F477763

General Info

Members Datasets Scaffolds Average Seq Length
727 295 1454 219

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0204919|Ga0495602_0204919_564_1253
Length 229
Sequence MTKDLGVWTADDCALVLIDYQKEMFEVIRSETSADLVEMNVRLLAKTAKAFDMPIVLSTVGVGAGFNGPTLPSILSELDGIEPIDRTSMNAFEDEAFSEAVKATGRKTGRRRLIIGGLHTEICLTFASVQALKNGYDVMYVADAVGGRSQAAHRTGIERLAHAGAVPTTALAVTTELFRDWAGPLAGPALDTIYWYFREIPKLTNEVGVADAEKGAAAAYAEQAAGAAH

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
291 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
292 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 14.31
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0204919 3300048088 Bacteria 1502
2 JGI24747J21853_1011099 3300001978 Bacteria 908
3 JGI24744J21845_10002897 3300002077 Bacteria 3509
4 Ga0070676_10152643 3300005328 Unclassified 1480
5 Ga0070683_100045356 3300005329 Bacteria 4057
6 Ga0070683_100585434 3300005329 Bacteria 1067
7 Ga0070690_100047336 3300005330 Bacteria 2736
8 Ga0068869_100128600 3300005334 Bacteria 1945
9 Ga0068869_100139105 3300005334 Bacteria 1873
10 Ga0068869_100149733 3300005334 Bacteria 1809
11 Ga0070680_100017805 3300005336 Bacteria 5604
12 Ga0070680_100184222 3300005336 Bacteria 1759
13 Ga0070680_100263589 3300005336 Unclassified 1458
14 Ga0070682_100002394 3300005337 Bacteria 10393
15 Ga0070682_100022994 3300005337 Bacteria 3699
16 Ga0068868_100015516 3300005338 Bacteria 5636
17 Ga0068868_100091883 3300005338 Bacteria 2446
18 Ga0068868_100143253 3300005338 Bacteria 1963
19 Ga0070660_100015317 3300005339 Bacteria 5534
20 Ga0070691_10029496 3300005341 Bacteria 2566
21 Ga0070691_10051628 3300005341 Bacteria 1964
22 Ga0070687_100304868 3300005343 Bacteria 1012
23 Ga0070687_100307732 3300005343 Bacteria 1008
24 Ga0070687_100450535 3300005343 Bacteria 856
25 Ga0070692_10095438 3300005345 Bacteria 1623
26 Ga0070692_10262601 3300005345 Bacteria 1039
27 Ga0070668_100023578 3300005347 Bacteria 4656
28 Ga0070668_100248735 3300005347 Bacteria 1475
29 Ga0070669_100120066 3300005353 Bacteria 2004
30 Ga0070669_100184736 3300005353 Bacteria 1633
31 Ga0070675_100546685 3300005354 Bacteria 1047
32 Ga0070671_100048211 3300005355 Bacteria 3542
33 Ga0070674_100064498 3300005356 Bacteria 2567
34 Ga0070674_100646178 3300005356 Bacteria 899
35 Ga0070673_100049553 3300005364 Bacteria 3280
36 Ga0070673_100111277 3300005364 Bacteria 2272
37 Ga0070688_100000841 3300005365 Bacteria 15211
38 Ga0070659_100006905 3300005366 Bacteria 8219
39 Ga0070659_100079438 3300005366 Bacteria 2618
40 Ga0070667_100192770 3300005367 Bacteria 1806
41 Ga0070709_10053899 3300005434 Bacteria 2533
42 Ga0070709_10211278 3300005434 Unclassified 1379
43 Ga0070714_100062419 3300005435 Bacteria 3203
44 Ga0070714_100088687 3300005435 Bacteria 2707
45 Ga0070714_100204689 3300005435 Unclassified 1807
46 Ga0070714_100234252 3300005435 Unclassified 1692
47 Ga0070714_100691230 3300005435 Bacteria 984
48 Ga0070713_100631798 3300005436 Bacteria 1019
49 Ga0070710_10014642 3300005437 Bacteria 3951
50 Ga0070710_10242488 3300005437 Unclassified 1155
51 Ga0070701_10012209 3300005438 Bacteria 3866
52 Ga0070711_100047894 3300005439 Bacteria 2920
53 Ga0070711_100053464 3300005439 Bacteria 2783
54 Ga0070711_100093198 3300005439 Bacteria 2175
55 Ga0070711_100094408 3300005439 Bacteria 2162
56 Ga0070711_100179877 3300005439 Bacteria 1619
57 Ga0070711_100455449 3300005439 Bacteria 1048
58 Ga0070705_100022110 3300005440 Bacteria 3393
59 Ga0070705_100114078 3300005440 Bacteria 1732
60 Ga0070705_100397250 3300005440 Bacteria 1020
61 Ga0070700_100001535 3300005441 Bacteria 11511
62 Ga0070700_100034748 3300005441 Bacteria 3046
63 Ga0070694_100172697 3300005444 Bacteria 1593
64 Ga0070694_100223748 3300005444 Bacteria 1413
65 Ga0070694_100322016 3300005444 Bacteria 1190
66 Ga0070708_100066025 3300005445 Bacteria 3246
67 Ga0070708_100075392 3300005445 Bacteria 3044
68 Ga0070708_100657175 3300005445 Unclassified 988
69 Ga0070663_100407715 3300005455 Bacteria 1112
70 Ga0070678_100032322 3300005456 Bacteria 3621
71 Ga0070678_100359491 3300005456 Bacteria 1254
72 Ga0070662_100112084 3300005457 Bacteria 2079
73 Ga0070662_100378597 3300005457 Bacteria 1165
74 Ga0070681_10804985 3300005458 Bacteria 857
75 Ga0068867_100001471 3300005459 Bacteria 16324
76 Ga0068867_100046414 3300005459 Bacteria 3191
77 Ga0070685_10014278 3300005466 Bacteria 4204
78 Ga0070706_100068874 3300005467 Bacteria 3273
79 Ga0070706_100107639 3300005467 Bacteria 2593
80 Ga0070706_100202669 3300005467 Bacteria 1853
81 Ga0070706_100960396 3300005467 Unclassified 789
82 Ga0070707_100000511 3300005468 Bacteria 38643
83 Ga0070707_100010774 3300005468 Bacteria 8515
84 Ga0070707_100036478 3300005468 Bacteria 4691
85 Ga0070707_100727335 3300005468 Bacteria 955
86 Ga0070698_100055634 3300005471 Bacteria 4010
87 Ga0070698_100079781 3300005471 Bacteria 3269
88 Ga0070698_100110822 3300005471 Bacteria 2709
89 Ga0070698_100177267 3300005471 Bacteria 2070
90 Ga0070698_100472753 3300005471 Bacteria 1190
91 Ga0070698_100520805 3300005471 Bacteria 1127
92 Ga0070698_100625718 3300005471 Bacteria 1017
93 Ga0070698_100840861 3300005471 Unclassified 863
94 Ga0070699_100117274 3300005518 Bacteria 2340
95 Ga0070679_100220661 3300005530 Bacteria 1857
96 Ga0070684_100487010 3300005535 Unclassified 1142
97 Ga0068853_100015572 3300005539 Bacteria 6247
98 Ga0070672_100087676 3300005543 Bacteria 2505
99 Ga0070672_100175644 3300005543 Bacteria 1783
100 Ga0070686_100040736 3300005544 Bacteria 2899
101 Ga0070686_100062901 3300005544 Bacteria 2402
102 Ga0070686_100126938 3300005544 Bacteria 1759
103 Ga0070686_100516901 3300005544 Bacteria 929
104 Ga0070695_100093783 3300005545 Bacteria 2009
105 Ga0070695_100099097 3300005545 Bacteria 1959
106 Ga0070695_100165560 3300005545 Bacteria 1556
107 Ga0070696_100006869 3300005546 Bacteria 7595
108 Ga0070696_100122627 3300005546 Bacteria 1882
109 Ga0070696_100174785 3300005546 Bacteria 1590
110 Ga0070696_100211759 3300005546 Bacteria 1451
111 Ga0070696_100391987 3300005546 Bacteria 1084
112 Ga0070693_100001834 3300005547 Bacteria 9700
113 Ga0070693_100005402 3300005547 Bacteria 6130
114 Ga0070693_100170598 3300005547 Unclassified 1393
115 Ga0070693_100480409 3300005547 Unclassified 878
116 Ga0070665_100095068 3300005548 Bacteria 2984
117 Ga0070704_100014179 3300005549 Bacteria 4972
118 Ga0070704_100086782 3300005549 Bacteria 2320
119 Ga0070704_100318175 3300005549 Bacteria 1303
120 Ga0068855_100156311 3300005563 Bacteria 2590
121 Ga0070664_100502036 3300005564 Bacteria 1118
122 Ga0068854_100391247 3300005578 Bacteria 1148
123 Ga0068854_100437271 3300005578 Bacteria 1090
124 Ga0068854_100663004 3300005578 Bacteria 897
125 Ga0068856_100002969 3300005614 Bacteria 17381
126 Ga0068856_100021597 3300005614 Bacteria 6256
127 Ga0068856_100321475 3300005614 Bacteria 1564
128 Ga0068856_100415054 3300005614 Bacteria 1366
129 Ga0070702_100000676 3300005615 Bacteria 12792
130 Ga0070702_100026855 3300005615 Bacteria 3099
131 Ga0070702_100259934 3300005615 Bacteria 1181
132 Ga0068852_100054409 3300005616 Bacteria 3450
133 Ga0068864_100410839 3300005618 Bacteria 1288
134 Ga0068864_100778555 3300005618 Bacteria 939
135 Ga0068866_10000624 3300005718 Bacteria 16096
136 Ga0068866_10006504 3300005718 Bacteria 4870
137 Ga0068866_10235318 3300005718 Bacteria 1113
138 Ga0068866_10428718 3300005718 Bacteria 859
139 Ga0068861_100030702 3300005719 Bacteria 3941
140 Ga0068861_100065512 3300005719 Bacteria 2799
141 Ga0068863_100135083 3300005841 Bacteria 2356
142 Ga0068858_100276448 3300005842 Bacteria 1599
143 Ga0068858_100592589 3300005842 Bacteria 1075
144 Ga0068862_100128195 3300005844 Bacteria 2242
145 Ga0068862_100217476 3300005844 Bacteria 1729
146 Ga0068862_100268120 3300005844 Bacteria 1561
147 Ga0068862_100333842 3300005844 Bacteria 1402
148 Ga0081455_10101542 3300005937 Bacteria 2308
149 Ga0070717_10067652 3300006028 Bacteria 2972
150 Ga0070717_10162570 3300006028 Archaea 1937
151 Ga0070717_10228285 3300006028 Bacteria 1638
152 Ga0070717_10385834 3300006028 Bacteria 1257
153 Ga0075365_10058973 3300006038 Bacteria 2557
154 Ga0075365_10438967 3300006038 Unclassified 922
155 Ga0075364_10023067 3300006051 Bacteria 3938
156 Ga0070715_10000737 3300006163 Bacteria 8827
157 Ga0070715_10008584 3300006163 Bacteria 3565
158 Ga0070715_10096148 3300006163 Bacteria 1373
159 Ga0070716_100144365 3300006173 Bacteria 1522
160 Ga0070716_100166006 3300006173 Bacteria 1436
161 Ga0070716_100231052 3300006173 Unclassified 1249
162 Ga0070716_100282711 3300006173 Bacteria 1146
163 Ga0070712_100042581 3300006175 Bacteria 3123
164 Ga0070712_100141993 3300006175 Bacteria 1834
165 Ga0070712_100211879 3300006175 Bacteria 1528
166 Ga0070712_100612711 3300006175 Archaea 922
167 Ga0075362_10079471 3300006177 Bacteria 1510
168 Ga0075369_10166176 3300006186 Unclassified 1012
169 Ga0097621_100004541 3300006237 Bacteria 9680
170 Ga0097621_100016827 3300006237 Bacteria 5540
171 Ga0097621_100586079 3300006237 Bacteria 1018
172 Ga0068871_100127102 3300006358 Bacteria 2158
173 Ga0068871_100643936 3300006358 Bacteria 967
174 Ga0075428_100006760 3300006844 Bacteria 12759
175 Ga0075428_100367704 3300006844 Archaea 1542
176 Ga0075428_100373574 3300006844 Unclassified 1529
177 Ga0075430_100558903 3300006846 Bacteria 944
178 Ga0075431_100003951 3300006847 Bacteria 14441
179 Ga0075431_100066582 3300006847 Bacteria 3719
180 Ga0075431_100956357 3300006847 Bacteria 825
181 Ga0075433_10002301 3300006852 Bacteria 14554
182 Ga0075433_10280987 3300006852 Bacteria 1475
183 Ga0075433_10339193 3300006852 Unclassified 1328
184 Ga0075433_10374880 3300006852 Bacteria 1256
185 Ga0075433_10529448 3300006852 Unclassified 1037
186 Ga0075433_10535015 3300006852 Bacteria 1030
187 Ga0075433_10553039 3300006852 Unclassified 1012
188 Ga0075433_10620596 3300006852 Unclassified 948
189 Ga0075434_100001735 3300006871 Bacteria 18707
190 Ga0075434_100002903 3300006871 Bacteria 15214
191 Ga0075434_100005482 3300006871 Bacteria 11557
192 Ga0075434_100035540 3300006871 Bacteria 4926
193 Ga0075434_100046968 3300006871 Bacteria 4285
194 Ga0075434_100070137 3300006871 Unclassified 3495
195 Ga0075434_100224654 3300006871 Bacteria 1897
196 Ga0075434_100467377 3300006871 Bacteria 1283
197 Ga0075429_100183696 3300006880 Bacteria 1832
198 Ga0068865_100001271 3300006881 Bacteria 14687
199 Ga0068865_100156395 3300006881 Bacteria 1734
200 Ga0075436_100003584 3300006914 Bacteria 10635
201 Ga0075436_100058845 3300006914 Bacteria 2654
202 Ga0075436_100115273 3300006914 Bacteria 1877
203 Ga0075436_100277829 3300006914 Unclassified 1197
204 Ga0075436_100314915 3300006914 Bacteria 1123
205 Ga0097620_100942440 3300006931 Bacteria 947
206 Ga0075435_100000284 3300007076 Bacteria 31543
207 Ga0075435_100001809 3300007076 Bacteria 13908
208 Ga0075435_100226689 3300007076 Bacteria 1587
209 Ga0105250_10077542 3300009092 Bacteria 1345
210 Ga0105240_10826936 3300009093 Unclassified 1001
211 Ga0111539_10073102 3300009094 Bacteria 4043
212 Ga0111539_10117237 3300009094 Bacteria 3121
213 Ga0111539_10641969 3300009094 Bacteria 1236
214 Ga0111539_11380715 3300009094 Bacteria 817
215 Ga0105245_10002220 3300009098 Bacteria 17580
216 Ga0105245_10012223 3300009098 Bacteria 7469
217 Ga0105245_10016423 3300009098 Bacteria 6457
218 Ga0105245_10016536 3300009098 Bacteria 6437
219 Ga0105245_10023158 3300009098 Bacteria 5450
220 Ga0105245_10055949 3300009098 Bacteria 3545
221 Ga0105245_10086114 3300009098 Bacteria 2881
222 Ga0105245_10185932 3300009098 Bacteria 1988
223 Ga0105245_10205405 3300009098 Bacteria 1893
224 Ga0105245_10410868 3300009098 Bacteria 1355
225 Ga0105245_10528407 3300009098 Bacteria 1199
226 Ga0105245_11112498 3300009098 Bacteria 836
227 Ga0105247_10009237 3300009101 Bacteria 5992
228 Ga0105247_10135380 3300009101 Bacteria 1609
229 Ga0105247_10295955 3300009101 Bacteria 1121
230 Ga0114129_10028492 3300009147 Bacteria 7914
231 Ga0114129_10048033 3300009147 Bacteria 5997
232 Ga0114129_10206852 3300009147 Bacteria 2655
233 Ga0114129_10336450 3300009147 Bacteria 2003
234 Ga0114129_10339024 3300009147 Bacteria 1994
235 Ga0114129_11032202 3300009147 Bacteria 1033
236 Ga0105243_10002337 3300009148 Bacteria 15873
237 Ga0105243_10082229 3300009148 Bacteria 2632
238 Ga0105243_10245984 3300009148 Bacteria 1594
239 Ga0105243_10324090 3300009148 Bacteria 1405
240 Ga0105241_10032280 3300009174 Bacteria 3924
241 Ga0105241_10035308 3300009174 Bacteria 3760
242 Ga0105241_10961496 3300009174 Bacteria 797
243 Ga0105242_10000857 3300009176 Bacteria 23571
244 Ga0105242_10063325 3300009176 Bacteria 3045
245 Ga0105242_10160149 3300009176 Bacteria 1969
246 Ga0105242_10241727 3300009176 Bacteria 1623
247 Ga0105242_10542559 3300009176 Bacteria 1113
248 Ga0105242_10602054 3300009176 Bacteria 1062
249 Ga0105242_10756665 3300009176 Bacteria 957
250 Ga0105248_10016269 3300009177 Bacteria 8188
251 Ga0105248_10028019 3300009177 Bacteria 6274
252 Ga0105248_10757073 3300009177 Unclassified 1096
253 Ga0105237_10532120 3300009545 Bacteria 1182
254 Ga0105249_10005899 3300009553 Bacteria 10602
255 Ga0105249_10010239 3300009553 Bacteria 8235
256 Ga0105249_10118624 3300009553 Bacteria 2511
257 Ga0105249_10165713 3300009553 Bacteria 2139
258 Ga0105239_10016348 3300010375 Bacteria 8205
259 Ga0105239_10068167 3300010375 Bacteria 3910
260 Ga0105239_10221523 3300010375 Bacteria 2122
261 Ga0105239_10274783 3300010375 Bacteria 1896
262 Ga0105239_10365628 3300010375 Bacteria 1630
263 Ga0105239_10448867 3300010375 Bacteria 1463
264 Ga0105239_10483589 3300010375 Bacteria 1407
265 Ga0105239_11296706 3300010375 Unclassified 840
266 Ga0105246_10014865 3300011119 Bacteria 4903
267 Ga0105246_10048970 3300011119 Bacteria 2891
268 Ga0105246_10097548 3300011119 Bacteria 2133
269 Ga0105246_10695907 3300011119 Unclassified 890
270 Ga0157326_1003426 3300012513 Bacteria 1669
271 Ga0157373_10035036 3300013100 Bacteria 3605
272 Ga0157371_10382498 3300013102 Archaea 1028
273 Ga0157370_10727876 3300013104 Bacteria 905
274 Ga0157374_10027019 3300013296 Bacteria 5170
275 Ga0157374_10755389 3300013296 Bacteria 987
276 Ga0157374_11282337 3300013296 Archaea 754
277 Ga0157378_10003292 3300013297 Bacteria 14378
278 Ga0157378_10313731 3300013297 Bacteria 1521
279 Ga0157378_10392079 3300013297 Bacteria 1366
280 Ga0157378_10668191 3300013297 Bacteria 1056
281 Ga0157378_11109492 3300013297 Archaea 828
282 Ga0163162_10021368 3300013306 Bacteria 6372
283 Ga0163162_10147406 3300013306 Bacteria 2470
284 Ga0163162_10512157 3300013306 Bacteria 1330
285 Ga0157372_10136991 3300013307 Bacteria 2820
286 Ga0157372_10825895 3300013307 Bacteria 1076
287 Ga0157372_11256138 3300013307 Archaea 855
288 Ga0157375_10297863 3300013308 Bacteria 1776
289 Ga0157375_10320764 3300013308 Bacteria 1714
290 Ga0157375_11602502 3300013308 Unclassified 770
291 Ga0163163_10933068 3300014325 Bacteria 931
292 Ga0157380_10249533 3300014326 Bacteria 1606
293 Ga0157380_10266617 3300014326 Bacteria 1559
294 Ga0157380_10443939 3300014326 Bacteria 1244
295 Ga0157377_10005732 3300014745 Bacteria 5859
296 Ga0157377_10223984 3300014745 Bacteria 1206
297 Ga0157377_10273523 3300014745 Archaea 1104
298 Ga0157379_10466959 3300014968 Bacteria 1167
299 Ga0157379_11060156 3300014968 Bacteria 775
300 Ga0157376_10003946 3300014969 Bacteria 10263
301 Ga0157376_10220390 3300014969 Bacteria 1757
302 Ga0157376_10249571 3300014969 Bacteria 1657
303 Ga0163161_10261123 3300017792 Bacteria 1353
304 Ga0163161_10641014 3300017792 Bacteria 879
305 Ga0163161_10666384 3300017792 Unclassified 863
306 Ga0163161_10750433 3300017792 Bacteria 816
307 Ga0207653_10003551 3300025885 Bacteria 4909
308 Ga0207692_10008001 3300025898 Bacteria 4361
309 Ga0207692_10013934 3300025898 Bacteria 3501
310 Ga0207692_10265080 3300025898 Bacteria 1034
311 Ga0207692_10377971 3300025898 Bacteria 879
312 Ga0207642_10210609 3300025899 Bacteria 1080
313 Ga0207710_10066670 3300025900 Bacteria 1643
314 Ga0207710_10198273 3300025900 Bacteria 991
315 Ga0207688_10014915 3300025901 Bacteria 4216
316 Ga0207688_10089866 3300025901 Bacteria 1763
317 Ga0207680_10066300 3300025903 Bacteria 2220
318 Ga0207680_10234876 3300025903 Bacteria 1261
319 Ga0207647_10063868 3300025904 Bacteria 2238
320 Ga0207685_10008451 3300025905 Bacteria 2932
321 Ga0207699_10012576 3300025906 Bacteria 4308
322 Ga0207699_10491786 3300025906 Bacteria 885
323 Ga0207643_10204730 3300025908 Bacteria 1203
324 Ga0207684_10185627 3300025910 Unclassified 1793
325 Ga0207684_10272202 3300025910 Unclassified 1461
326 Ga0207684_10337454 3300025910 Unclassified 1298
327 Ga0207684_10350354 3300025910 Bacteria 1271
328 Ga0207684_10586701 3300025910 Bacteria 952
329 Ga0207707_10567686 3300025912 Bacteria 963
330 Ga0207671_10205883 3300025914 Bacteria 1538
331 Ga0207693_10001284 3300025915 Bacteria 22326
332 Ga0207693_10006504 3300025915 Bacteria 9674
333 Ga0207693_10032035 3300025915 Bacteria 4151
334 Ga0207693_10037393 3300025915 Bacteria 3826
335 Ga0207693_10052145 3300025915 Bacteria 3209
336 Ga0207693_10060055 3300025915 Unclassified 2979
337 Ga0207693_10121881 3300025915 Bacteria 2048
338 Ga0207693_10140687 3300025915 Bacteria 1898
339 Ga0207693_10157315 3300025915 Bacteria 1787
340 Ga0207693_10221563 3300025915 Bacteria 1486
341 Ga0207663_10025979 3300025916 Bacteria 3393
342 Ga0207663_10028628 3300025916 Bacteria 3263
343 Ga0207663_10090891 3300025916 Bacteria 2025
344 Ga0207663_10405656 3300025916 Unclassified 1043
345 Ga0207663_10405703 3300025916 Bacteria 1043
346 Ga0207663_10482980 3300025916 Bacteria 960
347 Ga0207660_10005533 3300025917 Bacteria 8206
348 Ga0207660_10050742 3300025917 Bacteria 2947
349 Ga0207660_10311713 3300025917 Bacteria 1255
350 Ga0207662_10072910 3300025918 Bacteria 2082
351 Ga0207662_10226124 3300025918 Bacteria 1220
352 Ga0207662_10277881 3300025918 Bacteria 1107
353 Ga0207657_10018059 3300025919 Bacteria 6748
354 Ga0207657_10138556 3300025919 Bacteria 1989
355 Ga0207657_10217456 3300025919 Bacteria 1532
356 Ga0207646_10008723 3300025922 Bacteria 10116
357 Ga0207646_10073582 3300025922 Bacteria 3052
358 Ga0207646_10456857 3300025922 Bacteria 1152
359 Ga0207646_10509993 3300025922 Unclassified 1083
360 Ga0207681_10062821 3300025923 Bacteria 2559
361 Ga0207681_10272223 3300025923 Bacteria 1330
362 Ga0207694_10052561 3300025924 Bacteria 3158
363 Ga0207659_10062826 3300025926 Bacteria 2682
364 Ga0207687_10008519 3300025927 Bacteria 6705
365 Ga0207687_10020128 3300025927 Bacteria 4425
366 Ga0207687_10020967 3300025927 Bacteria 4338
367 Ga0207687_10069743 3300025927 Bacteria 2508
368 Ga0207687_10094293 3300025927 Bacteria 2190
369 Ga0207687_10121722 3300025927 Bacteria 1952
370 Ga0207687_10176832 3300025927 Bacteria 1650
371 Ga0207687_10320074 3300025927 Bacteria 1255
372 Ga0207687_10348014 3300025927 Bacteria 1207
373 Ga0207700_10241177 3300025928 Bacteria 1541
374 Ga0207700_10496238 3300025928 Bacteria 1080
375 Ga0207664_10024650 3300025929 Bacteria 4522
376 Ga0207664_10044801 3300025929 Bacteria 3466
377 Ga0207664_10091945 3300025929 Bacteria 2489
378 Ga0207664_10146942 3300025929 Bacteria 2000
379 Ga0207664_10281634 3300025929 Unclassified 1459
380 Ga0207664_10554080 3300025929 Bacteria 1032
381 Ga0207644_10057090 3300025931 Bacteria 2818
382 Ga0207690_10016283 3300025932 Bacteria 4520
383 Ga0207706_10071647 3300025933 Bacteria 3048
384 Ga0207686_10001206 3300025934 Bacteria 14994
385 Ga0207709_10003931 3300025935 Bacteria 8678
386 Ga0207709_10027468 3300025935 Bacteria 3279
387 Ga0207709_10298851 3300025935 Bacteria 1196
388 Ga0207709_10314913 3300025935 Bacteria 1169
389 Ga0207709_10364676 3300025935 Unclassified 1095
390 Ga0207709_10417379 3300025935 Bacteria 1030
391 Ga0207670_10248063 3300025936 Bacteria 1375
392 Ga0207670_10299454 3300025936 Bacteria 1259
393 Ga0207669_10002666 3300025937 Bacteria 7642
394 Ga0207669_10366272 3300025937 Bacteria 1119
395 Ga0207669_10573678 3300025937 Bacteria 913
396 Ga0207704_10009850 3300025938 Bacteria 4631
397 Ga0207665_10005836 3300025939 Bacteria 8191
398 Ga0207665_10006154 3300025939 Bacteria 7969
399 Ga0207691_10002281 3300025940 Bacteria 18781
400 Ga0207691_10137105 3300025940 Bacteria 2158
401 Ga0207711_10054269 3300025941 Bacteria 3439
402 Ga0207711_10058617 3300025941 Bacteria 3314
403 Ga0207711_10391085 3300025941 Bacteria 1291
404 Ga0207711_10539737 3300025941 Bacteria 1088
405 Ga0207689_10122390 3300025942 Unclassified 2140
406 Ga0207689_10397848 3300025942 Bacteria 1148
407 Ga0207661_10079431 3300025944 Bacteria 2704
408 Ga0207661_10875230 3300025944 Bacteria 827
409 Ga0207679_10211672 3300025945 Bacteria 1626
410 Ga0207667_10113528 3300025949 Bacteria 2793
411 Ga0207667_10251344 3300025949 Unclassified 1808
412 Ga0207651_10088119 3300025960 Bacteria 2262
413 Ga0207651_10470845 3300025960 Bacteria 1081
414 Ga0207712_10002308 3300025961 Bacteria 12387
415 Ga0207712_10003283 3300025961 Bacteria 10260
416 Ga0207712_10164844 3300025961 Bacteria 1726
417 Ga0207712_10221956 3300025961 Bacteria 1511
418 Ga0207668_10137283 3300025972 Bacteria 1875
419 Ga0207640_10128658 3300025981 Bacteria 1827
420 Ga0207640_10253849 3300025981 Bacteria 1366
421 Ga0207640_10380858 3300025981 Bacteria 1143
422 Ga0207640_10590376 3300025981 Bacteria 939
423 Ga0207640_10735027 3300025981 Unclassified 849
424 Ga0207658_10155201 3300025986 Bacteria 1870
425 Ga0207677_10059489 3300026023 Bacteria 2635
426 Ga0207677_10273528 3300026023 Bacteria 1383
427 Ga0207703_10152178 3300026035 Bacteria 2018
428 Ga0207703_10241664 3300026035 Unclassified 1624
429 Ga0207703_10543577 3300026035 Bacteria 1095
430 Ga0207678_10050160 3300026067 Bacteria 3606
431 Ga0207678_10105012 3300026067 Bacteria 2410
432 Ga0207708_10000370 3300026075 Bacteria 35189
433 Ga0207708_10004615 3300026075 Bacteria 10141
434 Ga0207708_10056212 3300026075 Bacteria 3002
435 Ga0207702_10002526 3300026078 Bacteria 17233
436 Ga0207702_10039342 3300026078 Bacteria 3961
437 Ga0207702_10699333 3300026078 Bacteria 999
438 Ga0207702_11175542 3300026078 Bacteria 761
439 Ga0207648_10001656 3300026089 Bacteria 24400
440 Ga0207648_10097415 3300026089 Bacteria 2574
441 Ga0207648_10171342 3300026089 Bacteria 1919
442 Ga0207674_10076445 3300026116 Bacteria 3356
443 Ga0207675_100001023 3300026118 Bacteria 27745
444 Ga0207675_100022607 3300026118 Bacteria 5854
445 Ga0207675_100060576 3300026118 Bacteria 3534
446 Ga0207675_100226238 3300026118 Unclassified 1804
447 Ga0207675_100563333 3300026118 Unclassified 1140
448 Ga0207683_10000703 3300026121 Bacteria 30509
449 Ga0207683_10009220 3300026121 Bacteria 8410
450 Ga0207683_10126376 3300026121 Bacteria 2298
451 Ga0207683_10143997 3300026121 Bacteria 2148
452 Ga0207683_10466671 3300026121 Bacteria 1164
453 Ga0207698_10038122 3300026142 Bacteria 3548
454 Ga0207698_10122567 3300026142 Bacteria 2203
455 Ga0207698_10892497 3300026142 Bacteria 896
456 Ga0209588_1011697 3300027671 Bacteria 2655
457 Ga0207428_10040067 3300027907 Bacteria 3802
458 Ga0207428_10272174 3300027907 Bacteria 1259
459 Ga0207428_10394461 3300027907 Unclassified 1014
460 Ga0268266_10213335 3300028379 Bacteria 1771
461 Ga0268265_10143944 3300028380 Bacteria 2000
462 Ga0268265_10145349 3300028380 Bacteria 1992
463 Ga0268264_10055989 3300028381 Bacteria 3295
464 Ga0268264_10292317 3300028381 Bacteria 1531
465 Ga0268264_10292745 3300028381 Bacteria 1530
466 Ga0307517_10054449 3300028786 Bacteria 3955
467 Ga0307515_10008048 3300028794 Bacteria 20659
468 Ga0307513_10608716 3300031456 Bacteria 801
469 Ga0373959_0010858 3300034820 Bacteria 1599
470 Ga0373938_0008959 3300034957 Bacteria 1800
471 Ga0373926_0020889 3300035083 Bacteria 2264
472 Ga0373940_0093157 3300035088 Bacteria 905
473 Ga0373944_0032996 3300035089 Unclassified 1567
474 Ga0373949_0007870 3300035090 Bacteria 2336
475 Ga0373951_0009558 3300035091 Bacteria 2182
476 Ga0373952_0007667 3300035092 Bacteria 2031
477 Ga0373932_0013893 3300035112 Bacteria 2014
478 Ga0373936_0110252 3300035113 Unclassified 1168
479 Ga0373941_0025398 3300035115 Bacteria 1711
480 Ga0373945_0043228 3300035116 Bacteria 1634
481 Ga0373960_0096175 3300035121 Bacteria 954
482 Ga0373943_0006763 3300035170 Bacteria 5145
483 Ga0373946_0116250 3300035171 Unclassified 1216
484 Ga0373961_0022069 3300035241 Bacteria 1700
485 Ga0373962_0065885 3300035242 Bacteria 1073
486 Ga0373931_0180667 3300035691 Bacteria 1249
487 Ga0373927_0121010 3300035695 Bacteria 1708
488 Ga0373947_0004379 3300035725 Bacteria 8282
489 Ga0373937_0759326 3300036401 Bacteria 917
490 Ga0373925_0007097 3300037068 Bacteria 8188
491 Ga0373925_0548947 3300037068 Unclassified 950
492 Ga0451576_1166587 3300045051 Bacteria 805
493 Ga0495617_104559 3300046452 Bacteria 919
494 Ga0495592_0031672 3300046454 Bacteria 3995
495 Ga0495603_0000598 3300046455 Bacteria 20275
496 Ga0495629_0006073 3300046459 Bacteria 8974
497 Ga0495629_0027320 3300046459 Unclassified 4051
498 Ga0495629_0215926 3300046459 Bacteria 1324
499 Ga0495641_0008494 3300046461 Bacteria 6248
500 Ga0495653_0103112 3300046463 Bacteria 2063
501 Ga0495580_0014040 3300046472 Bacteria 6092
502 Ga0495582_0001037 3300046473 Bacteria 15567
503 Ga0495639_0005017 3300046475 Bacteria 5680
504 Ga0495662_0001596 3300046476 Bacteria 11248
505 Ga0495584_0125112 3300046491 Bacteria 1303
506 Ga0495594_0000152 3300046499 Bacteria 32972
507 Ga0495594_0282436 3300046499 Bacteria 946
508 Ga0495607_0074576 3300046501 Bacteria 1883
509 Ga0495620_0009203 3300046515 Bacteria 5264
510 Ga0495628_0095857 3300046516 Unclassified 2292
511 Ga0495630_0040708 3300046517 Bacteria 3472
512 Ga0495630_0105465 3300046517 Bacteria 2134
513 Ga0495632_0022092 3300046519 Bacteria 3417
514 Ga0495637_0070353 3300046520 Bacteria 1414
515 Ga0495643_0005524 3300046522 Bacteria 8526
516 Ga0495644_0099882 3300046523 Unclassified 1097
517 Ga0495666_0005591 3300046526 Bacteria 6332
518 Ga0495666_0009431 3300046526 Bacteria 4882
519 Ga0495665_0006283 3300046531 Bacteria 6411
520 Ga0495640_0032279 3300046533 Bacteria 3730
521 Ga0495640_0266764 3300046533 Unclassified 1068
522 Ga0495586_0030816 3300046535 Unclassified 2870
523 Ga0495645_0258558 3300046543 Bacteria 1154
524 Ga0495622_0000291 3300046557 Bacteria 37888
525 Ga0495667_0071040 3300046559 Bacteria 2271
526 Ga0495656_0135992 3300046615 Bacteria 1174
527 Ga0495611_0109226 3300046648 Bacteria 1287
528 Ga0495659_0048643 3300046664 Unclassified 1537
529 Ga0495659_0106752 3300046664 Bacteria 1090
530 Ga0495599_0268590 3300046678 Bacteria 1035
531 Ga0495646_0175064 3300046680 Bacteria 1180
532 Ga0495647_0000716 3300046681 Bacteria 9820
533 Ga0495658_0004324 3300046683 Bacteria 6996
534 Ga0495658_0215409 3300046683 Bacteria 1201
535 Ga0495613_0004872 3300046689 Bacteria 10076
536 Ga0495624_0023521 3300046690 Bacteria 4063
537 Ga0495624_0046134 3300046690 Bacteria 2771
538 Ga0495670_0201537 3300046691 Unclassified 1054
539 Ga0495670_0283235 3300046691 Bacteria 887
540 Ga0495671_0217225 3300046692 Bacteria 926
541 Ga0495649_0130661 3300046694 Bacteria 1325
542 Ga0495589_0160956 3300046794 Bacteria 1069
543 Ga0495581_0008820 3300047315 Bacteria 5835
544 Ga0495674_0031944 3300047319 Bacteria 4778
545 Ga0495674_0060097 3300047319 Bacteria 3317
546 Ga0495674_0240599 3300047319 Unclassified 1491
547 Ga0495672_0267083 3300047320 Bacteria 823
548 Ga0495676_0000619 3300047321 Bacteria 29413
549 Ga0495676_0053837 3300047321 Bacteria 3203
550 Ga0495683_0022209 3300047323 Bacteria 3264
551 Ga0495687_004680 3300047443 Bacteria 9115
552 Ga0495677_0198028 3300047445 Bacteria 781
553 Ga0495681_0010923 3300047470 Bacteria 5456
554 Ga0495593_0007555 3300047673 Bacteria 6351
555 Ga0495614_0000555 3300048089 Bacteria 15471
556 Ga0495614_0004055 3300048089 Bacteria 6583
557 Ga0495626_0092082 3300048091 Bacteria 1332
558 Ga0496100_0006109 3300048903 Bacteria 6545
559 Ga0496100_0015781 3300048903 Bacteria 4417
560 Ga0496100_0061036 3300048903 Bacteria 2483
561 Ga0496100_0144801 3300048903 Bacteria 1688
562 Ga0496100_0413172 3300048903 Unclassified 1029
563 Ga0496100_0622723 3300048903 Unclassified 839
564 Ga0496101_0001011 3300048904 Bacteria 16565
565 Ga0496101_0001309 3300048904 Bacteria 14880
566 Ga0496101_0012823 3300048904 Bacteria 5604
567 Ga0496101_0033450 3300048904 Bacteria 3626
568 Ga0496101_0054251 3300048904 Bacteria 2893
569 Ga0496101_0088467 3300048904 Bacteria 2300
570 Ga0496101_0170031 3300048904 Bacteria 1675
571 Ga0496101_0185972 3300048904 Bacteria 1601
572 Ga0496101_0229591 3300048904 Unclassified 1442
573 Ga0496102_0003745 3300048905 Bacteria 12854
574 Ga0496102_0006061 3300048905 Bacteria 10306
575 Ga0496102_0016789 3300048905 Bacteria 6402
576 Ga0496102_0022931 3300048905 Bacteria 5537
577 Ga0496102_0047488 3300048905 Bacteria 3902
578 Ga0496102_0188174 3300048905 Bacteria 1945
579 Ga0496102_0355082 3300048905 Unclassified 1380
580 Ga0496102_0738420 3300048905 Bacteria 907
581 Ga0496102_0851750 3300048905 Unclassified 834
582 Ga0496102_1214391 3300048905 Bacteria 673
583 Ga0496103_0003723 3300048906 Bacteria 9271
584 Ga0496103_0009427 3300048906 Bacteria 5785
585 Ga0496103_0051436 3300048906 Bacteria 2550
586 Ga0496103_0080589 3300048906 Bacteria 2047
587 Ga0496103_0166566 3300048906 Unclassified 1414
588 Ga0496104_0000504 3300048907 Bacteria 33646
589 Ga0496104_0004535 3300048907 Bacteria 12101
590 Ga0496104_0008804 3300048907 Bacteria 8971
591 Ga0496104_0032463 3300048907 Bacteria 4859
592 Ga0496104_0045978 3300048907 Bacteria 4107
593 Ga0496104_0098429 3300048907 Bacteria 2800
594 Ga0496104_0444360 3300048907 Bacteria 1209
595 Ga0496104_0903256 3300048907 Unclassified 788
596 Ga0496105_0052553 3300048908 Bacteria 3365
597 Ga0496105_0072489 3300048908 Bacteria 2846
598 Ga0496105_0085161 3300048908 Bacteria 2611
599 Ga0496106_0001207 3300048909 Bacteria 19306
600 Ga0496106_0005486 3300048909 Bacteria 9382
601 Ga0496106_0080320 3300048909 Bacteria 2504
602 Ga0496106_0119329 3300048909 Bacteria 2060
603 Ga0496106_0195850 3300048909 Bacteria 1607
604 Ga0496106_0206736 3300048909 Unclassified 1563
605 Ga0496106_0207534 3300048909 Bacteria 1560
606 Ga0496107_0001691 3300048910 Bacteria 13818
607 Ga0496107_0001719 3300048910 Bacteria 13741
608 Ga0496107_0007634 3300048910 Bacteria 7468
609 Ga0496107_0011965 3300048910 Bacteria 6056
610 Ga0496107_0015197 3300048910 Bacteria 5393
611 Ga0496107_0026101 3300048910 Bacteria 4140
612 Ga0496107_0063786 3300048910 Bacteria 2670
613 Ga0496107_0065556 3300048910 Bacteria 2633
614 Ga0496107_0114715 3300048910 Bacteria 1982
615 Ga0496107_0141067 3300048910 Bacteria 1781
616 Ga0496107_0179775 3300048910 Bacteria 1571
617 Ga0496107_0358768 3300048910 Bacteria 1084
618 Ga0496108_0011148 3300048911 Bacteria 7305
619 Ga0496108_0042143 3300048911 Bacteria 3811
620 Ga0496108_0048746 3300048911 Bacteria 3542
621 Ga0496108_0055349 3300048911 Bacteria 3331
622 Ga0496108_0171658 3300048911 Bacteria 1876
623 Ga0496108_0888307 3300048911 Bacteria 765
624 Ga0496109_0010571 3300048912 Bacteria 7893
625 Ga0496109_0012446 3300048912 Bacteria 7344
626 Ga0496109_0022799 3300048912 Bacteria 5548
627 Ga0496109_0109284 3300048912 Bacteria 2570
628 Ga0496109_0161813 3300048912 Unclassified 2097
629 Ga0496109_0580681 3300048912 Bacteria 1056
630 Ga0496109_0722084 3300048912 Bacteria 934
631 Ga0496110_0007496 3300048913 Bacteria 8721
632 Ga0496110_0281207 3300048913 Bacteria 1515
633 Ga0496111_0060985 3300048914 Bacteria 2734
634 Ga0496111_0122647 3300048914 Bacteria 1920
635 Ga0496111_0253520 3300048914 Bacteria 1306
636 Ga0496111_0551425 3300048914 Bacteria 846
637 Ga0496112_0076010 3300048915 Bacteria 3322
638 Ga0496112_0151700 3300048915 Bacteria 2284
639 Ga0496112_0229228 3300048915 Bacteria 1812
640 Ga0496112_0358341 3300048915 Bacteria 1401
641 Ga0496112_0569465 3300048915 Bacteria 1066
642 Ga0496113_0078498 3300048916 Bacteria 2526
643 Ga0496113_0578546 3300048916 Bacteria 900
644 Ga0496114_0001293 3300048917 Bacteria 18946
645 Ga0496114_0002456 3300048917 Bacteria 14155
646 Ga0496114_0005072 3300048917 Bacteria 10265
647 Ga0496114_0014102 3300048917 Bacteria 6407
648 Ga0496114_0057318 3300048917 Bacteria 3252
649 Ga0496114_0074261 3300048917 Bacteria 2862
650 Ga0496114_0208835 3300048917 Bacteria 1712
651 Ga0496114_0241185 3300048917 Bacteria 1589
652 Ga0496114_0798595 3300048917 Unclassified 822
653 Ga0496115_0000227 3300048918 Bacteria 51259
654 Ga0496115_0000867 3300048918 Bacteria 22015
655 Ga0496115_0005762 3300048918 Bacteria 9021
656 Ga0496115_0009699 3300048918 Bacteria 7168
657 Ga0496115_0045364 3300048918 Bacteria 3508
658 Ga0496115_0102836 3300048918 Bacteria 2343
659 Ga0496115_0113090 3300048918 Bacteria 2231
660 Ga0496115_0385457 3300048918 Bacteria 1139
661 Ga0496115_0493958 3300048918 Bacteria 984
662 Ga0496126_0082413 3300048929 Bacteria 2842
663 Ga0501067_0003444 3300049583 Bacteria 8702
664 Ga0501068_0136269 3300049584 Bacteria 1537
665 Ga0501069_0001535 3300049585 Bacteria 11419
666 nmdc:mga0yw44_207261_c1 3300050492 Bacteria 1296
667 nmdc:mga05p37_168613_c1 3300050507 Bacteria 2671
668 nmdc:mga05p37_24796_c1 3300050507 Bacteria 7291
669 nmdc:mga05p37_290016_c1 3300050507 Bacteria 1948
670 nmdc:mga05p37_356227_c1 3300050507 Bacteria 1722
671 nmdc:mga05p37_481826_c1 3300050507 Bacteria 1429
672 nmdc:mga05p37_5975_c1 3300050507 Bacteria 14326
673 nmdc:mga05p37_821736_c1 3300050507 Unclassified 1013
674 nmdc:mga09592_100092_c1 3300050508 Bacteria 2482
675 nmdc:mga09592_266179_c1 3300050508 Bacteria 1487
676 nmdc:mga09592_470914_c1 3300050508 Unclassified 1083
677 nmdc:mga09592_635705_c1 3300050508 Unclassified 912
678 nmdc:mga09592_69793_c1 3300050508 Bacteria 2981
679 nmdc:mga09592_99263_c1 3300050508 Bacteria 2493
680 nmdc:mga0qj67_649682_c1 3300050509 Unclassified 841
681 nmdc:mga06r32_33429_c1 3300050510 Bacteria 4843
682 nmdc:mga06r32_5648_c1 3300050510 Bacteria 11252
683 nmdc:mga08y16_188440_c1 3300050511 Bacteria 2140
684 nmdc:mga08y16_20726_c1 3300050511 Bacteria 6939
685 nmdc:mga08y16_304871_c1 3300050511 Unclassified 1641
686 nmdc:mga08y16_58431_c1 3300050511 Bacteria 4030
687 nmdc:mga08y16_914685_c1 3300050511 Bacteria 863
688 nmdc:mga0n895_157998_c1 3300050512 Bacteria 2298
689 nmdc:mga0n895_17713_c1 3300050512 Bacteria 6572
690 nmdc:mga0n895_2041_c1 3300050512 Bacteria 15531
691 nmdc:mga0n895_282700_c1 3300050512 Bacteria 1682
692 nmdc:mga0n895_360874_c1 3300050512 Bacteria 1471
693 nmdc:mga0n895_45110_c1 3300050512 Bacteria 4301
694 nmdc:mga0n895_466616_c1 3300050512 Unclassified 1274
695 nmdc:mga0n895_49212_c1 3300050512 Bacteria 4128
696 nmdc:mga0n895_71944_c1 3300050512 Bacteria 3430
697 nmdc:mga0rr50_112785_c1 3300050513 Bacteria 2154
698 nmdc:mga0rr50_138622_c1 3300050513 Bacteria 1955
699 nmdc:mga0rr50_18740_c1 3300050513 Bacteria 4657
700 nmdc:mga0rr50_325049_c1 3300050513 Bacteria 1290
701 nmdc:mga0rr50_570_c1 3300050513 Bacteria 19808
702 nmdc:mga0rr50_592128_c1 3300050513 Bacteria 945
703 nmdc:mga08x19_100460_c1 3300050514 Bacteria 1919
704 nmdc:mga08x19_126266_c1 3300050514 Bacteria 1718
705 nmdc:mga08x19_21664_c1 3300050514 Bacteria 3971
706 nmdc:mga08x19_9820_c1 3300050514 Bacteria 5734
707 nmdc:mga0a205_307063_c1 3300050515 Bacteria 1459
708 nmdc:mga0a205_325338_c1 3300050515 Unclassified 1408
709 nmdc:mga0a205_386812_c1 3300050515 Bacteria 1264
710 nmdc:mga0a205_426513_c1 3300050515 Bacteria 1188
711 nmdc:mga0a205_431322_c1 3300050515 Bacteria 1179
712 nmdc:mga0a205_462629_c1 3300050515 Unclassified 1128
713 nmdc:mga0a205_908162_c1 3300050515 Unclassified 727
714 nmdc:mga0sz30_18404_c2 3300050516 Bacteria 2446
715 Ga0495601_0310265 3300053077 Unclassified 1027
716 Ga0495612_0000648 3300053078 Bacteria 13983
717 Ga0495619_0022226 3300053085 Bacteria 4056
718 Ga0495619_0501298 3300053085 Unclassified 835
719 Ga0500578_0336132 3300053086 Unclassified 886
720 Ga0500646_0054699 3300053090 Bacteria 1160
721 Ga0500583_0206130 3300053092 Unclassified 977
722 Ga0500654_121595 3300053099 Bacteria 1024
723 Ga0500569_008074 3300053109 Bacteria 2394
724 Ga0500561_0014965 3300053137 Bacteria 1712
725 Ga0500616_0033134 3300053153 Bacteria 2820
726 Ga0500634_0015437 3300053161 Bacteria 4055
727 Ga0530510_0062545 3300061734 Bacteria 2694
728 Ga0495602_0204919
729 JGI24747J21853_1011099
730 JGI24744J21845_10002897
731 Ga0070676_10152643
732 Ga0070683_100045356
733 Ga0070683_100585434
734 Ga0070690_100047336
735 Ga0068869_100128600
736 Ga0068869_100139105
737 Ga0068869_100149733
738 Ga0070680_100017805
739 Ga0070680_100184222
740 Ga0070680_100263589
741 Ga0070682_100002394
742 Ga0070682_100022994
743 Ga0068868_100015516
744 Ga0068868_100091883
745 Ga0068868_100143253
746 Ga0070660_100015317
747 Ga0070691_10029496
748 Ga0070691_10051628
749 Ga0070687_100304868
750 Ga0070687_100307732
751 Ga0070687_100450535
752 Ga0070692_10095438
753 Ga0070692_10262601
754 Ga0070668_100023578
755 Ga0070668_100248735
756 Ga0070669_100120066
757 Ga0070669_100184736
758 Ga0070675_100546685
759 Ga0070671_100048211
760 Ga0070674_100064498
761 Ga0070674_100646178
762 Ga0070673_100049553
763 Ga0070673_100111277
764 Ga0070688_100000841
765 Ga0070659_100006905
766 Ga0070659_100079438
767 Ga0070667_100192770
768 Ga0070709_10053899
769 Ga0070709_10211278
770 Ga0070714_100062419
771 Ga0070714_100088687
772 Ga0070714_100204689
773 Ga0070714_100234252
774 Ga0070714_100691230
775 Ga0070713_100631798
776 Ga0070710_10014642
777 Ga0070710_10242488
778 Ga0070701_10012209
779 Ga0070711_100047894
780 Ga0070711_100053464
781 Ga0070711_100093198
782 Ga0070711_100094408
783 Ga0070711_100179877
784 Ga0070711_100455449
785 Ga0070705_100022110
786 Ga0070705_100114078
787 Ga0070705_100397250
788 Ga0070700_100001535
789 Ga0070700_100034748
790 Ga0070694_100172697
791 Ga0070694_100223748
792 Ga0070694_100322016
793 Ga0070708_100066025
794 Ga0070708_100075392
795 Ga0070708_100657175
796 Ga0070663_100407715
797 Ga0070678_100032322
798 Ga0070678_100359491
799 Ga0070662_100112084
800 Ga0070662_100378597
801 Ga0070681_10804985
802 Ga0068867_100001471
803 Ga0068867_100046414
804 Ga0070685_10014278
805 Ga0070706_100068874
806 Ga0070706_100107639
807 Ga0070706_100202669
808 Ga0070706_100960396
809 Ga0070707_100000511
810 Ga0070707_100010774
811 Ga0070707_100036478
812 Ga0070707_100727335
813 Ga0070698_100055634
814 Ga0070698_100079781
815 Ga0070698_100110822
816 Ga0070698_100177267
817 Ga0070698_100472753
818 Ga0070698_100520805
819 Ga0070698_100625718
820 Ga0070698_100840861
821 Ga0070699_100117274
822 Ga0070679_100220661
823 Ga0070684_100487010
824 Ga0068853_100015572
825 Ga0070672_100087676
826 Ga0070672_100175644
827 Ga0070686_100040736
828 Ga0070686_100062901
829 Ga0070686_100126938
830 Ga0070686_100516901
831 Ga0070695_100093783
832 Ga0070695_100099097
833 Ga0070695_100165560
834 Ga0070696_100006869
835 Ga0070696_100122627
836 Ga0070696_100174785
837 Ga0070696_100211759
838 Ga0070696_100391987
839 Ga0070693_100001834
840 Ga0070693_100005402
841 Ga0070693_100170598
842 Ga0070693_100480409
843 Ga0070665_100095068
844 Ga0070704_100014179
845 Ga0070704_100086782
846 Ga0070704_100318175
847 Ga0068855_100156311
848 Ga0070664_100502036
849 Ga0068854_100391247
850 Ga0068854_100437271
851 Ga0068854_100663004
852 Ga0068856_100002969
853 Ga0068856_100021597
854 Ga0068856_100321475
855 Ga0068856_100415054
856 Ga0070702_100000676
857 Ga0070702_100026855
858 Ga0070702_100259934
859 Ga0068852_100054409
860 Ga0068864_100410839
861 Ga0068864_100778555
862 Ga0068866_10000624
863 Ga0068866_10006504
864 Ga0068866_10235318
865 Ga0068866_10428718
866 Ga0068861_100030702
867 Ga0068861_100065512
868 Ga0068863_100135083
869 Ga0068858_100276448
870 Ga0068858_100592589
871 Ga0068862_100128195
872 Ga0068862_100217476
873 Ga0068862_100268120
874 Ga0068862_100333842
875 Ga0081455_10101542
876 Ga0070717_10067652
877 Ga0070717_10162570
878 Ga0070717_10228285
879 Ga0070717_10385834
880 Ga0075365_10058973
881 Ga0075365_10438967
882 Ga0075364_10023067
883 Ga0070715_10000737
884 Ga0070715_10008584
885 Ga0070715_10096148
886 Ga0070716_100144365
887 Ga0070716_100166006
888 Ga0070716_100231052
889 Ga0070716_100282711
890 Ga0070712_100042581
891 Ga0070712_100141993
892 Ga0070712_100211879
893 Ga0070712_100612711
894 Ga0075362_10079471
895 Ga0075369_10166176
896 Ga0097621_100004541
897 Ga0097621_100016827
898 Ga0097621_100586079
899 Ga0068871_100127102
900 Ga0068871_100643936
901 Ga0075428_100006760
902 Ga0075428_100367704
903 Ga0075428_100373574
904 Ga0075430_100558903
905 Ga0075431_100003951
906 Ga0075431_100066582
907 Ga0075431_100956357
908 Ga0075433_10002301
909 Ga0075433_10280987
910 Ga0075433_10339193
911 Ga0075433_10374880
912 Ga0075433_10529448
913 Ga0075433_10535015
914 Ga0075433_10553039
915 Ga0075433_10620596
916 Ga0075434_100001735
917 Ga0075434_100002903
918 Ga0075434_100005482
919 Ga0075434_100035540
920 Ga0075434_100046968
921 Ga0075434_100070137
922 Ga0075434_100224654
923 Ga0075434_100467377
924 Ga0075429_100183696
925 Ga0068865_100001271
926 Ga0068865_100156395
927 Ga0075436_100003584
928 Ga0075436_100058845
929 Ga0075436_100115273
930 Ga0075436_100277829
931 Ga0075436_100314915
932 Ga0097620_100942440
933 Ga0075435_100000284
934 Ga0075435_100001809
935 Ga0075435_100226689
936 Ga0105250_10077542
937 Ga0105240_10826936
938 Ga0111539_10073102
939 Ga0111539_10117237
940 Ga0111539_10641969
941 Ga0111539_11380715
942 Ga0105245_10002220
943 Ga0105245_10012223
944 Ga0105245_10016423
945 Ga0105245_10016536
946 Ga0105245_10023158
947 Ga0105245_10055949
948 Ga0105245_10086114
949 Ga0105245_10185932
950 Ga0105245_10205405
951 Ga0105245_10410868
952 Ga0105245_10528407
953 Ga0105245_11112498
954 Ga0105247_10009237
955 Ga0105247_10135380
956 Ga0105247_10295955
957 Ga0114129_10028492
958 Ga0114129_10048033
959 Ga0114129_10206852
960 Ga0114129_10336450
961 Ga0114129_10339024
962 Ga0114129_11032202
963 Ga0105243_10002337
964 Ga0105243_10082229
965 Ga0105243_10245984
966 Ga0105243_10324090
967 Ga0105241_10032280
968 Ga0105241_10035308
969 Ga0105241_10961496
970 Ga0105242_10000857
971 Ga0105242_10063325
972 Ga0105242_10160149
973 Ga0105242_10241727
974 Ga0105242_10542559
975 Ga0105242_10602054
976 Ga0105242_10756665
977 Ga0105248_10016269
978 Ga0105248_10028019
979 Ga0105248_10757073
980 Ga0105237_10532120
981 Ga0105249_10005899
982 Ga0105249_10010239
983 Ga0105249_10118624
984 Ga0105249_10165713
985 Ga0105239_10016348
986 Ga0105239_10068167
987 Ga0105239_10221523
988 Ga0105239_10274783
989 Ga0105239_10365628
990 Ga0105239_10448867
991 Ga0105239_10483589
992 Ga0105239_11296706
993 Ga0105246_10014865
994 Ga0105246_10048970
995 Ga0105246_10097548
996 Ga0105246_10695907
997 Ga0157326_1003426
998 Ga0157373_10035036
999 Ga0157371_10382498
1000 Ga0157370_10727876
1001 Ga0157374_10027019
1002 Ga0157374_10755389
1003 Ga0157374_11282337
1004 Ga0157378_10003292
1005 Ga0157378_10313731
1006 Ga0157378_10392079
1007 Ga0157378_10668191
1008 Ga0157378_11109492
1009 Ga0163162_10021368
1010 Ga0163162_10147406
1011 Ga0163162_10512157
1012 Ga0157372_10136991
1013 Ga0157372_10825895
1014 Ga0157372_11256138
1015 Ga0157375_10297863
1016 Ga0157375_10320764
1017 Ga0157375_11602502
1018 Ga0163163_10933068
1019 Ga0157380_10249533
1020 Ga0157380_10266617
1021 Ga0157380_10443939
1022 Ga0157377_10005732
1023 Ga0157377_10223984
1024 Ga0157377_10273523
1025 Ga0157379_10466959
1026 Ga0157379_11060156
1027 Ga0157376_10003946
1028 Ga0157376_10220390
1029 Ga0157376_10249571
1030 Ga0163161_10261123
1031 Ga0163161_10641014
1032 Ga0163161_10666384
1033 Ga0163161_10750433
1034 Ga0207653_10003551
1035 Ga0207692_10008001
1036 Ga0207692_10013934
1037 Ga0207692_10265080
1038 Ga0207692_10377971
1039 Ga0207642_10210609
1040 Ga0207710_10066670
1041 Ga0207710_10198273
1042 Ga0207688_10014915
1043 Ga0207688_10089866
1044 Ga0207680_10066300
1045 Ga0207680_10234876
1046 Ga0207647_10063868
1047 Ga0207685_10008451
1048 Ga0207699_10012576
1049 Ga0207699_10491786
1050 Ga0207643_10204730
1051 Ga0207684_10185627
1052 Ga0207684_10272202
1053 Ga0207684_10337454
1054 Ga0207684_10350354
1055 Ga0207684_10586701
1056 Ga0207707_10567686
1057 Ga0207671_10205883
1058 Ga0207693_10001284
1059 Ga0207693_10006504
1060 Ga0207693_10032035
1061 Ga0207693_10037393
1062 Ga0207693_10052145
1063 Ga0207693_10060055
1064 Ga0207693_10121881
1065 Ga0207693_10140687
1066 Ga0207693_10157315
1067 Ga0207693_10221563
1068 Ga0207663_10025979
1069 Ga0207663_10028628
1070 Ga0207663_10090891
1071 Ga0207663_10405656
1072 Ga0207663_10405703
1073 Ga0207663_10482980
1074 Ga0207660_10005533
1075 Ga0207660_10050742
1076 Ga0207660_10311713
1077 Ga0207662_10072910
1078 Ga0207662_10226124
1079 Ga0207662_10277881
1080 Ga0207657_10018059
1081 Ga0207657_10138556
1082 Ga0207657_10217456
1083 Ga0207646_10008723
1084 Ga0207646_10073582
1085 Ga0207646_10456857
1086 Ga0207646_10509993
1087 Ga0207681_10062821
1088 Ga0207681_10272223
1089 Ga0207694_10052561
1090 Ga0207659_10062826
1091 Ga0207687_10008519
1092 Ga0207687_10020128
1093 Ga0207687_10020967
1094 Ga0207687_10069743
1095 Ga0207687_10094293
1096 Ga0207687_10121722
1097 Ga0207687_10176832
1098 Ga0207687_10320074
1099 Ga0207687_10348014
1100 Ga0207700_10241177
1101 Ga0207700_10496238
1102 Ga0207664_10024650
1103 Ga0207664_10044801
1104 Ga0207664_10091945
1105 Ga0207664_10146942
1106 Ga0207664_10281634
1107 Ga0207664_10554080
1108 Ga0207644_10057090
1109 Ga0207690_10016283
1110 Ga0207706_10071647
1111 Ga0207686_10001206
1112 Ga0207709_10003931
1113 Ga0207709_10027468
1114 Ga0207709_10298851
1115 Ga0207709_10314913
1116 Ga0207709_10364676
1117 Ga0207709_10417379
1118 Ga0207670_10248063
1119 Ga0207670_10299454
1120 Ga0207669_10002666
1121 Ga0207669_10366272
1122 Ga0207669_10573678
1123 Ga0207704_10009850
1124 Ga0207665_10005836
1125 Ga0207665_10006154
1126 Ga0207691_10002281
1127 Ga0207691_10137105
1128 Ga0207711_10054269
1129 Ga0207711_10058617
1130 Ga0207711_10391085
1131 Ga0207711_10539737
1132 Ga0207689_10122390
1133 Ga0207689_10397848
1134 Ga0207661_10079431
1135 Ga0207661_10875230
1136 Ga0207679_10211672
1137 Ga0207667_10113528
1138 Ga0207667_10251344
1139 Ga0207651_10088119
1140 Ga0207651_10470845
1141 Ga0207712_10002308
1142 Ga0207712_10003283
1143 Ga0207712_10164844
1144 Ga0207712_10221956
1145 Ga0207668_10137283
1146 Ga0207640_10128658
1147 Ga0207640_10253849
1148 Ga0207640_10380858
1149 Ga0207640_10590376
1150 Ga0207640_10735027
1151 Ga0207658_10155201
1152 Ga0207677_10059489
1153 Ga0207677_10273528
1154 Ga0207703_10152178
1155 Ga0207703_10241664
1156 Ga0207703_10543577
1157 Ga0207678_10050160
1158 Ga0207678_10105012
1159 Ga0207708_10000370
1160 Ga0207708_10004615
1161 Ga0207708_10056212
1162 Ga0207702_10002526
1163 Ga0207702_10039342
1164 Ga0207702_10699333
1165 Ga0207702_11175542
1166 Ga0207648_10001656
1167 Ga0207648_10097415
1168 Ga0207648_10171342
1169 Ga0207674_10076445
1170 Ga0207675_100001023
1171 Ga0207675_100022607
1172 Ga0207675_100060576
1173 Ga0207675_100226238
1174 Ga0207675_100563333
1175 Ga0207683_10000703
1176 Ga0207683_10009220
1177 Ga0207683_10126376
1178 Ga0207683_10143997
1179 Ga0207683_10466671
1180 Ga0207698_10038122
1181 Ga0207698_10122567
1182 Ga0207698_10892497
1183 Ga0209588_1011697
1184 Ga0207428_10040067
1185 Ga0207428_10272174
1186 Ga0207428_10394461
1187 Ga0268266_10213335
1188 Ga0268265_10143944
1189 Ga0268265_10145349
1190 Ga0268264_10055989
1191 Ga0268264_10292317
1192 Ga0268264_10292745
1193 Ga0307517_10054449
1194 Ga0307515_10008048
1195 Ga0307513_10608716
1196 Ga0373959_0010858
1197 Ga0373938_0008959
1198 Ga0373926_0020889
1199 Ga0373940_0093157
1200 Ga0373944_0032996
1201 Ga0373949_0007870
1202 Ga0373951_0009558
1203 Ga0373952_0007667
1204 Ga0373932_0013893
1205 Ga0373936_0110252
1206 Ga0373941_0025398
1207 Ga0373945_0043228
1208 Ga0373960_0096175
1209 Ga0373943_0006763
1210 Ga0373946_0116250
1211 Ga0373961_0022069
1212 Ga0373962_0065885
1213 Ga0373931_0180667
1214 Ga0373927_0121010
1215 Ga0373947_0004379
1216 Ga0373937_0759326
1217 Ga0373925_0007097
1218 Ga0373925_0548947
1219 Ga0451576_1166587
1220 Ga0495617_104559
1221 Ga0495592_0031672
1222 Ga0495603_0000598
1223 Ga0495629_0006073
1224 Ga0495629_0027320
1225 Ga0495629_0215926
1226 Ga0495641_0008494
1227 Ga0495653_0103112
1228 Ga0495580_0014040
1229 Ga0495582_0001037
1230 Ga0495639_0005017
1231 Ga0495662_0001596
1232 Ga0495584_0125112
1233 Ga0495594_0000152
1234 Ga0495594_0282436
1235 Ga0495607_0074576
1236 Ga0495620_0009203
1237 Ga0495628_0095857
1238 Ga0495630_0040708
1239 Ga0495630_0105465
1240 Ga0495632_0022092
1241 Ga0495637_0070353
1242 Ga0495643_0005524
1243 Ga0495644_0099882
1244 Ga0495666_0005591
1245 Ga0495666_0009431
1246 Ga0495665_0006283
1247 Ga0495640_0032279
1248 Ga0495640_0266764
1249 Ga0495586_0030816
1250 Ga0495645_0258558
1251 Ga0495622_0000291
1252 Ga0495667_0071040
1253 Ga0495656_0135992
1254 Ga0495611_0109226
1255 Ga0495659_0048643
1256 Ga0495659_0106752
1257 Ga0495599_0268590
1258 Ga0495646_0175064
1259 Ga0495647_0000716
1260 Ga0495658_0004324
1261 Ga0495658_0215409
1262 Ga0495613_0004872
1263 Ga0495624_0023521
1264 Ga0495624_0046134
1265 Ga0495670_0201537
1266 Ga0495670_0283235
1267 Ga0495671_0217225
1268 Ga0495649_0130661
1269 Ga0495589_0160956
1270 Ga0495581_0008820
1271 Ga0495674_0031944
1272 Ga0495674_0060097
1273 Ga0495674_0240599
1274 Ga0495672_0267083
1275 Ga0495676_0000619
1276 Ga0495676_0053837
1277 Ga0495683_0022209
1278 Ga0495687_004680
1279 Ga0495677_0198028
1280 Ga0495681_0010923
1281 Ga0495593_0007555
1282 Ga0495614_0000555
1283 Ga0495614_0004055
1284 Ga0495626_0092082
1285 Ga0496100_0006109
1286 Ga0496100_0015781
1287 Ga0496100_0061036
1288 Ga0496100_0144801
1289 Ga0496100_0413172
1290 Ga0496100_0622723
1291 Ga0496101_0001011
1292 Ga0496101_0001309
1293 Ga0496101_0012823
1294 Ga0496101_0033450
1295 Ga0496101_0054251
1296 Ga0496101_0088467
1297 Ga0496101_0170031
1298 Ga0496101_0185972
1299 Ga0496101_0229591
1300 Ga0496102_0003745
1301 Ga0496102_0006061
1302 Ga0496102_0016789
1303 Ga0496102_0022931
1304 Ga0496102_0047488
1305 Ga0496102_0188174
1306 Ga0496102_0355082
1307 Ga0496102_0738420
1308 Ga0496102_0851750
1309 Ga0496102_1214391
1310 Ga0496103_0003723
1311 Ga0496103_0009427
1312 Ga0496103_0051436
1313 Ga0496103_0080589
1314 Ga0496103_0166566
1315 Ga0496104_0000504
1316 Ga0496104_0004535
1317 Ga0496104_0008804
1318 Ga0496104_0032463
1319 Ga0496104_0045978
1320 Ga0496104_0098429
1321 Ga0496104_0444360
1322 Ga0496104_0903256
1323 Ga0496105_0052553
1324 Ga0496105_0072489
1325 Ga0496105_0085161
1326 Ga0496106_0001207
1327 Ga0496106_0005486
1328 Ga0496106_0080320
1329 Ga0496106_0119329
1330 Ga0496106_0195850
1331 Ga0496106_0206736
1332 Ga0496106_0207534
1333 Ga0496107_0001691
1334 Ga0496107_0001719
1335 Ga0496107_0007634
1336 Ga0496107_0011965
1337 Ga0496107_0015197
1338 Ga0496107_0026101
1339 Ga0496107_0063786
1340 Ga0496107_0065556
1341 Ga0496107_0114715
1342 Ga0496107_0141067
1343 Ga0496107_0179775
1344 Ga0496107_0358768
1345 Ga0496108_0011148
1346 Ga0496108_0042143
1347 Ga0496108_0048746
1348 Ga0496108_0055349
1349 Ga0496108_0171658
1350 Ga0496108_0888307
1351 Ga0496109_0010571
1352 Ga0496109_0012446
1353 Ga0496109_0022799
1354 Ga0496109_0109284
1355 Ga0496109_0161813
1356 Ga0496109_0580681
1357 Ga0496109_0722084
1358 Ga0496110_0007496
1359 Ga0496110_0281207
1360 Ga0496111_0060985
1361 Ga0496111_0122647
1362 Ga0496111_0253520
1363 Ga0496111_0551425
1364 Ga0496112_0076010
1365 Ga0496112_0151700
1366 Ga0496112_0229228
1367 Ga0496112_0358341
1368 Ga0496112_0569465
1369 Ga0496113_0078498
1370 Ga0496113_0578546
1371 Ga0496114_0001293
1372 Ga0496114_0002456
1373 Ga0496114_0005072
1374 Ga0496114_0014102
1375 Ga0496114_0057318
1376 Ga0496114_0074261
1377 Ga0496114_0208835
1378 Ga0496114_0241185
1379 Ga0496114_0798595
1380 Ga0496115_0000227
1381 Ga0496115_0000867
1382 Ga0496115_0005762
1383 Ga0496115_0009699
1384 Ga0496115_0045364
1385 Ga0496115_0102836
1386 Ga0496115_0113090
1387 Ga0496115_0385457
1388 Ga0496115_0493958
1389 Ga0496126_0082413
1390 Ga0501067_0003444
1391 Ga0501068_0136269
1392 Ga0501069_0001535
1393 nmdc:mga0yw44_207261_c1
1394 nmdc:mga05p37_168613_c1
1395 nmdc:mga05p37_24796_c1
1396 nmdc:mga05p37_290016_c1
1397 nmdc:mga05p37_356227_c1
1398 nmdc:mga05p37_481826_c1
1399 nmdc:mga05p37_5975_c1
1400 nmdc:mga05p37_821736_c1
1401 nmdc:mga09592_100092_c1
1402 nmdc:mga09592_266179_c1
1403 nmdc:mga09592_470914_c1
1404 nmdc:mga09592_635705_c1
1405 nmdc:mga09592_69793_c1
1406 nmdc:mga09592_99263_c1
1407 nmdc:mga0qj67_649682_c1
1408 nmdc:mga06r32_33429_c1
1409 nmdc:mga06r32_5648_c1
1410 nmdc:mga08y16_188440_c1
1411 nmdc:mga08y16_20726_c1
1412 nmdc:mga08y16_304871_c1
1413 nmdc:mga08y16_58431_c1
1414 nmdc:mga08y16_914685_c1
1415 nmdc:mga0n895_157998_c1
1416 nmdc:mga0n895_17713_c1
1417 nmdc:mga0n895_2041_c1
1418 nmdc:mga0n895_282700_c1
1419 nmdc:mga0n895_360874_c1
1420 nmdc:mga0n895_45110_c1
1421 nmdc:mga0n895_466616_c1
1422 nmdc:mga0n895_49212_c1
1423 nmdc:mga0n895_71944_c1
1424 nmdc:mga0rr50_112785_c1
1425 nmdc:mga0rr50_138622_c1
1426 nmdc:mga0rr50_18740_c1
1427 nmdc:mga0rr50_325049_c1
1428 nmdc:mga0rr50_570_c1
1429 nmdc:mga0rr50_592128_c1
1430 nmdc:mga08x19_100460_c1
1431 nmdc:mga08x19_126266_c1
1432 nmdc:mga08x19_21664_c1
1433 nmdc:mga08x19_9820_c1
1434 nmdc:mga0a205_307063_c1
1435 nmdc:mga0a205_325338_c1
1436 nmdc:mga0a205_386812_c1
1437 nmdc:mga0a205_426513_c1
1438 nmdc:mga0a205_431322_c1
1439 nmdc:mga0a205_462629_c1
1440 nmdc:mga0a205_908162_c1
1441 nmdc:mga0sz30_18404_c2
1442 Ga0495601_0310265
1443 Ga0495612_0000648
1444 Ga0495619_0022226
1445 Ga0495619_0501298
1446 Ga0500578_0336132
1447 Ga0500646_0054699
1448 Ga0500583_0206130
1449 Ga0500654_121595
1450 Ga0500569_008074
1451 Ga0500561_0014965
1452 Ga0500616_0033134
1453 Ga0500634_0015437
1454 Ga0530510_0062545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

13

171

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9456 9 189
1j2r-assembly1.cif.gz_A crystal structure of escherichia coli gene product yecd at 1.3 a resolution 0.9201 7 173
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9047 7 202
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.8948 7 205
1x9g-assembly1.cif.gz_A putative mar1 ribonuclease from leishmania donovani 0.8925 8 188
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9443 5 188 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9194 7 189 3.40.50.850
1j2rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9144 10 169 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9126 5 198 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8933 7 192 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V9PAZ2-F1-model_v4 Hydrolase 0.9911 41 165 GO:0016787
AF-A0A4R2JXE4-F1-model_v4 Nicotinamidase-related amidase 0.99 7 198
AF-A0A5J6IBJ0-F1-model_v4 Isochorismatase family protein 0.9882 7 199
AF-A0A442FYR2-F1-model_v4 Isochorismatase family protein 0.9882 9 158
AF-A0A1I4AVV4-F1-model_v4 Nicotinamidase-related amidase 0.988 7 198

Map