | |||
| 810 | Ga0070706_100384681 | |||
| 811 | Ga0070707_100071475 | |||
| 812 | Ga0070707_100079023 | |||
| 813 | Ga0070707_100122791 | |||
| 814 | Ga0070707_100182048 | |||
| 815 | Ga0070698_100003651 | |||
| 816 | Ga0070698_100007107 | |||
| 817 | Ga0070698_100018380 | |||
| 818 | Ga0070698_100088610 | |||
| 819 | Ga0070698_100095093 | |||
| 820 | Ga0070698_100339772 | |||
| 821 | Ga0070698_100672862 | |||
| 822 | Ga0070699_100001109 | |||
| 823 | Ga0070699_100334504 | |||
| 824 | Ga0070679_100088807 | |||
| 825 | Ga0070679_100265096 | |||
| 826 | Ga0070684_100061882 | |||
| 827 | Ga0070684_100074897 | |||
| 828 | Ga0070697_100006772 | |||
| 829 | Ga0070697_100028961 | |||
| 830 | Ga0070697_100062070 | |||
| 831 | Ga0070672_100059725 | |||
| 832 | Ga0070686_100117012 | |||
| 833 | Ga0070695_100022206 | |||
| 834 | Ga0070695_100187125 | |||
| 835 | Ga0070696_100321015 | |||
| 836 | Ga0070693_100011079 | |||
| 837 | Ga0070693_100080034 | |||
| 838 | Ga0070665_100346149 | |||
| 839 | Ga0070704_100039219 | |||
| 840 | Ga0070704_100510570 | |||
| 841 | Ga0068855_100193110 | |||
| 842 | Ga0068855_100228866 | |||
| 843 | Ga0070664_100123436 | |||
| 844 | Ga0068854_100069753 | |||
| 845 | Ga0068856_100033830 | |||
| 846 | Ga0068856_100254481 | |||
| 847 | Ga0068856_100757388 | |||
| 848 | Ga0070702_100444152 | |||
| 849 | Ga0068864_100225622 | |||
| 850 | Ga0068864_101113345 | |||
| 851 | Ga0068863_100743215 | |||
| 852 | Ga0068858_100111597 | |||
| 853 | Ga0068860_100265220 | |||
| 854 | Ga0081539_10014255 | |||
| 855 | Ga0081539_10052386 | |||
| 856 | Ga0070717_10039870 | |||
| 857 | Ga0070717_10050438 | |||
| 858 | Ga0070717_10053387 | |||
| 859 | Ga0070717_10084127 | |||
| 860 | Ga0070717_10194562 | |||
| 861 | Ga0070717_10319776 | |||
| 862 | Ga0070717_10327744 | |||
| 863 | Ga0070717_10362417 | |||
| 864 | Ga0070717_10365391 | |||
| 865 | Ga0070717_10366036 | |||
| 866 | Ga0070717_10458484 | |||
| 867 | Ga0070717_10486574 | |||
| 868 | Ga0070717_10721152 | |||
| 869 | Ga0070715_10046498 | |||
| 870 | Ga0070716_100003362 | |||
| 871 | Ga0070716_100021675 | |||
| 872 | Ga0070716_100023254 | |||
| 873 | Ga0070716_100023690 | |||
| 874 | Ga0070716_100051410 | |||
| 875 | Ga0070716_100287999 | |||
| 876 | Ga0070712_100003688 | |||
| 877 | Ga0070712_100005273 | |||
| 878 | Ga0070712_100034961 | |||
| 879 | Ga0070712_100068522 | |||
| 880 | Ga0070712_100075631 | |||
| 881 | Ga0070712_100149079 | |||
| 882 | Ga0070712_100203652 | |||
| 883 | Ga0070712_100231900 | |||
| 884 | Ga0070712_100253865 | |||
| 885 | Ga0070712_100383386 | |||
| 886 | Ga0070712_100420371 | |||
| 887 | Ga0070712_100483223 | |||
| 888 | Ga0070712_100643300 | |||
| 889 | Ga0097621_100167706 | |||
| 890 | Ga0097621_100416995 | |||
| 891 | Ga0068871_100041269 | |||
| 892 | Ga0075428_100258068 | |||
| 893 | Ga0075433_10152520 | |||
| 894 | Ga0075433_10251634 | |||
| 895 | Ga0075434_100042469 | |||
| 896 | Ga0075434_100046369 | |||
| 897 | Ga0075434_100103875 | |||
| 898 | Ga0075434_100160434 | |||
| 899 | Ga0075434_100175900 | |||
| 900 | Ga0075434_100211115 | |||
| 901 | Ga0075434_100679968 | |||
| 902 | Ga0068865_100196664 | |||
| 903 | Ga0075436_100011304 | |||
| 904 | Ga0075436_100438795 | |||
| 905 | Ga0075435_100004335 | |||
| 906 | Ga0075435_100006530 | |||
| 907 | Ga0075435_100105276 | |||
| 908 | Ga0075435_100288048 | |||
| 909 | Ga0099794_10049480 | |||
| 910 | Ga0099795_10042114 | |||
| 911 | Ga0099795_10044724 | |||
| 912 | Ga0099795_10065244 | |||
| 913 | Ga0105250_10110454 | |||
| 914 | Ga0111539_10693624 | |||
| 915 | Ga0105245_10203646 | |||
| 916 | Ga0105247_10382607 | |||
| 917 | Ga0114129_10054553 | |||
| 918 | Ga0114129_10103529 | |||
| 919 | Ga0114129_10110025 | |||
| 920 | Ga0114129_10454028 | |||
| 921 | Ga0105243_10543950 | |||
| 922 | Ga0105242_10017513 | |||
| 923 | Ga0105248_10075506 | |||
| 924 | Ga0105237_10245574 | |||
| 925 | Ga0105237_10502599 | |||
| 926 | Ga0105238_10413590 | |||
| 927 | Ga0105249_10496445 | |||
| 928 | Ga0099796_10029338 | |||
| 929 | Ga0105239_10673657 | |||
| 930 | Ga0157370_10129527 | |||
| 931 | Ga0157370_10307545 | |||
| 932 | Ga0157370_10785698 | |||
| 933 | Ga0157369_10162778 | |||
| 934 | Ga0157369_10277498 | |||
| 935 | Ga0157369_10299575 | |||
| 936 | Ga0157374_10011866 | |||
| 937 | Ga0157374_10108536 | |||
| 938 | Ga0157374_10120997 | |||
| 939 | Ga0157378_10070233 | |||
| 940 | Ga0163162_10444677 | |||
| 941 | Ga0157372_10529887 | |||
| 942 | Ga0157372_10711908 | |||
| 943 | Ga0163163_10218141 | |||
| 944 | Ga0163163_10396634 | |||
| 945 | Ga0157379_10168768 | |||
| 946 | Ga0157376_10081231 | |||
| 947 | Ga0163161_10333690 | |||
| 948 | Ga0206354_10062606 | |||
| 949 | Ga0207653_10006364 | |||
| 950 | Ga0207653_10016302 | |||
| 951 | Ga0207692_10001484 | |||
| 952 | Ga0207692_10002038 | |||
| 953 | Ga0207692_10005610 | |||
| 954 | Ga0207692_10014954 | |||
| 955 | Ga0207692_10027388 | |||
| 956 | Ga0207692_10059765 | |||
| 957 | Ga0207692_10103381 | |||
| 958 | Ga0207692_10206214 | |||
| 959 | Ga0207692_10254172 | |||
| 960 | Ga0207688_10007763 | |||
| 961 | Ga0207680_10399545 | |||
| 962 | Ga0207680_10406906 | |||
| 963 | Ga0207647_10077272 | |||
| 964 | Ga0207685_10000265 | |||
| 965 | Ga0207685_10015908 | |||
| 966 | Ga0207685_10055014 | |||
| 967 | Ga0207685_10168599 | |||
| 968 | Ga0207699_10002179 | |||
| 969 | Ga0207699_10002691 | |||
| 970 | Ga0207699_10003494 | |||
| 971 | Ga0207699_10008409 | |||
| 972 | Ga0207699_10018567 | |||
| 973 | Ga0207699_10022519 | |||
| 974 | Ga0207699_10185136 | |||
| 975 | Ga0207699_10256890 | |||
| 976 | Ga0207643_10057441 | |||
| 977 | Ga0207705_10022003 | |||
| 978 | Ga0207684_10009226 | |||
| 979 | Ga0207684_10053953 | |||
| 980 | Ga0207684_10060888 | |||
| 981 | Ga0207684_10118934 | |||
| 982 | Ga0207695_10259454 | |||
| 983 | Ga0207671_10057865 | |||
| 984 | Ga0207671_10123046 | |||
| 985 | Ga0207693_10002900 | |||
| 986 | Ga0207693_10008646 | |||
| 987 | Ga0207693_10017845 | |||
| 988 | Ga0207693_10022280 | |||
| 989 | Ga0207693_10029737 | |||
| 990 | Ga0207693_10294901 | |||
| 991 | Ga0207693_10355324 | |||
| 992 | Ga0207693_10362719 | |||
| 993 | Ga0207693_10555180 | |||
| 994 | Ga0207663_10003761 | |||
| 995 | Ga0207663_10016851 | |||
| 996 | Ga0207663_10027101 | |||
| 997 | Ga0207663_10028663 | |||
| 998 | Ga0207663_10051969 | |||
| 999 | Ga0207663_10059419 | |||
| 1000 | Ga0207663_10068437 | |||
| 1001 | Ga0207663_10311272 | |||
| 1002 | Ga0207663_10350998 | |||
| 1003 | Ga0207663_10529284 | |||
| 1004 | Ga0207657_10056925 | |||
| 1005 | Ga0207649_10110119 | |||
| 1006 | Ga0207646_10000056 | |||
| 1007 | Ga0207646_10009007 | |||
| 1008 | Ga0207646_10012767 | |||
| 1009 | Ga0207646_10038138 | |||
| 1010 | Ga0207646_10073878 | |||
| 1011 | Ga0207646_10192332 | |||
| 1012 | Ga0207646_10240598 | |||
| 1013 | Ga0207646_10561014 | |||
| 1014 | Ga0207694_10311225 | |||
| 1015 | Ga0207687_10134788 | |||
| 1016 | Ga0207687_10186552 | |||
| 1017 | Ga0207700_10002372 | |||
| 1018 | Ga0207700_10003978 | |||
| 1019 | Ga0207700_10022585 | |||
| 1020 | Ga0207700_10048980 | |||
| 1021 | Ga0207700_10053598 | |||
| 1022 | Ga0207700_10076018 | |||
| 1023 | Ga0207700_10115305 | |||
| 1024 | Ga0207700_10116759 | |||
| 1025 | Ga0207700_10128929 | |||
| 1026 | Ga0207700_10158551 | |||
| 1027 | Ga0207700_10591741 | |||
| 1028 | Ga0207700_10664532 | |||
| 1029 | Ga0207664_10002873 | |||
| 1030 | Ga0207664_10004444 | |||
| 1031 | Ga0207664_10013506 | |||
| 1032 | Ga0207664_10013555 | |||
| 1033 | Ga0207664_10039251 | |||
| 1034 | Ga0207664_10063337 | |||
| 1035 | Ga0207664_10092011 | |||
| 1036 | Ga0207664_10139898 | |||
| 1037 | Ga0207664_10164763 | |||
| 1038 | Ga0207664_10272062 | |||
| 1039 | Ga0207644_10173648 | |||
| 1040 | Ga0207686_10115091 | |||
| 1041 | Ga0207665_10004036 | |||
| 1042 | Ga0207665_10004304 | |||
| 1043 | Ga0207665_10004776 | |||
| 1044 | Ga0207665_10032360 | |||
| 1045 | Ga0207665_10265365 | |||
| 1046 | Ga0207665_10275589 | |||
| 1047 | Ga0207691_10057489 | |||
| 1048 | Ga0207711_10488054 | |||
| 1049 | Ga0207689_10010039 | |||
| 1050 | Ga0207661_10068020 | |||
| 1051 | Ga0207679_10047456 | |||
| 1052 | Ga0207667_10372292 | |||
| 1053 | Ga0207667_10563635 | |||
| 1054 | Ga0207667_10584307 | |||
| 1055 | Ga0207712_10347611 | |||
| 1056 | Ga0207712_10510257 | |||
| 1057 | Ga0207702_10003421 | |||
| 1058 | Ga0207702_10265259 | |||
| 1059 | Ga0207702_10403042 | |||
| 1060 | Ga0207641_10166411 | |||
| 1061 | Ga0207648_10113660 | |||
| 1062 | Ga0207676_10188017 | |||
| 1063 | Ga0207676_10615650 | |||
| 1064 | Ga0207674_10002514 | |||
| 1065 | Ga0207674_10169424 | |||
| 1066 | Ga0207675_100011261 | |||
| 1067 | Ga0207683_10003882 | |||
| 1068 | Ga0207428_10019154 | |||
| 1069 | Ga0207428_10063372 | |||
| 1070 | Ga0268265_10030286 | |||
| 1071 | Ga0268264_10117699 | |||
| 1072 | Ga0265326_10002763 | |||
| 1073 | Ga0265334_10002724 | |||
| 1074 | Ga0265323_10048022 | |||
| 1075 | Ga0307515_10000025 | |||
| 1076 | Ga0265338_10003321 | |||
| 1077 | Ga0265324_10001090 | |||
| 1078 | Ga0307512_10147525 | |||
| 1079 | Ga0307512_10148019 | |||
| 1080 | Ga0265332_10011997 | |||
| 1081 | Ga0265320_10009760 | |||
| 1082 | Ga0265325_10017636 | |||
| 1083 | Ga0265340_10002754 | |||
| 1084 | Ga0307509_10005795 | |||
| 1085 | Ga0307509_10024776 | |||
| 1086 | Ga0307509_10027298 | |||
| 1087 | Ga0307508_10044859 | |||
| 1088 | Ga0307514_10054033 | |||
| 1089 | Ga0265314_10052920 | |||
| 1090 | Ga0265342_10011942 | |||
| 1091 | Ga0307516_10020320 | |||
| 1092 | Ga0307518_10107206 | |||
| 1093 | Ga0307518_10191997 | |||
| 1094 | Ga0307507_10032048 | |||
| 1095 | Ga0307510_10031901 | |||
| 1096 | Ga0316214_1001741 | |||
| 1097 | Ga0373930_0006633 | |||
| 1098 | Ga0373930_0011325 | |||
| 1099 | Ga0373948_0016751 | |||
| 1100 | Ga0373948_0041943 | |||
| 1101 | Ga0373958_0019561 | |||
| 1102 | Ga0373959_0005951 | |||
| 1103 | Ga0373959_0041693 | |||
| 1104 | Ga0373926_0000563 | |||
| 1105 | Ga0373929_0053381 | |||
| 1106 | Ga0373934_0002721 | |||
| 1107 | Ga0373934_0010227 | |||
| 1108 | Ga0373934_0071332 | |||
| 1109 | Ga0373934_0088389 | |||
| 1110 | Ga0373934_0112245 | |||
| 1111 | Ga0373940_0136341 | |||
| 1112 | Ga0373944_0001459 | |||
| 1113 | Ga0373951_0024200 | |||
| 1114 | Ga0373952_0025029 | |||
| 1115 | Ga0373923_0000138 | |||
| 1116 | Ga0373923_0029016 | |||
| 1117 | Ga0373923_0210142 | |||
| 1118 | Ga0373932_0035129 | |||
| 1119 | Ga0373932_0130883 | |||
| 1120 | Ga0373936_0000260 | |||
| 1121 | Ga0373936_0014456 | |||
| 1122 | Ga0373936_0164002 | |||
| 1123 | Ga0373939_0010441 | |||
| 1124 | Ga0373941_0048869 | |||
| 1125 | Ga0373945_0000382 | |||
| 1126 | Ga0373945_0029548 | |||
| 1127 | Ga0373945_0054879 | |||
| 1128 | Ga0373953_0040143 | |||
| 1129 | Ga0373953_0045145 | |||
| 1130 | Ga0373953_0145051 | |||
| 1131 | Ga0373954_0004738 | |||
| 1132 | Ga0373954_0066368 | |||
| 1133 | Ga0373954_0245910 | |||
| 1134 | Ga0373956_0005544 | |||
| 1135 | Ga0373956_0040068 | |||
| 1136 | Ga0373956_0040069 | |||
| 1137 | Ga0373957_0004576 | |||
| 1138 | Ga0373957_0011022 | |||
| 1139 | Ga0373957_0048327 | |||
| 1140 | Ga0373960_0014084 | |||
| 1141 | Ga0373960_0032427 | |||
| 1142 | Ga0373960_0116654 | |||
| 1143 | Ga0373943_0000338 | |||
| 1144 | Ga0373943_0128909 | |||
| 1145 | Ga0373943_0190316 | |||
| 1146 | Ga0373946_0000449 | |||
| 1147 | Ga0373946_0046455 | |||
| 1148 | Ga0373946_0140298 | |||
| 1149 | Ga0373955_0000247 | |||
| 1150 | Ga0373955_0005966 | |||
| 1151 | Ga0373955_0177934 | |||
| 1152 | Ga0373961_0058166 | |||
| 1153 | Ga0373961_0059228 | |||
| 1154 | Ga0373961_0069339 | |||
| 1155 | Ga0373962_0049264 | |||
| 1156 | Ga0373924_0007858 | |||
| 1157 | Ga0373924_0008335 | |||
| 1158 | Ga0373931_0011867 | |||
| 1159 | Ga0373931_0053170 | |||
| 1160 | Ga0373931_0173118 | |||
| 1161 | Ga0373931_0175253 | |||
| 1162 | Ga0373935_0002321 | |||
| 1163 | Ga0373935_0104689 | |||
| 1164 | Ga0373935_0130419 | |||
| 1165 | Ga0373935_0197921 | |||
| 1166 | Ga0373935_0204105 | |||
| 1167 | Ga0373935_0225374 | |||
| 1168 | Ga0373927_0002685 | |||
| 1169 | Ga0373927_0064934 | |||
| 1170 | Ga0373927_0257522 | |||
| 1171 | Ga0373933_0008868 | |||
| 1172 | Ga0373933_0052600 | |||
| 1173 | Ga0373933_0202153 | |||
| 1174 | Ga0373933_0325112 | |||
| 1175 | Ga0373947_0000950 | |||
| 1176 | Ga0373947_0016693 | |||
| 1177 | Ga0373937_0022277 | |||
| 1178 | Ga0373937_0074449 | |||
| 1179 | Ga0373937_0188515 | |||
| 1180 | Ga0373937_0232435 | |||
| 1181 | Ga0373925_0002214 | |||
| 1182 | Ga0373925_0066728 | |||
| 1183 | Ga0373925_0113766 | |||
| 1184 | Ga0373925_0238610 | |||
| 1185 | Ga0373925_0262955 | |||
| 1186 | Ga0395898_0019149 | |||
| 1187 | Ga0395898_0420321 | |||
| 1188 | Ga0395901_0021898 | |||
| 1189 | Ga0395901_0842347 | |||
| 1190 | Ga0242420_013948 | |||
| 1191 | Ga0495592_0004407 | |||
| 1192 | Ga0495592_0005094 | |||
| 1193 | Ga0495592_0029490 | |||
| 1194 | Ga0495592_0212262 | |||
| 1195 | Ga0495592_0337394 | |||
| 1196 | Ga0495603_0000807 | |||
| 1197 | Ga0495603_0164204 | |||
| 1198 | Ga0495629_0003043 | |||
| 1199 | Ga0495629_0024282 | |||
| 1200 | Ga0495629_0024619 | |||
| 1201 | Ga0495641_0002812 | |||
| 1202 | Ga0495641_0017579 | |||
| 1203 | Ga0495641_0205926 | |||
| 1204 | Ga0495651_0002068 | |||
| 1205 | Ga0495651_0003185 | |||
| 1206 | Ga0495651_0016723 | |||
| 1207 | Ga0495651_0029693 | |||
| 1208 | Ga0495651_0041666 | |||
| 1209 | Ga0495651_0113445 | |||
| 1210 | Ga0495651_0133021 | |||
| 1211 | Ga0495653_0005201 | |||
| 1212 | Ga0495653_0018949 | |||
| 1213 | Ga0495653_0020193 | |||
| 1214 | Ga0495653_0117354 | |||
| 1215 | Ga0495653_0146570 | |||
| 1216 | Ga0495580_0000900 | |||
| 1217 | Ga0495580_0373429 | |||
| 1218 | Ga0495582_0001517 | |||
| 1219 | Ga0495582_0067596 | |||
| 1220 | Ga0495639_0002004 | |||
| 1221 | Ga0495639_0059348 | |||
| 1222 | Ga0495639_0301024 | |||
| 1223 | Ga0495662_0000841 | |||
| 1224 | Ga0495662_0020363 | |||
| 1225 | Ga0495662_0082595 | |||
| 1226 | Ga0495662_0123812 | |||
| 1227 | Ga0495664_0005250 | |||
| 1228 | Ga0495664_0017309 | |||
| 1229 | Ga0495664_0044201 | |||
| 1230 | Ga0495664_0048796 | |||
| 1231 | Ga0495664_0137323 | |||
| 1232 | Ga0495594_0014289 | |||
| 1233 | Ga0495583_0089991 | |||
| 1234 | Ga0495608_0002059 | |||
| 1235 | Ga0495608_0004213 | |||
| 1236 | Ga0495608_0007093 | |||
| 1237 | Ga0495608_0023289 | |||
| 1238 | Ga0495608_0024191 | |||
| 1239 | Ga0495618_0002349 | |||
| 1240 | Ga0495618_0035706 | |||
| 1241 | Ga0495618_0188046 | |||
| 1242 | Ga0495628_0015167 | |||
| 1243 | Ga0495628_0017101 | |||
| 1244 | Ga0495628_0017671 | |||
| 1245 | Ga0495628_0043710 | |||
| 1246 | Ga0495628_0166918 | |||
| 1247 | Ga0495628_0234992 | |||
| 1248 | Ga0495630_0003797 | |||
| 1249 | Ga0495630_0019142 | |||
| 1250 | Ga0495630_0034335 | |||
| 1251 | Ga0495630_0122457 | |||
| 1252 | Ga0495630_0298528 | |||
| 1253 | Ga0495666_0004983 | |||
| 1254 | Ga0495652_0002650 | |||
| 1255 | Ga0495652_0007644 | |||
| 1256 | Ga0495652_0106784 | |||
| 1257 | Ga0495652_0123900 | |||
| 1258 | Ga0495652_0197131 | |||
| 1259 | Ga0495652_0279392 | |||
| 1260 | Ga0495665_0001060 | |||
| 1261 | Ga0495665_0154554 | |||
| 1262 | Ga0495640_0008444 | |||
| 1263 | Ga0495640_0035232 | |||
| 1264 | Ga0495640_0039115 | |||
| 1265 | Ga0495640_0079129 | |||
| 1266 | Ga0495640_0366150 | |||
| 1267 | Ga0495586_0017689 | |||
| 1268 | Ga0495587_0004390 | |||
| 1269 | Ga0495587_0006464 | |||
| 1270 | Ga0495587_0007734 | |||
| 1271 | Ga0495587_0021862 | |||
| 1272 | Ga0495587_0036137 | |||
| 1273 | Ga0495587_0151360 | |||
| 1274 | Ga0495645_0004966 | |||
| 1275 | Ga0495645_0005579 | |||
| 1276 | Ga0495645_0015554 | |||
| 1277 | Ga0495645_0044950 | |||
| 1278 | Ga0495645_0096887 | |||
| 1279 | Ga0495645_0152117 | |||
| 1280 | Ga0495667_0000535 | |||
| 1281 | Ga0495667_0003519 | |||
| 1282 | Ga0495667_0006700 | |||
| 1283 | Ga0495667_0022592 | |||
| 1284 | Ga0495667_0231445 | |||
| 1285 | Ga0495667_0307202 | |||
| 1286 | Ga0495667_0355550 | |||
| 1287 | Ga0495634_0002093 | |||
| 1288 | Ga0495634_0008783 | |||
| 1289 | Ga0495634_0059852 | |||
| 1290 | Ga0495634_0108400 | |||
| 1291 | Ga0495625_0042952 | |||
| 1292 | Ga0495635_0004803 | |||
| 1293 | Ga0495635_0011160 | |||
| 1294 | Ga0495635_0014678 | |||
| 1295 | Ga0495635_0016198 | |||
| 1296 | Ga0495635_0060631 | |||
| 1297 | Ga0495635_0076268 | |||
| 1298 | Ga0495635_0077629 | |||
| 1299 | Ga0495588_0021191 | |||
| 1300 | Ga0495657_0003052 | |||
| 1301 | Ga0495657_0003639 | |||
| 1302 | Ga0495657_0004393 | |||
| 1303 | Ga0495657_0013700 | |||
| 1304 | Ga0495657_0218126 | |||
| 1305 | Ga0495599_0008591 | |||
| 1306 | Ga0495599_0019855 | |||
| 1307 | Ga0495599_0076132 | |||
| 1308 | Ga0495623_0007377 | |||
| 1309 | Ga0495623_0010945 | |||
| 1310 | Ga0495623_0026213 | |||
| 1311 | Ga0495646_0012463 | |||
| 1312 | Ga0495646_0016915 | |||
| 1313 | Ga0495646_0018766 | |||
| 1314 | Ga0495646_0023331 | |||
| 1315 | Ga0495646_0061894 | |||
| 1316 | Ga0495646_0145344 | |||
| 1317 | Ga0495647_0092807 | |||
| 1318 | Ga0495647_0103195 | |||
| 1319 | Ga0495658_0002629 | |||
| 1320 | Ga0495658_0195001 | |||
| 1321 | Ga0495658_0259355 | |||
| 1322 | Ga0495613_0005707 | |||
| 1323 | Ga0495613_0055431 | |||
| 1324 | Ga0495624_0001642 | |||
| 1325 | Ga0495624_0080649 | |||
| 1326 | Ga0495624_0386267 | |||
| 1327 | Ga0495671_0015064 | |||
| 1328 | Ga0495600_0002380 | |||
| 1329 | Ga0495600_0017431 | |||
| 1330 | Ga0495600_0054473 | |||
| 1331 | Ga0495600_0054496 | |||
| 1332 | Ga0495581_0000496 | |||
| 1333 | Ga0495581_0016685 | |||
| 1334 | Ga0495604_0009559 | |||
| 1335 | Ga0495604_0030248 | |||
| 1336 | Ga0495604_0030633 | |||
| 1337 | Ga0495636_0109717 | |||
| 1338 | Ga0495674_0009685 | |||
| 1339 | Ga0495674_0014906 | |||
| 1340 | Ga0495674_0026557 | |||
| 1341 | Ga0495674_0056522 | |||
| 1342 | Ga0495674_0058292 | |||
| 1343 | Ga0495674_0073406 | |||
| 1344 | Ga0495674_0102244 | |||
| 1345 | Ga0495674_0360174 | |||
| 1346 | Ga0495676_0000700 | |||
| 1347 | Ga0495676_0259659 | |||
| 1348 | Ga0495680_0001524 | |||
| 1349 | Ga0495680_0007765 | |||
| 1350 | Ga0495680_0022504 | |||
| 1351 | Ga0495680_0156798 | |||
| 1352 | Ga0495687_001618 | |||
| 1353 | Ga0495675_0002613 | |||
| 1354 | Ga0495675_0004210 | |||
| 1355 | Ga0495675_0009009 | |||
| 1356 | Ga0495675_0020655 | |||
| 1357 | Ga0495675_0073405 | |||
| 1358 | Ga0495681_0013509 | |||
| 1359 | Ga0495684_0000915 | |||
| 1360 | Ga0495684_0015546 | |||
| 1361 | Ga0495684_0034276 | |||
| 1362 | Ga0495684_0073856 | |||
| 1363 | Ga0495684_0098745 | |||
| 1364 | Ga0495684_0110704 | |||
| 1365 | Ga0495684_0119435 | |||
| 1366 | Ga0495684_0228208 | |||
| 1367 | Ga0495686_0026799 | |||
| 1368 | Ga0495593_0004441 | |||
| 1369 | Ga0495593_0048013 | |||
| 1370 | Ga0495602_0005369 | |||
| 1371 | Ga0495602_0071054 | |||
| 1372 | Ga0495602_0090441 | |||
| 1373 | Ga0495602_0119317 | |||
| 1374 | Ga0495602_0131341 | |||
| 1375 | Ga0495614_0001547 | |||
| 1376 | Ga0496100_0053451 | |||
| 1377 | Ga0496100_0420610 | |||
| 1378 | Ga0496101_0015820 | |||
| 1379 | Ga0496101_0115344 | |||
| 1380 | Ga0496101_0166700 | |||
| 1381 | Ga0496101_0183872 | |||
| 1382 | Ga0496102_0126181 | |||
| 1383 | Ga0496102_0187276 | |||
| 1384 | Ga0496104_0016301 | |||
| 1385 | Ga0496104_0023541 | |||
| 1386 | Ga0496104_0081059 | |||
| 1387 | Ga0496104_0087655 | |||
| 1388 | Ga0496105_0002382 | |||
| 1389 | Ga0496105_0008747 | |||
| 1390 | Ga0496105_0057654 | |||
| 1391 | Ga0496105_0139316 | |||
| 1392 | Ga0496105_0161660 | |||
| 1393 | Ga0496106_0074472 | |||
| 1394 | Ga0496106_0077155 | |||
| 1395 | Ga0496107_0133836 | |||
| 1396 | Ga0496107_0163054 | |||
| 1397 | Ga0496108_0027758 | |||
| 1398 | Ga0496108_0033511 | |||
| 1399 | Ga0496108_0035960 | |||
| 1400 | Ga0496108_0470150 | |||
| 1401 | Ga0496109_0053726 | |||
| 1402 | Ga0496109_0059825 | |||
| 1403 | Ga0496109_0093262 | |||
| 1404 | Ga0496109_0122305 | |||
| 1405 | Ga0496110_0009446 | |||
| 1406 | Ga0496110_0026291 | |||
| 1407 | Ga0496110_0075195 | |||
| 1408 | Ga0496110_0597873 | |||
| 1409 | Ga0496111_0010884 | |||
| 1410 | Ga0496111_0096881 | |||
| 1411 | Ga0496111_0100874 | |||
| 1412 | Ga0496112_0023220 | |||
| 1413 | Ga0496112_0030981 | |||
| 1414 | Ga0496112_0084094 | |||
| 1415 | Ga0496113_0010824 | |||
| 1416 | Ga0496113_0051788 | |||
| 1417 | Ga0496113_0199409 | |||
| 1418 | Ga0496113_0334964 | |||
| 1419 | Ga0496113_0367986 | |||
| 1420 | Ga0496114_0019457 | |||
| 1421 | Ga0496114_0255125 | |||
| 1422 | Ga0496115_0012296 | |||
| 1423 | Ga0496115_0054354 | |||
| 1424 | Ga0496126_0465835 | |||
| 1425 | Ga0501070_0527168 | |||
| 1426 | nmdc:mga05p37_15272_c1 | |||
| 1427 | nmdc:mga05p37_36127_c1 | |||
| 1428 | nmdc:mga08y16_122497_c1 | |||
| 1429 | nmdc:mga08y16_597154_c1 | |||
| 1430 | nmdc:mga0n895_12070_c1 | |||
| 1431 | nmdc:mga0n895_132658_c1 | |||
| 1432 | nmdc:mga0rr50_10489_c1 | |||
| 1433 | nmdc:mga0rr50_162463_c1 | |||
| 1434 | nmdc:mga0rr50_285507_c1 | |||
| 1435 | nmdc:mga0rr50_291231_c1 | |||
| 1436 | nmdc:mga0rr50_7420_c1 | |||
| 1437 | nmdc:mga08x19_3432_c1 | |||
| 1438 | nmdc:mga08x19_79008_c1 | |||
| 1439 | nmdc:mga0a205_121677_c1 | |||
| 1440 | nmdc:mga0a205_14730_c1 | |||
| 1441 | nmdc:mga0a205_202254_c1 | |||
| 1442 | Ga0495601_0000170 | |||
| 1443 | Ga0495601_0010149 | |||
| 1444 | Ga0495601_0011922 | |||
| 1445 | Ga0495601_0094753 | |||
| 1446 | Ga0495601_0216695 | |||
| 1447 | Ga0495601_0500177 | |||
| 1448 | Ga0495612_0002763 | |||
| 1449 | Ga0495612_0010441 | |||
| 1450 | Ga0495612_0062640 | |||
| 1451 | Ga0495612_0066327 | |||
| 1452 | Ga0495595_0002434 | |||
| 1453 | Ga0495595_0011782 | |||
| 1454 | Ga0495595_0052420 | |||
| 1455 | Ga0495595_0096431 | |||
| 1456 | Ga0495619_0010380 | |||
| 1457 | Ga0495619_0104282 | |||
| 1458 | Ga0495619_0151829 | |||
| 1459 | Ga0495619_0273579 | |||
| 1460 | Ga0495619_0433674 | |||
| 1461 | Ga0500560_028337 | |||
| 1462 | 2995469907 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jc8-assembly1.cif.gz_B | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.94 | 3 | 225 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9387 | 3 | 222 |
| 3gvc-assembly2.cif.gz_D-3 | crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis | 0.9345 | 3 | 225 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9329 | 3 | 223 |
| 3tzq-assembly1.cif.gz_C | crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum | 0.9326 | 3 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EGA6_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9359 | 3 | 222 | 3.40.50.720 |
| 3tzqC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9326 | 3 | 223 | 3.40.50.720 |
| 2cfcD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9306 | 3 | 223 | 3.40.50.720 |
| 3awdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9304 | 1 | 222 | 3.40.50.720 |
| 5jlaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9304 | 4 | 223 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2C060-F1-model_v4 | Short-subunit dehydrogenase | 0.9796 | 1 | 226 |
GO:0016491
|
| AF-A0A7Y5KWS0-F1-model_v4 | SDR family oxidoreductase | 0.9521 | 4 | 226 |
GO:0016491
|
| AF-A0A4D7QV48-F1-model_v4 | SDR family oxidoreductase | 0.9521 | 4 | 225 |
GO:0016491
|
| AF-A0A535MBX9-F1-model_v4 | SDR family oxidoreductase | 0.9491 | 4 | 226 |
GO:0016616
GO:0030497 |
| AF-A0A1U9UZ77-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9465 | 3 | 223 |
GO:0016491
|