F477752

General Info

Members Datasets Scaffolds Average Seq Length
727 275 1454 219

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100033611|Ga0307408_1000336114
Length 234
Sequence VSWLSLVGDLSDLFMLTLLGAVLGLDVVSFPQAQISRPLAAATIAGFLTGNVAGGLLVGAALELIALETLPFGASRYPEWGSAAVVGGALFAEQAEGAAGALTTAVLAALATAWVGGWSMVELRKLNARWARVRLDRLARGSQRTVIGLQVAGMTADLARGGALTLLALLVMRPVVRASVGLWAGDARLARAVVVGVAATVAAGAAWKIFHAIPGARWFFAGGIVAGLALLALR

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
244 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
255 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
256 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
257 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
258 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
259 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
260 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.48
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100033611 3300031548 Bacteria 3585
2 Ga0070658_10009375 3300005327 Bacteria 7866
3 Ga0070658_10024932 3300005327 Bacteria 4796
4 Ga0070658_10027393 3300005327 Bacteria 4573
5 Ga0070658_10182518 3300005327 Unclassified 1766
6 Ga0070658_10324107 3300005327 Bacteria 1316
7 Ga0070658_10491032 3300005327 Unclassified 1060
8 Ga0070658_10523325 3300005327 Bacteria 1025
9 Ga0070676_10006960 3300005328 Bacteria 6053
10 Ga0070676_10008782 3300005328 Bacteria 5453
11 Ga0070683_100010082 3300005329 Bacteria 8105
12 Ga0070683_100011059 3300005329 Bacteria 7779
13 Ga0070683_100030201 3300005329 Bacteria 4915
14 Ga0070683_100109254 3300005329 Bacteria 2608
15 Ga0070683_100136967 3300005329 Bacteria 2319
16 Ga0070683_100161555 3300005329 Bacteria 2126
17 Ga0070683_100338800 3300005329 Unclassified 1432
18 Ga0070690_100011725 3300005330 Bacteria 5137
19 Ga0070690_100023823 3300005330 Bacteria 3759
20 Ga0070690_100032100 3300005330 Unclassified 3277
21 Ga0070690_100597610 3300005330 Unclassified 837
22 Ga0070670_100013576 3300005331 Bacteria 6981
23 Ga0070670_100043780 3300005331 Bacteria 3848
24 Ga0070670_100181230 3300005331 Bacteria 1829
25 Ga0070670_100301584 3300005331 Bacteria 1401
26 Ga0070670_100356481 3300005331 Bacteria 1286
27 Ga0070677_10113983 3300005333 Unclassified 1211
28 Ga0068869_100117301 3300005334 Unclassified 2032
29 Ga0068869_100134047 3300005334 Bacteria 1906
30 Ga0070666_10346238 3300005335 Bacteria 1063
31 Ga0070680_100001244 3300005336 Bacteria 18369
32 Ga0070680_100002160 3300005336 Bacteria 14534
33 Ga0070680_100002198 3300005336 Bacteria 14375
34 Ga0070680_100174837 3300005336 Bacteria 1808
35 Ga0070682_100005851 3300005337 Bacteria 6871
36 Ga0070682_100310411 3300005337 Bacteria 1161
37 Ga0068868_100016583 3300005338 Bacteria 5475
38 Ga0068868_100047252 3300005338 Bacteria 3372
39 Ga0068868_100243141 3300005338 Bacteria 1513
40 Ga0070660_100003351 3300005339 Bacteria 11012
41 Ga0070660_100065649 3300005339 Bacteria 2824
42 Ga0070660_100090234 3300005339 Bacteria 2416
43 Ga0070660_100206764 3300005339 Unclassified 1593
44 Ga0070689_100007804 3300005340 Bacteria 7498
45 Ga0070689_100070411 3300005340 Bacteria 2731
46 Ga0070689_100185709 3300005340 Bacteria 1691
47 Ga0070689_100609524 3300005340 Bacteria 946
48 Ga0070691_10012993 3300005341 Bacteria 3813
49 Ga0070687_100111500 3300005343 Bacteria 1549
50 Ga0070687_100122473 3300005343 Bacteria 1489
51 Ga0070661_100004963 3300005344 Bacteria 9164
52 Ga0070661_100010690 3300005344 Bacteria 6386
53 Ga0070661_100016018 3300005344 Bacteria 5291
54 Ga0070661_100069025 3300005344 Bacteria 2598
55 Ga0070661_100073256 3300005344 Bacteria 2521
56 Ga0070661_100144489 3300005344 Bacteria 1795
57 Ga0070661_100204206 3300005344 Bacteria 1511
58 Ga0070661_100648266 3300005344 Bacteria 857
59 Ga0070692_10011075 3300005345 Bacteria 4129
60 Ga0070692_10203246 3300005345 Bacteria 1162
61 Ga0070668_100002904 3300005347 Bacteria 12655
62 Ga0070668_100023889 3300005347 Bacteria 4628
63 Ga0070668_100354511 3300005347 Bacteria 1242
64 Ga0070668_100539670 3300005347 Bacteria 1014
65 Ga0070669_100002843 3300005353 Bacteria 12508
66 Ga0070669_100019178 3300005353 Bacteria 4887
67 Ga0070669_100124496 3300005353 Bacteria 1971
68 Ga0070669_100243624 3300005353 Bacteria 1429
69 Ga0070675_100001661 3300005354 Bacteria 16438
70 Ga0070675_100002764 3300005354 Bacteria 13193
71 Ga0070675_100009557 3300005354 Bacteria 7544
72 Ga0070675_100072507 3300005354 Bacteria 2859
73 Ga0070675_100239311 3300005354 Bacteria 1586
74 Ga0070675_100503325 3300005354 Bacteria 1092
75 Ga0070671_100037881 3300005355 Bacteria 4001
76 Ga0070671_100058742 3300005355 Bacteria 3201
77 Ga0070671_100152662 3300005355 Bacteria 1950
78 Ga0070671_100228099 3300005355 Bacteria 1580
79 Ga0070674_100090244 3300005356 Bacteria 2210
80 Ga0070674_100137619 3300005356 Bacteria 1829
81 Ga0070673_100010604 3300005364 Bacteria 6245
82 Ga0070673_100055682 3300005364 Bacteria 3117
83 Ga0070673_100057014 3300005364 Bacteria 3085
84 Ga0070673_100102908 3300005364 Bacteria 2355
85 Ga0070673_100695027 3300005364 Bacteria 934
86 Ga0070688_100001537 3300005365 Bacteria 11528
87 Ga0070688_100049707 3300005365 Bacteria 2610
88 Ga0070659_100001454 3300005366 Bacteria 17048
89 Ga0070659_100006033 3300005366 Bacteria 8737
90 Ga0070659_100009318 3300005366 Bacteria 7210
91 Ga0070659_100035063 3300005366 Bacteria 3905
92 Ga0070659_100055800 3300005366 Bacteria 3114
93 Ga0070659_100414124 3300005366 Bacteria 1139
94 Ga0070659_100700064 3300005366 Bacteria 876
95 Ga0070667_100014476 3300005367 Bacteria 6517
96 Ga0070667_100080602 3300005367 Unclassified 2784
97 Ga0070667_100093424 3300005367 Bacteria 2590
98 Ga0070709_10215310 3300005434 Bacteria 1367
99 Ga0070714_100245202 3300005435 Unclassified 1655
100 Ga0070714_100448280 3300005435 Unclassified 1225
101 Ga0070713_100000365 3300005436 Bacteria 29146
102 Ga0070701_10002895 3300005438 Bacteria 6686
103 Ga0070701_10110614 3300005438 Bacteria 1534
104 Ga0070701_10144819 3300005438 Bacteria 1362
105 Ga0070701_10205490 3300005438 Bacteria 1166
106 Ga0070711_100517190 3300005439 Unclassified 986
107 Ga0070700_100134889 3300005441 Unclassified 1670
108 Ga0070694_100214158 3300005444 Bacteria 1442
109 Ga0070708_100000024 3300005445 Bacteria 104177
110 Ga0070663_100021824 3300005455 Bacteria 4266
111 Ga0070663_100038762 3300005455 Bacteria 3326
112 Ga0070678_100051909 3300005456 Bacteria 2975
113 Ga0070678_100079734 3300005456 Bacteria 2477
114 Ga0070678_100279301 3300005456 Bacteria 1412
115 Ga0070678_100690576 3300005456 Bacteria 919
116 Ga0070662_100004241 3300005457 Bacteria 9041
117 Ga0070662_100033053 3300005457 Unclassified 3640
118 Ga0070662_100183559 3300005457 Bacteria 1651
119 Ga0070681_10001192 3300005458 Bacteria 22531
120 Ga0070681_10011247 3300005458 Bacteria 8854
121 Ga0070681_10011256 3300005458 Bacteria 8849
122 Ga0070681_10212364 3300005458 Bacteria 1851
123 Ga0070681_10480078 3300005458 Bacteria 1156
124 Ga0068867_100049245 3300005459 Bacteria 3101
125 Ga0068867_100088847 3300005459 Bacteria 2342
126 Ga0068867_100217493 3300005459 Bacteria 1538
127 Ga0068867_100729737 3300005459 Unclassified 877
128 Ga0070685_10016196 3300005466 Bacteria 3969
129 Ga0070685_10069124 3300005466 Bacteria 2088
130 Ga0070685_10078668 3300005466 Bacteria 1972
131 Ga0070698_100026323 3300005471 Bacteria 6054
132 Ga0070698_100051749 3300005471 Bacteria 4181
133 Ga0070698_100118685 3300005471 Bacteria 2606
134 Ga0070679_100001382 3300005530 Bacteria 21375
135 Ga0070679_100003354 3300005530 Bacteria 14675
136 Ga0070679_100010941 3300005530 Bacteria 8622
137 Ga0070679_100099094 3300005530 Bacteria 2901
138 Ga0070679_100254159 3300005530 Unclassified 1713
139 Ga0070679_100324996 3300005530 Bacteria 1487
140 Ga0070679_100369295 3300005530 Bacteria 1382
141 Ga0070684_100005054 3300005535 Bacteria 10070
142 Ga0070684_100005381 3300005535 Bacteria 9807
143 Ga0070684_100022465 3300005535 Bacteria 5262
144 Ga0070684_100075181 3300005535 Unclassified 2979
145 Ga0070684_100076346 3300005535 Bacteria 2957
146 Ga0070684_100077151 3300005535 Bacteria 2942
147 Ga0070684_100087472 3300005535 Bacteria 2767
148 Ga0070684_100213758 3300005535 Unclassified 1758
149 Ga0070684_100382742 3300005535 Bacteria 1296
150 Ga0070684_100777903 3300005535 Bacteria 894
151 Ga0068853_100110232 3300005539 Bacteria 2444
152 Ga0068853_100139595 3300005539 Bacteria 2175
153 Ga0068853_100485652 3300005539 Bacteria 1165
154 Ga0070672_100004646 3300005543 Bacteria 8998
155 Ga0070672_100246959 3300005543 Unclassified 1502
156 Ga0070672_100264407 3300005543 Bacteria 1451
157 Ga0070672_100538736 3300005543 Bacteria 1013
158 Ga0070672_100713102 3300005543 Bacteria 879
159 Ga0070672_100836348 3300005543 Unclassified 811
160 Ga0070686_100145078 3300005544 Bacteria 1656
161 Ga0070686_100284214 3300005544 Unclassified 1221
162 Ga0070686_100394122 3300005544 Bacteria 1051
163 Ga0070695_100001852 3300005545 Bacteria 11939
164 Ga0070693_100005385 3300005547 Bacteria 6138
165 Ga0070665_100024001 3300005548 Bacteria 6140
166 Ga0070665_100092682 3300005548 Bacteria 3026
167 Ga0070665_100211977 3300005548 Bacteria 1938
168 Ga0068855_100044173 3300005563 Bacteria 5275
169 Ga0068855_100096498 3300005563 Bacteria 3406
170 Ga0068855_100200134 3300005563 Unclassified 2249
171 Ga0068855_100335230 3300005563 Bacteria 1669
172 Ga0070664_100010557 3300005564 Bacteria 7487
173 Ga0070664_100028779 3300005564 Bacteria 4626
174 Ga0070664_100036381 3300005564 Bacteria 4136
175 Ga0070664_100043630 3300005564 Bacteria 3784
176 Ga0070664_100054904 3300005564 Bacteria 3381
177 Ga0070664_100074122 3300005564 Bacteria 2921
178 Ga0070664_100091040 3300005564 Bacteria 2640
179 Ga0070664_100096278 3300005564 Bacteria 2568
180 Ga0070664_100224049 3300005564 Bacteria 1683
181 Ga0070664_100231638 3300005564 Unclassified 1656
182 Ga0070664_100481959 3300005564 Unclassified 1141
183 Ga0070664_100777018 3300005564 Bacteria 895
184 Ga0068857_100007641 3300005577 Bacteria 9312
185 Ga0068857_100009475 3300005577 Bacteria 8456
186 Ga0068857_100014570 3300005577 Bacteria 6858
187 Ga0068857_100106433 3300005577 Bacteria 2519
188 Ga0068854_100561243 3300005578 Bacteria 970
189 Ga0068856_100002006 3300005614 Bacteria 21232
190 Ga0068856_100105890 3300005614 Bacteria 2806
191 Ga0068856_100226294 3300005614 Bacteria 1886
192 Ga0070702_100000558 3300005615 Bacteria 13581
193 Ga0068852_100026491 3300005616 Bacteria 4714
194 Ga0068852_100035480 3300005616 Bacteria 4161
195 Ga0068852_100039076 3300005616 Bacteria 3993
196 Ga0068852_100097864 3300005616 Bacteria 2640
197 Ga0068852_100583512 3300005616 Unclassified 1121
198 Ga0068859_100005085 3300005617 Bacteria 13363
199 Ga0068859_100010154 3300005617 Bacteria 9482
200 Ga0068859_100043357 3300005617 Bacteria 4521
201 Ga0068859_100076174 3300005617 Bacteria 3395
202 Ga0068859_100241752 3300005617 Bacteria 1895
203 Ga0068864_100008399 3300005618 Bacteria 8521
204 Ga0068864_100030068 3300005618 Bacteria 4604
205 Ga0068864_100058006 3300005618 Bacteria 3345
206 Ga0068861_100018071 3300005719 Bacteria 5014
207 Ga0068870_10002264 3300005840 Bacteria 7991
208 Ga0068870_10004708 3300005840 Bacteria 5896
209 Ga0068870_10034257 3300005840 Bacteria 2598
210 Ga0068870_10081092 3300005840 Bacteria 1794
211 Ga0068863_100007732 3300005841 Bacteria 10513
212 Ga0068863_100083253 3300005841 Bacteria 3031
213 Ga0068863_100597987 3300005841 Unclassified 1092
214 Ga0068858_100027910 3300005842 Bacteria 5244
215 Ga0068858_100105041 3300005842 Bacteria 2635
216 Ga0068858_100288183 3300005842 Bacteria 1565
217 Ga0068860_100008276 3300005843 Bacteria 10352
218 Ga0068860_100077426 3300005843 Unclassified 3162
219 Ga0068862_100000563 3300005844 Bacteria 38630
220 Ga0068862_100016777 3300005844 Bacteria 6097
221 Ga0070717_10005342 3300006028 Bacteria 9365
222 Ga0070716_100071232 3300006173 Bacteria 2043
223 Ga0070712_100022496 3300006175 Bacteria 4154
224 Ga0097621_100508450 3300006237 Bacteria 1092
225 Ga0068871_100004583 3300006358 Bacteria 9638
226 Ga0075428_100116530 3300006844 Bacteria 2910
227 Ga0075428_100173298 3300006844 Bacteria 2338
228 Ga0075428_100391251 3300006844 Bacteria 1490
229 Ga0075428_100414249 3300006844 Unclassified 1444
230 Ga0075430_100002009 3300006846 Bacteria 16757
231 Ga0075430_100087255 3300006846 Unclassified 2611
232 Ga0075430_100103903 3300006846 Bacteria 2372
233 Ga0075430_100156810 3300006846 Bacteria 1895
234 Ga0075430_100268091 3300006846 Bacteria 1413
235 Ga0075431_100191633 3300006847 Bacteria 2094
236 Ga0075431_100201027 3300006847 Bacteria 2039
237 Ga0075433_10040297 3300006852 Bacteria 4043
238 Ga0075433_10047006 3300006852 Bacteria 3754
239 Ga0075433_10431314 3300006852 Bacteria 1162
240 Ga0075434_100010409 3300006871 Bacteria 8717
241 Ga0075434_100055851 3300006871 Bacteria 3924
242 Ga0075434_100142159 3300006871 Bacteria 2420
243 Ga0075434_100243546 3300006871 Bacteria 1818
244 Ga0075434_100331924 3300006871 Unclassified 1541
245 Ga0075429_100025615 3300006880 Bacteria 5120
246 Ga0075429_100042420 3300006880 Bacteria 3960
247 Ga0068865_100026342 3300006881 Bacteria 3833
248 Ga0068865_100042531 3300006881 Unclassified 3099
249 Ga0097620_100005085 3300006931 Bacteria 13363
250 Ga0097620_100010154 3300006931 Bacteria 9482
251 Ga0097620_100043355 3300006931 Bacteria 4521
252 Ga0097620_100076171 3300006931 Bacteria 3395
253 Ga0097620_100241755 3300006931 Bacteria 1895
254 Ga0075435_100875011 3300007076 Bacteria 783
255 Ga0111539_10016990 3300009094 Bacteria 9005
256 Ga0111539_10118385 3300009094 Bacteria 3105
257 Ga0111539_10648123 3300009094 Bacteria 1230
258 Ga0111539_10944336 3300009094 Bacteria 1003
259 Ga0105245_10004657 3300009098 Bacteria 12123
260 Ga0105245_10043029 3300009098 Bacteria 4029
261 Ga0114129_10018210 3300009147 Bacteria 10000
262 Ga0114129_10041097 3300009147 Bacteria 6518
263 Ga0114129_10587774 3300009147 Unclassified 1444
264 Ga0114129_10659840 3300009147 Unclassified 1349
265 Ga0114129_11058786 3300009147 Bacteria 1018
266 Ga0105243_10168684 3300009148 Unclassified 1894
267 Ga0105243_10236912 3300009148 Bacteria 1622
268 Ga0105242_10038001 3300009176 Bacteria 3869
269 Ga0105242_10066442 3300009176 Bacteria 2978
270 Ga0105248_10003619 3300009177 Bacteria 17144
271 Ga0105248_10019488 3300009177 Bacteria 7507
272 Ga0105248_10057361 3300009177 Bacteria 4371
273 Ga0105248_10071679 3300009177 Bacteria 3893
274 Ga0105248_10365258 3300009177 Bacteria 1625
275 Ga0105238_10029562 3300009551 Bacteria 5582
276 Ga0105238_10442639 3300009551 Bacteria 1296
277 Ga0105249_10000662 3300009553 Bacteria 31249
278 Ga0105249_10005645 3300009553 Bacteria 10826
279 Ga0105239_10116400 3300010375 Unclassified 2966
280 Ga0105239_10172106 3300010375 Bacteria 2422
281 Ga0105246_10003077 3300011119 Bacteria 10132
282 Ga0157373_10010157 3300013100 Bacteria 6936
283 Ga0157373_10070737 3300013100 Bacteria 2465
284 Ga0157371_10025629 3300013102 Bacteria 4295
285 Ga0157371_10033766 3300013102 Bacteria 3674
286 Ga0157371_10412856 3300013102 Bacteria 989
287 Ga0157369_10034675 3300013105 Bacteria 5536
288 Ga0157369_10084620 3300013105 Unclassified 3390
289 Ga0157369_10415161 3300013105 Bacteria 1395
290 Ga0157369_10944208 3300013105 Bacteria 884
291 Ga0157378_10339310 3300013297 Bacteria 1465
292 Ga0163162_10021469 3300013306 Bacteria 6359
293 Ga0163162_10124202 3300013306 Bacteria 2687
294 Ga0163162_10424286 3300013306 Bacteria 1462
295 Ga0157372_10003051 3300013307 Bacteria 18053
296 Ga0157372_10012575 3300013307 Bacteria 9014
297 Ga0157372_10033314 3300013307 Bacteria 5657
298 Ga0157372_10040174 3300013307 Bacteria 5165
299 Ga0157372_10051110 3300013307 Bacteria 4599
300 Ga0157372_10077526 3300013307 Bacteria 3754
301 Ga0157372_10103620 3300013307 Bacteria 3251
302 Ga0157372_10109041 3300013307 Bacteria 3170
303 Ga0157372_10207953 3300013307 Bacteria 2268
304 Ga0157372_10292365 3300013307 Bacteria 1895
305 Ga0157372_10893144 3300013307 Bacteria 1031
306 Ga0157375_10036954 3300013308 Bacteria 4675
307 Ga0157375_10070807 3300013308 Bacteria 3499
308 Ga0157375_10082574 3300013308 Bacteria 3256
309 Ga0157375_10114734 3300013308 Bacteria 2796
310 Ga0157375_10332655 3300013308 Bacteria 1684
311 Ga0157375_10582468 3300013308 Unclassified 1279
312 Ga0163163_10022697 3300014325 Bacteria 5946
313 Ga0163163_10038847 3300014325 Bacteria 4641
314 Ga0163163_10106330 3300014325 Bacteria 2832
315 Ga0163163_10876016 3300014325 Unclassified 961
316 Ga0157380_10001269 3300014326 Bacteria 16396
317 Ga0157380_10178020 3300014326 Unclassified 1866
318 Ga0157377_10003414 3300014745 Bacteria 7188
319 Ga0157377_10009008 3300014745 Bacteria 4886
320 Ga0157379_10009985 3300014968 Bacteria 8273
321 Ga0157376_10012034 3300014969 Bacteria 6404
322 Ga0163161_10024987 3300017792 Bacteria 4223
323 Ga0163161_10410076 3300017792 Bacteria 1088
324 Ga0206354_10507204 3300020081 Bacteria 820
325 Ga0206353_10412376 3300020082 Unclassified 1104
326 Ga0213876_10049470 3300021384 Unclassified 2221
327 Ga0207656_10038320 3300025321 Bacteria 2022
328 Ga0207682_10009484 3300025893 Bacteria 3840
329 Ga0207688_10046677 3300025901 Bacteria 2419
330 Ga0207688_10150665 3300025901 Bacteria 1374
331 Ga0207647_10040350 3300025904 Bacteria 2940
332 Ga0207645_10005607 3300025907 Bacteria 9077
333 Ga0207645_10006068 3300025907 Bacteria 8689
334 Ga0207643_10010330 3300025908 Bacteria 5026
335 Ga0207643_10052872 3300025908 Bacteria 2307
336 Ga0207643_10205515 3300025908 Bacteria 1201
337 Ga0207705_10015020 3300025909 Bacteria 5567
338 Ga0207705_10017160 3300025909 Bacteria 5186
339 Ga0207705_10131702 3300025909 Bacteria 1861
340 Ga0207705_10329830 3300025909 Unclassified 1173
341 Ga0207705_10388726 3300025909 Bacteria 1078
342 Ga0207705_10535453 3300025909 Archaea 910
343 Ga0207707_10003275 3300025912 Bacteria 14385
344 Ga0207707_10004812 3300025912 Bacteria 11842
345 Ga0207707_10032034 3300025912 Bacteria 4602
346 Ga0207707_10221052 3300025912 Bacteria 1649
347 Ga0207707_10447979 3300025912 Bacteria 1105
348 Ga0207693_10010340 3300025915 Bacteria 7575
349 Ga0207660_10003814 3300025917 Bacteria 9820
350 Ga0207660_10183836 3300025917 Unclassified 1625
351 Ga0207662_10001456 3300025918 Bacteria 11485
352 Ga0207662_10010512 3300025918 Bacteria 5113
353 Ga0207662_10024675 3300025918 Bacteria 3460
354 Ga0207657_10003620 3300025919 Bacteria 16467
355 Ga0207657_10019361 3300025919 Bacteria 6466
356 Ga0207657_10069469 3300025919 Bacteria 2989
357 Ga0207657_10186237 3300025919 Bacteria 1676
358 Ga0207657_10291890 3300025919 Bacteria 1293
359 Ga0207649_10001109 3300025920 Bacteria 16344
360 Ga0207649_10004268 3300025920 Bacteria 7780
361 Ga0207649_10020418 3300025920 Bacteria 3799
362 Ga0207649_10046813 3300025920 Bacteria 2659
363 Ga0207649_10118463 3300025920 Bacteria 1781
364 Ga0207649_10480732 3300025920 Bacteria 942
365 Ga0207652_10019280 3300025921 Bacteria 5608
366 Ga0207652_10034855 3300025921 Bacteria 4244
367 Ga0207652_10040876 3300025921 Bacteria 3939
368 Ga0207652_10100849 3300025921 Bacteria 2549
369 Ga0207652_10123676 3300025921 Bacteria 2303
370 Ga0207652_10314308 3300025921 Unclassified 1414
371 Ga0207681_10041868 3300025923 Bacteria 3056
372 Ga0207681_10133825 3300025923 Unclassified 1836
373 Ga0207681_10400999 3300025923 Bacteria 1108
374 Ga0207694_10020485 3300025924 Bacteria 5003
375 Ga0207650_10018343 3300025925 Bacteria 4910
376 Ga0207650_10028340 3300025925 Bacteria 4015
377 Ga0207650_10132643 3300025925 Bacteria 1951
378 Ga0207650_10193435 3300025925 Bacteria 1626
379 Ga0207650_10812675 3300025925 Bacteria 792
380 Ga0207659_10011043 3300025926 Bacteria 5693
381 Ga0207659_10026481 3300025926 Bacteria 3912
382 Ga0207659_10034004 3300025926 Bacteria 3512
383 Ga0207659_10357868 3300025926 Unclassified 1212
384 Ga0207687_10002121 3300025927 Bacteria 13548
385 Ga0207687_10024522 3300025927 Bacteria 4030
386 Ga0207687_10208163 3300025927 Bacteria 1533
387 Ga0207700_10000601 3300025928 Bacteria 21049
388 Ga0207700_10854324 3300025928 Bacteria 814
389 Ga0207664_10211242 3300025929 Unclassified 1679
390 Ga0207664_10213081 3300025929 Bacteria 1672
391 Ga0207644_10016146 3300025931 Bacteria 5023
392 Ga0207644_10350771 3300025931 Unclassified 1198
393 Ga0207644_10477930 3300025931 Bacteria 1026
394 Ga0207690_10009752 3300025932 Bacteria 5705
395 Ga0207690_10009969 3300025932 Bacteria 5642
396 Ga0207690_10042710 3300025932 Bacteria 2979
397 Ga0207690_10117491 3300025932 Bacteria 1925
398 Ga0207690_10460309 3300025932 Bacteria 1023
399 Ga0207690_10481595 3300025932 Bacteria 1001
400 Ga0207706_10000155 3300025933 Bacteria 75598
401 Ga0207706_10021799 3300025933 Bacteria 5751
402 Ga0207706_10069928 3300025933 Unclassified 3087
403 Ga0207706_10088595 3300025933 Bacteria 2721
404 Ga0207706_10125358 3300025933 Bacteria 2259
405 Ga0207706_10209860 3300025933 Bacteria 1707
406 Ga0207706_10405810 3300025933 Bacteria 1181
407 Ga0207686_10076228 3300025934 Unclassified 2173
408 Ga0207686_10698572 3300025934 Bacteria 806
409 Ga0207670_10128309 3300025936 Unclassified 1854
410 Ga0207670_10415550 3300025936 Unclassified 1078
411 Ga0207669_10019424 3300025937 Bacteria 3538
412 Ga0207691_10001667 3300025940 Bacteria 21972
413 Ga0207691_10002873 3300025940 Bacteria 16783
414 Ga0207691_10050140 3300025940 Bacteria 3823
415 Ga0207691_10076157 3300025940 Bacteria 3024
416 Ga0207691_10136856 3300025940 Bacteria 2160
417 Ga0207691_10149704 3300025940 Bacteria 2052
418 Ga0207691_10293469 3300025940 Bacteria 1398
419 Ga0207691_10702572 3300025940 Unclassified 853
420 Ga0207711_10059799 3300025941 Bacteria 3281
421 Ga0207711_10114664 3300025941 Bacteria 2400
422 Ga0207711_10278792 3300025941 Bacteria 1539
423 Ga0207711_10502334 3300025941 Bacteria 1130
424 Ga0207711_10563085 3300025941 Bacteria 1063
425 Ga0207689_10002528 3300025942 Bacteria 16994
426 Ga0207689_10026628 3300025942 Bacteria 4843
427 Ga0207689_10052931 3300025942 Unclassified 3344
428 Ga0207661_10001218 3300025944 Bacteria 17203
429 Ga0207661_10001484 3300025944 Bacteria 15869
430 Ga0207661_10029599 3300025944 Bacteria 4208
431 Ga0207661_10036765 3300025944 Bacteria 3825
432 Ga0207661_10037049 3300025944 Bacteria 3811
433 Ga0207661_10057765 3300025944 Bacteria 3121
434 Ga0207661_10062308 3300025944 Bacteria 3017
435 Ga0207661_10119346 3300025944 Bacteria 2243
436 Ga0207661_10342635 3300025944 Bacteria 1347
437 Ga0207661_10649540 3300025944 Bacteria 969
438 Ga0207679_10001557 3300025945 Bacteria 14345
439 Ga0207679_10002457 3300025945 Bacteria 11407
440 Ga0207679_10004253 3300025945 Bacteria 8897
441 Ga0207679_10010095 3300025945 Bacteria 6070
442 Ga0207679_10010457 3300025945 Bacteria 5976
443 Ga0207679_10022702 3300025945 Bacteria 4277
444 Ga0207679_10097178 3300025945 Bacteria 2293
445 Ga0207679_10102806 3300025945 Bacteria 2238
446 Ga0207679_10152676 3300025945 Bacteria 1882
447 Ga0207679_10319700 3300025945 Bacteria 1343
448 Ga0207667_10031049 3300025949 Bacteria 5771
449 Ga0207667_10040067 3300025949 Bacteria 4988
450 Ga0207667_10082511 3300025949 Unclassified 3330
451 Ga0207667_10227051 3300025949 Bacteria 1912
452 Ga0207667_10310832 3300025949 Bacteria 1610
453 Ga0207651_10013685 3300025960 Bacteria 4653
454 Ga0207651_10502175 3300025960 Bacteria 1049
455 Ga0207651_10559963 3300025960 Unclassified 995
456 Ga0207668_10004444 3300025972 Bacteria 8236
457 Ga0207668_10052146 3300025972 Bacteria 2829
458 Ga0207668_10140751 3300025972 Unclassified 1855
459 Ga0207668_10160022 3300025972 Bacteria 1753
460 Ga0207668_10442764 3300025972 Bacteria 1107
461 Ga0207640_10614043 3300025981 Bacteria 922
462 Ga0207658_10033104 3300025986 Bacteria 3684
463 Ga0207658_10049030 3300025986 Bacteria 3101
464 Ga0207658_10103736 3300025986 Bacteria 2233
465 Ga0207658_10212893 3300025986 Bacteria 1621
466 Ga0207677_10088465 3300026023 Bacteria 2246
467 Ga0207677_10096358 3300026023 Bacteria 2164
468 Ga0207677_10125413 3300026023 Unclassified 1940
469 Ga0207677_10516794 3300026023 Unclassified 1035
470 Ga0207703_10141361 3300026035 Bacteria 2089
471 Ga0207639_10014233 3300026041 Bacteria 5587
472 Ga0207639_10034713 3300026041 Bacteria 3730
473 Ga0207639_10388438 3300026041 Bacteria 1255
474 Ga0207639_11234126 3300026041 Bacteria 702
475 Ga0207708_10049485 3300026075 Bacteria 3200
476 Ga0207708_10074349 3300026075 Unclassified 2604
477 Ga0207708_10375422 3300026075 Unclassified 1171
478 Ga0207702_10004386 3300026078 Bacteria 12569
479 Ga0207702_10029775 3300026078 Bacteria 4544
480 Ga0207702_10254850 3300026078 Bacteria 1650
481 Ga0207702_10840611 3300026078 Bacteria 908
482 Ga0207641_10006591 3300026088 Bacteria 9756
483 Ga0207648_10016415 3300026089 Bacteria 6765
484 Ga0207648_10416299 3300026089 Bacteria 1220
485 Ga0207676_10002872 3300026095 Bacteria 12275
486 Ga0207676_10019772 3300026095 Bacteria 4918
487 Ga0207676_10046437 3300026095 Bacteria 3361
488 Ga0207676_10049150 3300026095 Bacteria 3279
489 Ga0207676_10339697 3300026095 Bacteria 1385
490 Ga0207676_10361887 3300026095 Unclassified 1345
491 Ga0207674_10000809 3300026116 Bacteria 40695
492 Ga0207674_10001550 3300026116 Bacteria 29596
493 Ga0207674_10001551 3300026116 Bacteria 29595
494 Ga0207674_10017983 3300026116 Bacteria 7700
495 Ga0207674_10026402 3300026116 Bacteria 6169
496 Ga0207674_10049063 3300026116 Bacteria 4319
497 Ga0207674_10423776 3300026116 Unclassified 1286
498 Ga0207675_100001026 3300026118 Bacteria 27652
499 Ga0207683_10282952 3300026121 Bacteria 1515
500 Ga0207698_10004902 3300026142 Bacteria 8208
501 Ga0207698_10018642 3300026142 Bacteria 4736
502 Ga0207698_10094725 3300026142 Bacteria 2456
503 Ga0207698_10958641 3300026142 Bacteria 865
504 Ga0268266_10040493 3300028379 Bacteria 3971
505 Ga0268265_10003561 3300028380 Bacteria 11130
506 Ga0268265_10027238 3300028380 Bacteria 4077
507 Ga0268265_10090110 3300028380 Bacteria 2449
508 Ga0268264_10045094 3300028381 Bacteria 3660
509 Ga0268264_10062479 3300028381 Unclassified 3127
510 Ga0265332_10003146 3300031238 Bacteria 8039
511 Ga0265332_10008139 3300031238 Bacteria 4715
512 Ga0265320_10080759 3300031240 Bacteria 1518
513 Ga0265340_10069845 3300031247 Bacteria 1667
514 Ga0307408_100001643 3300031548 Bacteria 16496
515 Ga0307408_100154213 3300031548 Bacteria 1816
516 Ga0307408_100314334 3300031548 Bacteria 1317
517 Ga0307408_100327023 3300031548 Bacteria 1293
518 Ga0307408_100385725 3300031548 Bacteria 1199
519 Ga0265314_10013156 3300031711 Bacteria 6702
520 Ga0307405_10000555 3300031731 Bacteria 14193
521 Ga0307405_10012954 3300031731 Bacteria 4435
522 Ga0307405_10040514 3300031731 Unclassified 2822
523 Ga0307405_10124473 3300031731 Bacteria 1770
524 Ga0307405_10159212 3300031731 Unclassified 1597
525 Ga0307413_10000588 3300031824 Bacteria 12205
526 Ga0307413_10102036 3300031824 Bacteria 1898
527 Ga0307413_10110610 3300031824 Bacteria 1838
528 Ga0307413_10444567 3300031824 Unclassified 1027
529 Ga0307410_10008576 3300031852 Bacteria 5677
530 Ga0307410_10008824 3300031852 Bacteria 5618
531 Ga0307410_10012850 3300031852 Bacteria 4861
532 Ga0307410_10040121 3300031852 Bacteria 3079
533 Ga0307410_10066404 3300031852 Bacteria 2485
534 Ga0307410_10127060 3300031852 Bacteria 1868
535 Ga0307410_10253097 3300031852 Unclassified 1370
536 Ga0307406_10001667 3300031901 Bacteria 12207
537 Ga0307406_10029885 3300031901 Bacteria 3303
538 Ga0307406_10032347 3300031901 Bacteria 3193
539 Ga0307406_10070275 3300031901 Bacteria 2292
540 Ga0307406_10227780 3300031901 Unclassified 1390
541 Ga0307407_10001245 3300031903 Bacteria 9059
542 Ga0307407_10002737 3300031903 Bacteria 7010
543 Ga0307407_10018611 3300031903 Bacteria 3517
544 Ga0307407_10308658 3300031903 Unclassified 1106
545 Ga0307407_10312758 3300031903 Bacteria 1099
546 Ga0307407_10347141 3300031903 Bacteria 1050
547 Ga0307407_10480218 3300031903 Bacteria 907
548 Ga0307412_10005921 3300031911 Bacteria 6892
549 Ga0307412_10006175 3300031911 Bacteria 6753
550 Ga0307412_10012952 3300031911 Bacteria 4876
551 Ga0307412_10063227 3300031911 Bacteria 2496
552 Ga0307412_10280565 3300031911 Bacteria 1308
553 Ga0307409_100000084 3300031995 Bacteria 33710
554 Ga0307409_100025800 3300031995 Bacteria 4130
555 Ga0307409_100041503 3300031995 Bacteria 3437
556 Ga0307409_100073955 3300031995 Bacteria 2721
557 Ga0307409_100153384 3300031995 Bacteria 2004
558 Ga0307409_100198873 3300031995 Bacteria 1791
559 Ga0307409_100486876 3300031995 Bacteria 1198
560 Ga0307416_100000582 3300032002 Bacteria 18751
561 Ga0307416_100012115 3300032002 Bacteria 5791
562 Ga0307416_100012575 3300032002 Bacteria 5711
563 Ga0307416_100023653 3300032002 Bacteria 4464
564 Ga0307416_100163195 3300032002 Bacteria 2063
565 Ga0307416_100186886 3300032002 Bacteria 1949
566 Ga0307416_100303938 3300032002 Unclassified 1587
567 Ga0307416_100305367 3300032002 Bacteria 1584
568 Ga0307416_100713564 3300032002 Bacteria 1093
569 Ga0307414_10004995 3300032004 Bacteria 7257
570 Ga0307414_10191649 3300032004 Unclassified 1655
571 Ga0307414_10658814 3300032004 Bacteria 944
572 Ga0307411_10000070 3300032005 Bacteria 31137
573 Ga0307411_10000266 3300032005 Bacteria 17168
574 Ga0307411_10009129 3300032005 Bacteria 5191
575 Ga0307411_10109692 3300032005 Bacteria 1972
576 Ga0307411_10136019 3300032005 Bacteria 1804
577 Ga0307411_10196455 3300032005 Bacteria 1545
578 Ga0307411_10242531 3300032005 Bacteria 1412
579 Ga0307411_10493083 3300032005 Unclassified 1034
580 Ga0307411_10925341 3300032005 Unclassified 776
581 Ga0307415_100003789 3300032126 Bacteria 7749
582 Ga0307415_100009913 3300032126 Bacteria 5369
583 Ga0307415_100038216 3300032126 Bacteria 3161
584 Ga0307415_100063514 3300032126 Bacteria 2566
585 Ga0307415_100334401 3300032126 Bacteria 1269
586 Ga0373958_0050250 3300034819 Unclassified 879
587 Ga0373934_0003588 3300035086 Bacteria 5707
588 Ga0373923_0004376 3300035111 Bacteria 4681
589 Ga0373953_0004240 3300035117 Unclassified 4552
590 Ga0373955_0006301 3300035172 Bacteria 5402
591 Ga0373924_0013898 3300035410 Unclassified 3032
592 Ga0373931_0054905 3300035691 Unclassified 2130
593 Ga0373931_0347576 3300035691 Bacteria 928
594 Ga0373933_0008609 3300035724 Bacteria 5565
595 Ga0373933_0607181 3300035724 Bacteria 718
596 Ga0373937_0008633 3300036401 Bacteria 8852
597 Ga0373937_0270657 3300036401 Bacteria 1603
598 Ga0373925_0070236 3300037068 Unclassified 2647
599 Ga0373925_0362511 3300037068 Bacteria 1178
600 Ga0395900_0019850 3300037418 Bacteria 6851
601 Ga0395900_0638617 3300037418 Bacteria 1002
602 Ga0395905_0004652 3300037471 Bacteria 14191
603 Ga0395905_0170920 3300037471 Bacteria 2042
604 Ga0395905_0482610 3300037471 Bacteria 1139
605 Ga0436365_0446906 3300039437 Unclassified 1252
606 Ga0439450_041896 3300042008 Unclassified 1066
607 Ga0450914_020997 3300042118 Unclassified 728
608 Ga0451577_0037993 3300042876 Bacteria 4332
609 Ga0451576_0019886 3300045051 Bacteria 7323
610 Ga0451576_0228736 3300045051 Bacteria 1942
611 Ga0451576_1024610 3300045051 Bacteria 865
612 Ga0466967_0005004 3300045976 Bacteria 9079
613 Ga0466967_0198456 3300045976 Bacteria 1899
614 Ga0495592_0066816 3300046454 Unclassified 2630
615 Ga0495629_0007405 3300046459 Bacteria 8088
616 Ga0495629_0014112 3300046459 Bacteria 5755
617 Ga0495629_0194816 3300046459 Bacteria 1402
618 Ga0495629_0429921 3300046459 Bacteria 895
619 Ga0495651_0012210 3300046462 Bacteria 6615
620 Ga0495653_0017133 3300046463 Bacteria 5893
621 Ga0495639_0045059 3300046475 Bacteria 1995
622 Ga0495594_0022374 3300046499 Bacteria 3381
623 Ga0495594_0129434 3300046499 Bacteria 1429
624 Ga0495608_0029791 3300046511 Unclassified 3699
625 Ga0495618_0154995 3300046514 Bacteria 1462
626 Ga0495628_0005937 3300046516 Bacteria 10685
627 Ga0495630_0018256 3300046517 Bacteria 5151
628 Ga0495652_0014836 3300046529 Bacteria 6985
629 Ga0495665_0043250 3300046531 Bacteria 2396
630 Ga0495587_0007410 3300046536 Bacteria 7106
631 Ga0495645_0015144 3300046543 Bacteria 5482
632 Ga0495667_0006744 3300046559 Bacteria 7791
633 Ga0495635_0004505 3300046663 Bacteria 9651
634 Ga0495657_0015202 3300046675 Bacteria 5636
635 Ga0495623_0002993 3300046679 Bacteria 11115
636 Ga0495658_0025265 3300046683 Bacteria 3173
637 Ga0495613_0084897 3300046689 Bacteria 2298
638 Ga0495600_0003030 3300046809 Bacteria 9812
639 Ga0495600_0040340 3300046809 Bacteria 3040
640 Ga0495604_0005420 3300047317 Bacteria 10117
641 Ga0495636_0029351 3300047318 Bacteria 2245
642 Ga0495674_0006248 3300047319 Bacteria 11431
643 Ga0495672_0008501 3300047320 Bacteria 7559
644 Ga0495680_0027329 3300047322 Bacteria 4690
645 Ga0495675_0007997 3300047444 Bacteria 6541
646 Ga0495684_0005933 3300047471 Bacteria 9491
647 Ga0495602_0003786 3300048088 Bacteria 15729
648 Ga0495602_0144918 3300048088 Bacteria 1875
649 Ga0496104_0117006 3300048907 Bacteria 2558
650 Ga0496107_0213165 3300048910 Bacteria 1436
651 Ga0496108_0097146 3300048911 Bacteria 2510
652 Ga0496108_0121436 3300048911 Bacteria 2241
653 Ga0496108_0130917 3300048911 Unclassified 2156
654 Ga0496108_0244120 3300048911 Bacteria 1562
655 Ga0496108_0355287 3300048911 Unclassified 1279
656 Ga0496108_0393912 3300048911 Bacteria 1210
657 Ga0496109_0137832 3300048912 Bacteria 2281
658 Ga0496109_0414518 3300048912 Unclassified 1273
659 Ga0496112_0296579 3300048915 Bacteria 1562
660 Ga0496112_0422361 3300048915 Bacteria 1272
661 Ga0496113_0040616 3300048916 Bacteria 3429
662 Ga0496113_0124975 3300048916 Bacteria 2014
663 Ga0496113_0129270 3300048916 Bacteria 1981
664 Ga0496113_0284428 3300048916 Unclassified 1323
665 Ga0496114_0122736 3300048917 Bacteria 2236
666 Ga0496115_0077378 3300048918 Bacteria 2705
667 Ga0501292_032436 3300049515 Unclassified 882
668 Ga0501032_0477191 3300049569 Bacteria 798
669 Ga0501033_0271827 3300049570 Bacteria 1198
670 Ga0501034_0397196 3300049571 Bacteria 1302
671 Ga0501037_0179249 3300049573 Bacteria 1504
672 Ga0501038_0069258 3300049574 Bacteria 2997
673 Ga0501042_0090517 3300049578 Bacteria 2196
674 Ga0501043_0140405 3300049579 Bacteria 1892
675 Ga0501046_0191420 3300049580 Bacteria 1526
676 Ga0501047_0007988 3300049581 Bacteria 9977
677 Ga0501048_0337384 3300049582 Unclassified 1074
678 Ga0501069_0280392 3300049585 Bacteria 975
679 Ga0501070_0123001 3300049586 Bacteria 2144
680 Ga0501071_0643223 3300049587 Bacteria 816
681 Ga0501072_0262382 3300049588 Bacteria 1375
682 Ga0501216_001545 3300049660 Bacteria 3126
683 Ga0501222_005200 3300049662 Bacteria 1759
684 Ga0501224_002012 3300049664 Bacteria 2753
685 Ga0501227_008086 3300049665 Bacteria 2257
686 Ga0501230_007848 3300049667 Bacteria 1596
687 Ga0501233_004321 3300049668 Bacteria 2598
688 Ga0501247_021134 3300049677 Unclassified 845
689 Ga0501259_039858 3300049688 Unclassified 920
690 Ga0501225_0005860 3300049705 Bacteria 3596
691 Ga0501079_0102460 3300049741 Bacteria 2220
692 Ga0501080_0455741 3300049742 Bacteria 1146
693 Ga0501241_058431 3300049758 Unclassified 771
694 Ga0501262_012911 3300049759 Unclassified 1072
695 Ga0501263_018338 3300049760 Unclassified 925
696 Ga0501265_006752 3300049762 Unclassified 1340
697 Ga0501267_011336 3300049764 Unclassified 908
698 Ga0501268_000435 3300049765 Unclassified 4502
699 Ga0501274_001505 3300049771 Unclassified 1783
700 Ga0501283_008032 3300049779 Unclassified 1514
701 Ga0501035_0117257 3300049822 Bacteria 2330
702 Ga0501044_0319605 3300049823 Bacteria 1477
703 nmdc:mga05p37_25234_c1 3300050507 Bacteria 7227
704 nmdc:mga05p37_54826_c1 3300050507 Bacteria 4904
705 nmdc:mga09592_153824_c1 3300050508 Bacteria 1985
706 nmdc:mga09592_67409_c1 3300050508 Bacteria 3035
707 nmdc:mga09592_85372_c1 3300050508 Bacteria 2693
708 nmdc:mga0qj67_12558_c1 3300050509 Bacteria 6385
709 nmdc:mga0qj67_22271_c1 3300050509 Bacteria 4867
710 nmdc:mga0qj67_24652_c1 3300050509 Bacteria 4640
711 nmdc:mga0qj67_3124_c1 3300050509 Bacteria 11922
712 nmdc:mga0qj67_660391_c1 3300050509 Bacteria 834
713 nmdc:mga06r32_227621_c1 3300050510 Bacteria 1853
714 nmdc:mga08y16_187930_c1 3300050511 Bacteria 2143
715 nmdc:mga08y16_684435_c1 3300050511 Bacteria 1027
716 nmdc:mga0n895_1276438_c1 3300050512 Bacteria 706
717 nmdc:mga0n895_137841_c1 3300050512 Bacteria 2467
718 nmdc:mga0n895_23636_c1 3300050512 Bacteria 5780
719 nmdc:mga0n895_543648_c1 3300050512 Bacteria 1168
720 nmdc:mga0rr50_195857_c1 3300050513 Bacteria 1658
721 nmdc:mga0a205_23189_c1 3300050515 Bacteria 5886
722 nmdc:mga0a205_8950_c1 3300050515 Bacteria 9125
723 Ga0495601_0019485 3300053077 Unclassified 4138
724 Ga0495601_0053274 3300053077 Bacteria 2557
725 Ga0495595_0009670 3300053084 Bacteria 3993
726 Ga0495619_0012227 3300053085 Bacteria 5399
727 Ga0590071_007993 3300059421 Bacteria 2499
728 Ga0307408_100033611
729 Ga0070658_10009375
730 Ga0070658_10024932
731 Ga0070658_10027393
732 Ga0070658_10182518
733 Ga0070658_10324107
734 Ga0070658_10491032
735 Ga0070658_10523325
736 Ga0070676_10006960
737 Ga0070676_10008782
738 Ga0070683_100010082
739 Ga0070683_100011059
740 Ga0070683_100030201
741 Ga0070683_100109254
742 Ga0070683_100136967
743 Ga0070683_100161555
744 Ga0070683_100338800
745 Ga0070690_100011725
746 Ga0070690_100023823
747 Ga0070690_100032100
748 Ga0070690_100597610
749 Ga0070670_100013576
750 Ga0070670_100043780
751 Ga0070670_100181230
752 Ga0070670_100301584
753 Ga0070670_100356481
754 Ga0070677_10113983
755 Ga0068869_100117301
756 Ga0068869_100134047
757 Ga0070666_10346238
758 Ga0070680_100001244
759 Ga0070680_100002160
760 Ga0070680_100002198
761 Ga0070680_100174837
762 Ga0070682_100005851
763 Ga0070682_100310411
764 Ga0068868_100016583
765 Ga0068868_100047252
766 Ga0068868_100243141
767 Ga0070660_100003351
768 Ga0070660_100065649
769 Ga0070660_100090234
770 Ga0070660_100206764
771 Ga0070689_100007804
772 Ga0070689_100070411
773 Ga0070689_100185709
774 Ga0070689_100609524
775 Ga0070691_10012993
776 Ga0070687_100111500
777 Ga0070687_100122473
778 Ga0070661_100004963
779 Ga0070661_100010690
780 Ga0070661_100016018
781 Ga0070661_100069025
782 Ga0070661_100073256
783 Ga0070661_100144489
784 Ga0070661_100204206
785 Ga0070661_100648266
786 Ga0070692_10011075
787 Ga0070692_10203246
788 Ga0070668_100002904
789 Ga0070668_100023889
790 Ga0070668_100354511
791 Ga0070668_100539670
792 Ga0070669_100002843
793 Ga0070669_100019178
794 Ga0070669_100124496
795 Ga0070669_100243624
796 Ga0070675_100001661
797 Ga0070675_100002764
798 Ga0070675_100009557
799 Ga0070675_100072507
800 Ga0070675_100239311
801 Ga0070675_100503325
802 Ga0070671_100037881
803 Ga0070671_100058742
804 Ga0070671_100152662
805 Ga0070671_100228099
806 Ga0070674_100090244
807 Ga0070674_100137619
808 Ga0070673_100010604
809 Ga0070673_100055682
810 Ga0070673_100057014
811 Ga0070673_100102908
812 Ga0070673_100695027
813 Ga0070688_100001537
814 Ga0070688_100049707
815 Ga0070659_100001454
816 Ga0070659_100006033
817 Ga0070659_100009318
818 Ga0070659_100035063
819 Ga0070659_100055800
820 Ga0070659_100414124
821 Ga0070659_100700064
822 Ga0070667_100014476
823 Ga0070667_100080602
824 Ga0070667_100093424
825 Ga0070709_10215310
826 Ga0070714_100245202
827 Ga0070714_100448280
828 Ga0070713_100000365
829 Ga0070701_10002895
830 Ga0070701_10110614
831 Ga0070701_10144819
832 Ga0070701_10205490
833 Ga0070711_100517190
834 Ga0070700_100134889
835 Ga0070694_100214158
836 Ga0070708_100000024
837 Ga0070663_100021824
838 Ga0070663_100038762
839 Ga0070678_100051909
840 Ga0070678_100079734
841 Ga0070678_100279301
842 Ga0070678_100690576
843 Ga0070662_100004241
844 Ga0070662_100033053
845 Ga0070662_100183559
846 Ga0070681_10001192
847 Ga0070681_10011247
848 Ga0070681_10011256
849 Ga0070681_10212364
850 Ga0070681_10480078
851 Ga0068867_100049245
852 Ga0068867_100088847
853 Ga0068867_100217493
854 Ga0068867_100729737
855 Ga0070685_10016196
856 Ga0070685_10069124
857 Ga0070685_10078668
858 Ga0070698_100026323
859 Ga0070698_100051749
860 Ga0070698_100118685
861 Ga0070679_100001382
862 Ga0070679_100003354
863 Ga0070679_100010941
864 Ga0070679_100099094
865 Ga0070679_100254159
866 Ga0070679_100324996
867 Ga0070679_100369295
868 Ga0070684_100005054
869 Ga0070684_100005381
870 Ga0070684_100022465
871 Ga0070684_100075181
872 Ga0070684_100076346
873 Ga0070684_100077151
874 Ga0070684_100087472
875 Ga0070684_100213758
876 Ga0070684_100382742
877 Ga0070684_100777903
878 Ga0068853_100110232
879 Ga0068853_100139595
880 Ga0068853_100485652
881 Ga0070672_100004646
882 Ga0070672_100246959
883 Ga0070672_100264407
884 Ga0070672_100538736
885 Ga0070672_100713102
886 Ga0070672_100836348
887 Ga0070686_100145078
888 Ga0070686_100284214
889 Ga0070686_100394122
890 Ga0070695_100001852
891 Ga0070693_100005385
892 Ga0070665_100024001
893 Ga0070665_100092682
894 Ga0070665_100211977
895 Ga0068855_100044173
896 Ga0068855_100096498
897 Ga0068855_100200134
898 Ga0068855_100335230
899 Ga0070664_100010557
900 Ga0070664_100028779
901 Ga0070664_100036381
902 Ga0070664_100043630
903 Ga0070664_100054904
904 Ga0070664_100074122
905 Ga0070664_100091040
906 Ga0070664_100096278
907 Ga0070664_100224049
908 Ga0070664_100231638
909 Ga0070664_100481959
910 Ga0070664_100777018
911 Ga0068857_100007641
912 Ga0068857_100009475
913 Ga0068857_100014570
914 Ga0068857_100106433
915 Ga0068854_100561243
916 Ga0068856_100002006
917 Ga0068856_100105890
918 Ga0068856_100226294
919 Ga0070702_100000558
920 Ga0068852_100026491
921 Ga0068852_100035480
922 Ga0068852_100039076
923 Ga0068852_100097864
924 Ga0068852_100583512
925 Ga0068859_100005085
926 Ga0068859_100010154
927 Ga0068859_100043357
928 Ga0068859_100076174
929 Ga0068859_100241752
930 Ga0068864_100008399
931 Ga0068864_100030068
932 Ga0068864_100058006
933 Ga0068861_100018071
934 Ga0068870_10002264
935 Ga0068870_10004708
936 Ga0068870_10034257
937 Ga0068870_10081092
938 Ga0068863_100007732
939 Ga0068863_100083253
940 Ga0068863_100597987
941 Ga0068858_100027910
942 Ga0068858_100105041
943 Ga0068858_100288183
944 Ga0068860_100008276
945 Ga0068860_100077426
946 Ga0068862_100000563
947 Ga0068862_100016777
948 Ga0070717_10005342
949 Ga0070716_100071232
950 Ga0070712_100022496
951 Ga0097621_100508450
952 Ga0068871_100004583
953 Ga0075428_100116530
954 Ga0075428_100173298
955 Ga0075428_100391251
956 Ga0075428_100414249
957 Ga0075430_100002009
958 Ga0075430_100087255
959 Ga0075430_100103903
960 Ga0075430_100156810
961 Ga0075430_100268091
962 Ga0075431_100191633
963 Ga0075431_100201027
964 Ga0075433_10040297
965 Ga0075433_10047006
966 Ga0075433_10431314
967 Ga0075434_100010409
968 Ga0075434_100055851
969 Ga0075434_100142159
970 Ga0075434_100243546
971 Ga0075434_100331924
972 Ga0075429_100025615
973 Ga0075429_100042420
974 Ga0068865_100026342
975 Ga0068865_100042531
976 Ga0097620_100005085
977 Ga0097620_100010154
978 Ga0097620_100043355
979 Ga0097620_100076171
980 Ga0097620_100241755
981 Ga0075435_100875011
982 Ga0111539_10016990
983 Ga0111539_10118385
984 Ga0111539_10648123
985 Ga0111539_10944336
986 Ga0105245_10004657
987 Ga0105245_10043029
988 Ga0114129_10018210
989 Ga0114129_10041097
990 Ga0114129_10587774
991 Ga0114129_10659840
992 Ga0114129_11058786
993 Ga0105243_10168684
994 Ga0105243_10236912
995 Ga0105242_10038001
996 Ga0105242_10066442
997 Ga0105248_10003619
998 Ga0105248_10019488
999 Ga0105248_10057361
1000 Ga0105248_10071679
1001 Ga0105248_10365258
1002 Ga0105238_10029562
1003 Ga0105238_10442639
1004 Ga0105249_10000662
1005 Ga0105249_10005645
1006 Ga0105239_10116400
1007 Ga0105239_10172106
1008 Ga0105246_10003077
1009 Ga0157373_10010157
1010 Ga0157373_10070737
1011 Ga0157371_10025629
1012 Ga0157371_10033766
1013 Ga0157371_10412856
1014 Ga0157369_10034675
1015 Ga0157369_10084620
1016 Ga0157369_10415161
1017 Ga0157369_10944208
1018 Ga0157378_10339310
1019 Ga0163162_10021469
1020 Ga0163162_10124202
1021 Ga0163162_10424286
1022 Ga0157372_10003051
1023 Ga0157372_10012575
1024 Ga0157372_10033314
1025 Ga0157372_10040174
1026 Ga0157372_10051110
1027 Ga0157372_10077526
1028 Ga0157372_10103620
1029 Ga0157372_10109041
1030 Ga0157372_10207953
1031 Ga0157372_10292365
1032 Ga0157372_10893144
1033 Ga0157375_10036954
1034 Ga0157375_10070807
1035 Ga0157375_10082574
1036 Ga0157375_10114734
1037 Ga0157375_10332655
1038 Ga0157375_10582468
1039 Ga0163163_10022697
1040 Ga0163163_10038847
1041 Ga0163163_10106330
1042 Ga0163163_10876016
1043 Ga0157380_10001269
1044 Ga0157380_10178020
1045 Ga0157377_10003414
1046 Ga0157377_10009008
1047 Ga0157379_10009985
1048 Ga0157376_10012034
1049 Ga0163161_10024987
1050 Ga0163161_10410076
1051 Ga0206354_10507204
1052 Ga0206353_10412376
1053 Ga0213876_10049470
1054 Ga0207656_10038320
1055 Ga0207682_10009484
1056 Ga0207688_10046677
1057 Ga0207688_10150665
1058 Ga0207647_10040350
1059 Ga0207645_10005607
1060 Ga0207645_10006068
1061 Ga0207643_10010330
1062 Ga0207643_10052872
1063 Ga0207643_10205515
1064 Ga0207705_10015020
1065 Ga0207705_10017160
1066 Ga0207705_10131702
1067 Ga0207705_10329830
1068 Ga0207705_10388726
1069 Ga0207705_10535453
1070 Ga0207707_10003275
1071 Ga0207707_10004812
1072 Ga0207707_10032034
1073 Ga0207707_10221052
1074 Ga0207707_10447979
1075 Ga0207693_10010340
1076 Ga0207660_10003814
1077 Ga0207660_10183836
1078 Ga0207662_10001456
1079 Ga0207662_10010512
1080 Ga0207662_10024675
1081 Ga0207657_10003620
1082 Ga0207657_10019361
1083 Ga0207657_10069469
1084 Ga0207657_10186237
1085 Ga0207657_10291890
1086 Ga0207649_10001109
1087 Ga0207649_10004268
1088 Ga0207649_10020418
1089 Ga0207649_10046813
1090 Ga0207649_10118463
1091 Ga0207649_10480732
1092 Ga0207652_10019280
1093 Ga0207652_10034855
1094 Ga0207652_10040876
1095 Ga0207652_10100849
1096 Ga0207652_10123676
1097 Ga0207652_10314308
1098 Ga0207681_10041868
1099 Ga0207681_10133825
1100 Ga0207681_10400999
1101 Ga0207694_10020485
1102 Ga0207650_10018343
1103 Ga0207650_10028340
1104 Ga0207650_10132643
1105 Ga0207650_10193435
1106 Ga0207650_10812675
1107 Ga0207659_10011043
1108 Ga0207659_10026481
1109 Ga0207659_10034004
1110 Ga0207659_10357868
1111 Ga0207687_10002121
1112 Ga0207687_10024522
1113 Ga0207687_10208163
1114 Ga0207700_10000601
1115 Ga0207700_10854324
1116 Ga0207664_10211242
1117 Ga0207664_10213081
1118 Ga0207644_10016146
1119 Ga0207644_10350771
1120 Ga0207644_10477930
1121 Ga0207690_10009752
1122 Ga0207690_10009969
1123 Ga0207690_10042710
1124 Ga0207690_10117491
1125 Ga0207690_10460309
1126 Ga0207690_10481595
1127 Ga0207706_10000155
1128 Ga0207706_10021799
1129 Ga0207706_10069928
1130 Ga0207706_10088595
1131 Ga0207706_10125358
1132 Ga0207706_10209860
1133 Ga0207706_10405810
1134 Ga0207686_10076228
1135 Ga0207686_10698572
1136 Ga0207670_10128309
1137 Ga0207670_10415550
1138 Ga0207669_10019424
1139 Ga0207691_10001667
1140 Ga0207691_10002873
1141 Ga0207691_10050140
1142 Ga0207691_10076157
1143 Ga0207691_10136856
1144 Ga0207691_10149704
1145 Ga0207691_10293469
1146 Ga0207691_10702572
1147 Ga0207711_10059799
1148 Ga0207711_10114664
1149 Ga0207711_10278792
1150 Ga0207711_10502334
1151 Ga0207711_10563085
1152 Ga0207689_10002528
1153 Ga0207689_10026628
1154 Ga0207689_10052931
1155 Ga0207661_10001218
1156 Ga0207661_10001484
1157 Ga0207661_10029599
1158 Ga0207661_10036765
1159 Ga0207661_10037049
1160 Ga0207661_10057765
1161 Ga0207661_10062308
1162 Ga0207661_10119346
1163 Ga0207661_10342635
1164 Ga0207661_10649540
1165 Ga0207679_10001557
1166 Ga0207679_10002457
1167 Ga0207679_10004253
1168 Ga0207679_10010095
1169 Ga0207679_10010457
1170 Ga0207679_10022702
1171 Ga0207679_10097178
1172 Ga0207679_10102806
1173 Ga0207679_10152676
1174 Ga0207679_10319700
1175 Ga0207667_10031049
1176 Ga0207667_10040067
1177 Ga0207667_10082511
1178 Ga0207667_10227051
1179 Ga0207667_10310832
1180 Ga0207651_10013685
1181 Ga0207651_10502175
1182 Ga0207651_10559963
1183 Ga0207668_10004444
1184 Ga0207668_10052146
1185 Ga0207668_10140751
1186 Ga0207668_10160022
1187 Ga0207668_10442764
1188 Ga0207640_10614043
1189 Ga0207658_10033104
1190 Ga0207658_10049030
1191 Ga0207658_10103736
1192 Ga0207658_10212893
1193 Ga0207677_10088465
1194 Ga0207677_10096358
1195 Ga0207677_10125413
1196 Ga0207677_10516794
1197 Ga0207703_10141361
1198 Ga0207639_10014233
1199 Ga0207639_10034713
1200 Ga0207639_10388438
1201 Ga0207639_11234126
1202 Ga0207708_10049485
1203 Ga0207708_10074349
1204 Ga0207708_10375422
1205 Ga0207702_10004386
1206 Ga0207702_10029775
1207 Ga0207702_10254850
1208 Ga0207702_10840611
1209 Ga0207641_10006591
1210 Ga0207648_10016415
1211 Ga0207648_10416299
1212 Ga0207676_10002872
1213 Ga0207676_10019772
1214 Ga0207676_10046437
1215 Ga0207676_10049150
1216 Ga0207676_10339697
1217 Ga0207676_10361887
1218 Ga0207674_10000809
1219 Ga0207674_10001550
1220 Ga0207674_10001551
1221 Ga0207674_10017983
1222 Ga0207674_10026402
1223 Ga0207674_10049063
1224 Ga0207674_10423776
1225 Ga0207675_100001026
1226 Ga0207683_10282952
1227 Ga0207698_10004902
1228 Ga0207698_10018642
1229 Ga0207698_10094725
1230 Ga0207698_10958641
1231 Ga0268266_10040493
1232 Ga0268265_10003561
1233 Ga0268265_10027238
1234 Ga0268265_10090110
1235 Ga0268264_10045094
1236 Ga0268264_10062479
1237 Ga0265332_10003146
1238 Ga0265332_10008139
1239 Ga0265320_10080759
1240 Ga0265340_10069845
1241 Ga0307408_100001643
1242 Ga0307408_100154213
1243 Ga0307408_100314334
1244 Ga0307408_100327023
1245 Ga0307408_100385725
1246 Ga0265314_10013156
1247 Ga0307405_10000555
1248 Ga0307405_10012954
1249 Ga0307405_10040514
1250 Ga0307405_10124473
1251 Ga0307405_10159212
1252 Ga0307413_10000588
1253 Ga0307413_10102036
1254 Ga0307413_10110610
1255 Ga0307413_10444567
1256 Ga0307410_10008576
1257 Ga0307410_10008824
1258 Ga0307410_10012850
1259 Ga0307410_10040121
1260 Ga0307410_10066404
1261 Ga0307410_10127060
1262 Ga0307410_10253097
1263 Ga0307406_10001667
1264 Ga0307406_10029885
1265 Ga0307406_10032347
1266 Ga0307406_10070275
1267 Ga0307406_10227780
1268 Ga0307407_10001245
1269 Ga0307407_10002737
1270 Ga0307407_10018611
1271 Ga0307407_10308658
1272 Ga0307407_10312758
1273 Ga0307407_10347141
1274 Ga0307407_10480218
1275 Ga0307412_10005921
1276 Ga0307412_10006175
1277 Ga0307412_10012952
1278 Ga0307412_10063227
1279 Ga0307412_10280565
1280 Ga0307409_100000084
1281 Ga0307409_100025800
1282 Ga0307409_100041503
1283 Ga0307409_100073955
1284 Ga0307409_100153384
1285 Ga0307409_100198873
1286 Ga0307409_100486876
1287 Ga0307416_100000582
1288 Ga0307416_100012115
1289 Ga0307416_100012575
1290 Ga0307416_100023653
1291 Ga0307416_100163195
1292 Ga0307416_100186886
1293 Ga0307416_100303938
1294 Ga0307416_100305367
1295 Ga0307416_100713564
1296 Ga0307414_10004995
1297 Ga0307414_10191649
1298 Ga0307414_10658814
1299 Ga0307411_10000070
1300 Ga0307411_10000266
1301 Ga0307411_10009129
1302 Ga0307411_10109692
1303 Ga0307411_10136019
1304 Ga0307411_10196455
1305 Ga0307411_10242531
1306 Ga0307411_10493083
1307 Ga0307411_10925341
1308 Ga0307415_100003789
1309 Ga0307415_100009913
1310 Ga0307415_100038216
1311 Ga0307415_100063514
1312 Ga0307415_100334401
1313 Ga0373958_0050250
1314 Ga0373934_0003588
1315 Ga0373923_0004376
1316 Ga0373953_0004240
1317 Ga0373955_0006301
1318 Ga0373924_0013898
1319 Ga0373931_0054905
1320 Ga0373931_0347576
1321 Ga0373933_0008609
1322 Ga0373933_0607181
1323 Ga0373937_0008633
1324 Ga0373937_0270657
1325 Ga0373925_0070236
1326 Ga0373925_0362511
1327 Ga0395900_0019850
1328 Ga0395900_0638617
1329 Ga0395905_0004652
1330 Ga0395905_0170920
1331 Ga0395905_0482610
1332 Ga0436365_0446906
1333 Ga0439450_041896
1334 Ga0450914_020997
1335 Ga0451577_0037993
1336 Ga0451576_0019886
1337 Ga0451576_0228736
1338 Ga0451576_1024610
1339 Ga0466967_0005004
1340 Ga0466967_0198456
1341 Ga0495592_0066816
1342 Ga0495629_0007405
1343 Ga0495629_0014112
1344 Ga0495629_0194816
1345 Ga0495629_0429921
1346 Ga0495651_0012210
1347 Ga0495653_0017133
1348 Ga0495639_0045059
1349 Ga0495594_0022374
1350 Ga0495594_0129434
1351 Ga0495608_0029791
1352 Ga0495618_0154995
1353 Ga0495628_0005937
1354 Ga0495630_0018256
1355 Ga0495652_0014836
1356 Ga0495665_0043250
1357 Ga0495587_0007410
1358 Ga0495645_0015144
1359 Ga0495667_0006744
1360 Ga0495635_0004505
1361 Ga0495657_0015202
1362 Ga0495623_0002993
1363 Ga0495658_0025265
1364 Ga0495613_0084897
1365 Ga0495600_0003030
1366 Ga0495600_0040340
1367 Ga0495604_0005420
1368 Ga0495636_0029351
1369 Ga0495674_0006248
1370 Ga0495672_0008501
1371 Ga0495680_0027329
1372 Ga0495675_0007997
1373 Ga0495684_0005933
1374 Ga0495602_0003786
1375 Ga0495602_0144918
1376 Ga0496104_0117006
1377 Ga0496107_0213165
1378 Ga0496108_0097146
1379 Ga0496108_0121436
1380 Ga0496108_0130917
1381 Ga0496108_0244120
1382 Ga0496108_0355287
1383 Ga0496108_0393912
1384 Ga0496109_0137832
1385 Ga0496109_0414518
1386 Ga0496112_0296579
1387 Ga0496112_0422361
1388 Ga0496113_0040616
1389 Ga0496113_0124975
1390 Ga0496113_0129270
1391 Ga0496113_0284428
1392 Ga0496114_0122736
1393 Ga0496115_0077378
1394 Ga0501292_032436
1395 Ga0501032_0477191
1396 Ga0501033_0271827
1397 Ga0501034_0397196
1398 Ga0501037_0179249
1399 Ga0501038_0069258
1400 Ga0501042_0090517
1401 Ga0501043_0140405
1402 Ga0501046_0191420
1403 Ga0501047_0007988
1404 Ga0501048_0337384
1405 Ga0501069_0280392
1406 Ga0501070_0123001
1407 Ga0501071_0643223
1408 Ga0501072_0262382
1409 Ga0501216_001545
1410 Ga0501222_005200
1411 Ga0501224_002012
1412 Ga0501227_008086
1413 Ga0501230_007848
1414 Ga0501233_004321
1415 Ga0501247_021134
1416 Ga0501259_039858
1417 Ga0501225_0005860
1418 Ga0501079_0102460
1419 Ga0501080_0455741
1420 Ga0501241_058431
1421 Ga0501262_012911
1422 Ga0501263_018338
1423 Ga0501265_006752
1424 Ga0501267_011336
1425 Ga0501268_000435
1426 Ga0501274_001505
1427 Ga0501283_008032
1428 Ga0501035_0117257
1429 Ga0501044_0319605
1430 nmdc:mga05p37_25234_c1
1431 nmdc:mga05p37_54826_c1
1432 nmdc:mga09592_153824_c1
1433 nmdc:mga09592_67409_c1
1434 nmdc:mga09592_85372_c1
1435 nmdc:mga0qj67_12558_c1
1436 nmdc:mga0qj67_22271_c1
1437 nmdc:mga0qj67_24652_c1
1438 nmdc:mga0qj67_3124_c1
1439 nmdc:mga0qj67_660391_c1
1440 nmdc:mga06r32_227621_c1
1441 nmdc:mga08y16_187930_c1
1442 nmdc:mga08y16_684435_c1
1443 nmdc:mga0n895_1276438_c1
1444 nmdc:mga0n895_137841_c1
1445 nmdc:mga0n895_23636_c1
1446 nmdc:mga0n895_543648_c1
1447 nmdc:mga0rr50_195857_c1
1448 nmdc:mga0a205_23189_c1
1449 nmdc:mga0a205_8950_c1
1450 Ga0495601_0019485
1451 Ga0495601_0053274
1452 Ga0495595_0009670
1453 Ga0495619_0012227
1454 Ga0590071_007993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03609

EII-Sor

PTS system sorbose-specific iic component

10

206

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k1h-assembly1.cif.gz_Y structure of membrane protein 0.7346 2 224
6k1h-assembly1.cif.gz_Y structure of membrane protein 0.7262 2 224
7xtg-assembly1.cif.gz_Y cryo-em structure of listeria monocytogenes man-pts complexed with pediocin pa-1 0.6761 3 224
8hfs-assembly1.cif.gz_C the structure of lcna, lcia, and the man-pts of lactococcus lactis 0.6709 3 224
8hfs-assembly1.cif.gz_C the structure of lcna, lcia, and the man-pts of lactococcus lactis 0.6608 3 224
ID Description Score Start End Superfamily
af_P42905_5_132_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8274 1 129 1.10.1760.20
af_P42905_5_132_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7984 1 129 1.10.1760.20
af_P42910_6_238_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6355 1 217 1.10.1760.20
af_P69801_5_237_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.626 1 218 1.10.1760.20
af_P42910_6_238_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6049 1 217 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7W1A5Z7-F1-model_v4 PTS sugar transporter subunit IIC 0.9157 2 225 GO:0005886
GO:0009401
AF-A0A7W1A5Z7-F1-model_v4 PTS sugar transporter subunit IIC 0.9079 2 225 GO:0005886
GO:0009401
AF-A0A257SIV9-F1-model_v4 Uncharacterized protein 0.9041 3 225 GO:0005886
GO:0009401
AF-A0A7W1IAI1-F1-model_v4 PTS sugar transporter subunit IIC 0.8956 2 225 GO:0005886
GO:0009401
AF-A0A257SIV9-F1-model_v4 Uncharacterized protein 0.8927 3 225 GO:0005886
GO:0009401

Map