F477723

General Info

Members Datasets Scaffolds Average Seq Length
727 356 1454 106

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_11004657|Ga0070676_110046571
Length 98
Sequence MKLRELAHSRTGDKGNTLNVSVICHDARHYEHLRQVLSADRVKADLAAFNFVLGQALGGGVTRSLALDAHGKSLSSALMDLDLPPPVADPGCAASFPE

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
346 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
347 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
348 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
349 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
350 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
351 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
352 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
353 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
354 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
355 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
356 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.14
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0.69
Rhizoplane 7.29
Rhizosphere 81.29
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_11004657 3300005328 Bacteria 626
2 JGI24739J22299_10000809 3300001989 Bacteria 11452
3 JGI24739J22299_10165863 3300001989 Bacteria 651
4 JGI24737J22298_10051138 3300001990 Bacteria 1255
5 JGI24735J21928_10027856 3300002067 Bacteria 1691
6 JGI24735J21928_10039776 3300002067 Bacteria 1374
7 JGI24738J21930_10002131 3300002075 Bacteria 5279
8 JGI25156J39149_1000210 3300002705 Bacteria 40560
9 Ga0006562J51391_1108973 3300003578 Bacteria 990
10 Ga0055533_1000159 3300003756 Bacteria 65219
11 Ga0055533_1001666 3300003756 Bacteria 5705
12 Ga0055532_1000014 3300003758 Bacteria 344702
13 Ga0055525_1002806 3300003759 Bacteria 1658
14 Ga0055527_1000013 3300003760 Bacteria 347416
15 Ga0055535_1000011 3300003761 Bacteria 347416
16 Ga0055542_1000018 3300003762 Bacteria 347416
17 Ga0055529_1000017 3300003763 Bacteria 347416
18 JGI25405J52794_10126149 3300003911 Bacteria 578
19 Ga0070658_10058310 3300005327 Bacteria 3142
20 Ga0070658_10137324 3300005327 Bacteria 2041
21 Ga0070676_10008713 3300005328 Bacteria 5474
22 Ga0070683_100070006 3300005329 Bacteria 3272
23 Ga0070683_100267971 3300005329 Bacteria 1624
24 Ga0070690_100591695 3300005330 Bacteria 841
25 Ga0070670_100016883 3300005331 Bacteria 6267
26 Ga0070670_100717051 3300005331 Bacteria 900
27 Ga0070677_10136258 3300005333 Bacteria 1127
28 Ga0070677_10621523 3300005333 Bacteria 600
29 Ga0068869_100096408 3300005334 Bacteria 2232
30 Ga0070666_10054765 3300005335 Bacteria 2691
31 Ga0070666_10110052 3300005335 Bacteria 1904
32 Ga0070680_100720436 3300005336 Bacteria 859
33 Ga0070682_100396922 3300005337 Bacteria 1042
34 Ga0070682_100525161 3300005337 Bacteria 922
35 Ga0068868_100024055 3300005338 Bacteria 4617
36 Ga0070660_100020129 3300005339 Bacteria 4899
37 Ga0070660_100077211 3300005339 Bacteria 2610
38 Ga0070660_100189683 3300005339 Bacteria 1665
39 Ga0070689_101891399 3300005340 Bacteria 545
40 Ga0070687_100101354 3300005343 Bacteria 1612
41 Ga0070661_100032158 3300005344 Bacteria 3796
42 Ga0070661_100244411 3300005344 Bacteria 1383
43 Ga0070668_100423899 3300005347 Bacteria 1140
44 Ga0070669_100145222 3300005353 Bacteria 1832
45 Ga0070675_100002601 3300005354 Bacteria 13543
46 Ga0070675_100006604 3300005354 Bacteria 8914
47 Ga0070671_100175690 3300005355 Bacteria 1812
48 Ga0070671_100225717 3300005355 Bacteria 1589
49 Ga0070671_102129420 3300005355 Bacteria 500
50 Ga0070673_100005182 3300005364 Bacteria 8324
51 Ga0070673_100144820 3300005364 Bacteria 2008
52 Ga0070659_100079426 3300005366 Bacteria 2619
53 Ga0070659_100096019 3300005366 Bacteria 2381
54 Ga0070667_100087953 3300005367 Bacteria 2667
55 Ga0070667_100135232 3300005367 Bacteria 2155
56 Ga0070667_100278268 3300005367 Bacteria 1502
57 Ga0070701_10382675 3300005438 Bacteria 887
58 Ga0070700_100570243 3300005441 Bacteria 882
59 Ga0070663_100036215 3300005455 Bacteria 3428
60 Ga0070663_100094309 3300005455 Bacteria 2222
61 Ga0070663_100523010 3300005455 Bacteria 988
62 Ga0070678_100004125 3300005456 Bacteria 8188
63 Ga0070678_100322608 3300005456 Bacteria 1319
64 Ga0070662_100033836 3300005457 Bacteria 3601
65 Ga0070662_100288331 3300005457 Bacteria 1330
66 Ga0070662_100864678 3300005457 Bacteria 770
67 Ga0070681_10003273 3300005458 Bacteria 15113
68 Ga0068867_100307482 3300005459 Bacteria 1309
69 Ga0070679_100019456 3300005530 Bacteria 6601
70 Ga0070684_100006427 3300005535 Bacteria 9094
71 Ga0070684_100612733 3300005535 Bacteria 1012
72 Ga0068853_100046385 3300005539 Bacteria 3726
73 Ga0068853_100312813 3300005539 Bacteria 1454
74 Ga0070672_100001573 3300005543 Bacteria 14128
75 Ga0070672_100011490 3300005543 Bacteria 6177
76 Ga0070672_100016863 3300005543 Bacteria 5239
77 Ga0070695_100290530 3300005545 Bacteria 1205
78 Ga0070693_100337270 3300005547 Bacteria 1028
79 Ga0068855_100063329 3300005563 Bacteria 4315
80 Ga0068855_101100116 3300005563 Bacteria 831
81 Ga0070664_100076618 3300005564 Bacteria 2874
82 Ga0068857_100438751 3300005577 Bacteria 1219
83 Ga0068854_100047210 3300005578 Bacteria 3068
84 Ga0068854_100215411 3300005578 Bacteria 1517
85 Ga0068856_100408754 3300005614 Bacteria 1377
86 Ga0068852_100002398 3300005616 Bacteria 12915
87 Ga0068852_100053125 3300005616 Bacteria 3486
88 Ga0068852_100081205 3300005616 Bacteria 2877
89 Ga0068852_100373991 3300005616 Bacteria 1396
90 Ga0068852_100465079 3300005616 Bacteria 1254
91 Ga0068864_100050563 3300005618 Bacteria 3578
92 Ga0068864_100160824 3300005618 Bacteria 2041
93 Ga0068861_100003571 3300005719 Bacteria 10350
94 Ga0068851_10014026 3300005834 Bacteria 3799
95 Ga0068851_10121024 3300005834 Bacteria 1406
96 Ga0068851_10524288 3300005834 Bacteria 713
97 Ga0068863_100206645 3300005841 Bacteria 1890
98 Ga0068858_100008449 3300005842 Bacteria 9898
99 Ga0068860_100234085 3300005843 Bacteria 1785
100 Ga0068862_101123878 3300005844 Bacteria 782
101 Ga0081455_10006696 3300005937 Bacteria 12314
102 Ga0081455_10044689 3300005937 Bacteria 3861
103 Ga0070717_10001267 3300006028 Bacteria 17258
104 Ga0070717_10413245 3300006028 Bacteria 1213
105 Ga0075365_10045261 3300006038 Bacteria 2886
106 Ga0075364_10163758 3300006051 Bacteria 1502
107 Ga0070712_100187875 3300006175 Bacteria 1614
108 Ga0075366_10631540 3300006195 Bacteria 664
109 Ga0097621_100059042 3300006237 Bacteria 3139
110 Ga0097621_100063152 3300006237 Bacteria 3043
111 Ga0097621_100172020 3300006237 Bacteria 1867
112 Ga0075370_10122926 3300006353 Bacteria 1512
113 Ga0068871_100002820 3300006358 Bacteria 11889
114 Ga0068871_100101144 3300006358 Bacteria 2416
115 Ga0068871_100334634 3300006358 Bacteria 1336
116 Ga0075428_100028400 3300006844 Bacteria 6188
117 Ga0068865_100498267 3300006881 Bacteria 1015
118 Ga0075435_101952708 3300007076 Bacteria 515
119 Ga0105251_10000085 3300009011 Bacteria 89249
120 Ga0105251_10172878 3300009011 Bacteria 973
121 Ga0105244_10580020 3300009036 Bacteria 515
122 Ga0105240_10340632 3300009093 Bacteria 1703
123 Ga0105240_10638317 3300009093 Bacteria 1169
124 Ga0105245_10200242 3300009098 Bacteria 1917
125 Ga0105247_10767782 3300009101 Bacteria 732
126 Ga0105241_11013116 3300009174 Bacteria 778
127 Ga0105241_11706311 3300009174 Bacteria 612
128 Ga0105248_10003406 3300009177 Bacteria 17662
129 Ga0105248_10007820 3300009177 Bacteria 11739
130 Ga0105248_10514929 3300009177 Bacteria 1349
131 Ga0105238_10034853 3300009551 Bacteria 5119
132 Ga0105238_10052121 3300009551 Bacteria 4114
133 Ga0105238_10250684 3300009551 Bacteria 1749
134 Ga0105239_10223044 3300010375 Bacteria 2114
135 Ga0105239_11454738 3300010375 Bacteria 791
136 Ga0105246_11962843 3300011119 Bacteria 564
137 Ga0157373_10378305 3300013100 Bacteria 1013
138 Ga0157371_10163025 3300013102 Bacteria 1592
139 Ga0157369_10001860 3300013105 Bacteria 25437
140 Ga0157369_10122851 3300013105 Bacteria 2754
141 Ga0157369_10147697 3300013105 Bacteria 2485
142 Ga0157369_10164939 3300013105 Bacteria 2337
143 Ga0157369_10513224 3300013105 Bacteria 1240
144 Ga0157374_10316524 3300013296 Bacteria 1546
145 Ga0157374_10378633 3300013296 Bacteria 1410
146 Ga0163162_10001045 3300013306 Bacteria 25754
147 Ga0163162_10259306 3300013306 Bacteria 1870
148 Ga0163162_10272763 3300013306 Bacteria 1823
149 Ga0163162_11248669 3300013306 Bacteria 844
150 Ga0157372_10011868 3300013307 Bacteria 9280
151 Ga0157372_10016369 3300013307 Bacteria 7954
152 Ga0157372_11423311 3300013307 Bacteria 799
153 Ga0157375_10014900 3300013308 Bacteria 6950
154 Ga0157375_10466024 3300013308 Bacteria 1429
155 Ga0157375_10586331 3300013308 Bacteria 1275
156 Ga0157375_11410164 3300013308 Bacteria 821
157 Ga0163163_10905339 3300014325 Bacteria 946
158 Ga0157380_10005014 3300014326 Bacteria 9231
159 Ga0157380_11524339 3300014326 Bacteria 722
160 Ga0182008_10155092 3300014497 Bacteria 1150
161 Ga0157377_10000667 3300014745 Bacteria 14251
162 Ga0157379_10019350 3300014968 Bacteria 6013
163 Ga0157379_10023126 3300014968 Bacteria 5511
164 Ga0157376_10005055 3300014969 Bacteria 9199
165 Ga0157376_10005738 3300014969 Bacteria 8694
166 Ga0182006_1222789 3300015261 Bacteria 621
167 Ga0183361_10004 3300016635 Bacteria 484183
168 Ga0163161_10140028 3300017792 Bacteria 1831
169 Ga0163161_10683907 3300017792 Bacteria 853
170 Ga0213872_10095493 3300021361 Bacteria 1328
171 Ga0209435_117001 3300025206 Bacteria 742
172 Ga0209674_100049 3300025226 Bacteria 346969
173 Ga0209674_100051 3300025226 Bacteria 338399
174 Ga0209672_100027 3300025228 Bacteria 344500
175 Ga0209147_100035 3300025229 Bacteria 344500
176 Ga0209563_100411 3300025230 Bacteria 15102
177 Ga0207427_102536 3300025231 Bacteria 4793
178 Ga0209258_100052 3300025242 Bacteria 344500
179 Ga0209646_1023647 3300025246 Bacteria 870
180 Ga0209677_115002 3300025253 Bacteria 1036
181 Ga0209148_1000064 3300025254 Bacteria 344500
182 Ga0209759_1000015 3300025256 Bacteria 388724
183 Ga0209759_1000041 3300025256 Bacteria 252893
184 Ga0209759_1000097 3300025256 Bacteria 157627
185 Ga0209233_1000073 3300025261 Bacteria 362383
186 Ga0209455_1000057 3300025272 Bacteria 344500
187 Ga0207697_10028537 3300025315 Bacteria 2282
188 Ga0207656_10021457 3300025321 Bacteria 2581
189 Ga0207656_10079305 3300025321 Bacteria 1473
190 Ga0207713_1000760 3300025735 Bacteria 29964
191 Ga0207682_10056127 3300025893 Bacteria 1639
192 Ga0207710_10270169 3300025900 Bacteria 854
193 Ga0207688_10088296 3300025901 Bacteria 1778
194 Ga0207688_10995744 3300025901 Bacteria 530
195 Ga0207680_10227521 3300025903 Bacteria 1281
196 Ga0207680_10953862 3300025903 Bacteria 615
197 Ga0207680_11312253 3300025903 Bacteria 514
198 Ga0207647_10009356 3300025904 Bacteria 6963
199 Ga0207647_10065619 3300025904 Bacteria 2203
200 Ga0207645_10838208 3300025907 Bacteria 625
201 Ga0207705_10083595 3300025909 Bacteria 2329
202 Ga0207654_11204077 3300025911 Bacteria 552
203 Ga0207707_10000419 3300025912 Bacteria 44410
204 Ga0207671_11219624 3300025914 Bacteria 588
205 Ga0207693_10294801 3300025915 Bacteria 1271
206 Ga0207660_10075546 3300025917 Bacteria 2462
207 Ga0207662_10174897 3300025918 Bacteria 1379
208 Ga0207657_10003562 3300025919 Bacteria 16610
209 Ga0207657_10032649 3300025919 Bacteria 4701
210 Ga0207649_10009622 3300025920 Bacteria 5291
211 Ga0207649_10099140 3300025920 Bacteria 1924
212 Ga0207649_10491044 3300025920 Bacteria 932
213 Ga0207652_10090468 3300025921 Bacteria 2689
214 Ga0207681_10232475 3300025923 Bacteria 1431
215 Ga0207694_10097130 3300025924 Bacteria 2330
216 Ga0207694_10100599 3300025924 Bacteria 2290
217 Ga0207650_10015893 3300025925 Bacteria 5251
218 Ga0207659_10001489 3300025926 Bacteria 13949
219 Ga0207659_10179717 3300025926 Bacteria 1675
220 Ga0207644_10166204 3300025931 Bacteria 1719
221 Ga0207644_10281119 3300025931 Bacteria 1336
222 Ga0207644_10316427 3300025931 Bacteria 1261
223 Ga0207690_10016568 3300025932 Bacteria 4487
224 Ga0207690_10281430 3300025932 Bacteria 1295
225 Ga0207706_10000892 3300025933 Bacteria 30643
226 Ga0207670_10648940 3300025936 Bacteria 870
227 Ga0207704_10553602 3300025938 Bacteria 935
228 Ga0207704_10690154 3300025938 Bacteria 844
229 Ga0207691_10007224 3300025940 Bacteria 10713
230 Ga0207691_10009267 3300025940 Bacteria 9444
231 Ga0207711_10104099 3300025941 Bacteria 2514
232 Ga0207711_10266648 3300025941 Bacteria 1575
233 Ga0207711_11038697 3300025941 Bacteria 759
234 Ga0207689_10000393 3300025942 Bacteria 41140
235 Ga0207661_10008899 3300025944 Bacteria 7188
236 Ga0207661_10715177 3300025944 Bacteria 921
237 Ga0207679_10156925 3300025945 Bacteria 1859
238 Ga0207679_10734564 3300025945 Bacteria 897
239 Ga0207667_10069682 3300025949 Bacteria 3660
240 Ga0207667_10462788 3300025949 Bacteria 1288
241 Ga0207667_10858517 3300025949 Bacteria 902
242 Ga0207651_10035126 3300025960 Bacteria 3255
243 Ga0207651_10088740 3300025960 Bacteria 2255
244 Ga0207668_10225589 3300025972 Bacteria 1507
245 Ga0207640_10208929 3300025981 Bacteria 1485
246 Ga0207658_10277828 3300025986 Bacteria 1434
247 Ga0207658_10442588 3300025986 Bacteria 1149
248 Ga0207658_10542920 3300025986 Bacteria 1039
249 Ga0207677_10009028 3300026023 Bacteria 5594
250 Ga0207703_10291849 3300026035 Bacteria 1484
251 Ga0207703_10354020 3300026035 Bacteria 1352
252 Ga0207639_10040898 3300026041 Bacteria 3464
253 Ga0207639_10287076 3300026041 Bacteria 1449
254 Ga0207639_10310745 3300026041 Bacteria 1396
255 Ga0207678_10015576 3300026067 Bacteria 6685
256 Ga0207678_10041159 3300026067 Bacteria 4006
257 Ga0207708_10620223 3300026075 Bacteria 918
258 Ga0207702_10072746 3300026078 Bacteria 2964
259 Ga0207702_10171031 3300026078 Bacteria 1992
260 Ga0207702_10344379 3300026078 Bacteria 1425
261 Ga0207641_10092317 3300026088 Bacteria 2651
262 Ga0207641_10125133 3300026088 Bacteria 2300
263 Ga0207648_10284811 3300026089 Bacteria 1478
264 Ga0207676_10030489 3300026095 Bacteria 4049
265 Ga0207676_10271277 3300026095 Bacteria 1536
266 Ga0207674_10025628 3300026116 Bacteria 6281
267 Ga0207675_100001783 3300026118 Bacteria 21521
268 Ga0207683_10008607 3300026121 Bacteria 8730
269 Ga0207683_10341664 3300026121 Bacteria 1373
270 Ga0207698_10262305 3300026142 Bacteria 1588
271 Ga0207698_10544810 3300026142 Bacteria 1136
272 Ga0207698_10611607 3300026142 Bacteria 1075
273 Ga0209371_1010796 3300027312 Bacteria 2771
274 Ga0268265_10219608 3300028380 Bacteria 1662
275 Ga0268265_12699132 3300028380 Bacteria 502
276 Ga0268264_10003826 3300028381 Bacteria 12902
277 Ga0268264_10607804 3300028381 Bacteria 1078
278 Ga0307517_10001025 3300028786 Bacteria 47474
279 Ga0268256_1015942 3300030500 Bacteria 2172
280 Ga0307512_10040740 3300030522 Bacteria 3872
281 Ga0307509_10003682 3300031507 Bacteria 22922
282 Ga0307509_10481171 3300031507 Bacteria 929
283 Ga0307408_100640184 3300031548 Bacteria 949
284 Ga0307508_10074715 3300031616 Bacteria 2966
285 Ga0307514_10234709 3300031649 Bacteria 1107
286 Ga0307405_10025394 3300031731 Bacteria 3401
287 Ga0307405_10032946 3300031731 Bacteria 3068
288 Ga0307413_10028858 3300031824 Bacteria 3097
289 Ga0307410_10080530 3300031852 Bacteria 2285
290 Ga0307410_10247646 3300031852 Bacteria 1384
291 Ga0307406_10226178 3300031901 Bacteria 1394
292 Ga0307412_10000010 3300031911 Bacteria 421262
293 Ga0307412_10302249 3300031911 Bacteria 1265
294 Ga0307409_100012466 3300031995 Bacteria 5418
295 Ga0307416_100017439 3300032002 Bacteria 5026
296 Ga0307416_100147306 3300032002 Bacteria 2152
297 Ga0307411_10078132 3300032005 Bacteria 2268
298 Ga0307411_10445968 3300032005 Bacteria 1081
299 Ga0307415_100006789 3300032126 Bacteria 6209
300 Ga0307510_10519564 3300033180 Bacteria 634
301 Ga0373959_0093936 3300034820 Bacteria 706
302 Ga0373928_0071922 3300035084 Bacteria 857
303 Ga0373949_0191417 3300035090 Bacteria 610
304 Ga0373939_0043049 3300035114 Bacteria 1368
305 Ga0373953_0481494 3300035117 Bacteria 549
306 Ga0373960_0055563 3300035121 Bacteria 1187
307 Ga0373946_0063288 3300035171 Bacteria 1580
308 Ga0373955_0300988 3300035172 Bacteria 967
309 Ga0373924_0077742 3300035410 Bacteria 1408
310 Ga0373931_0000504 3300035691 Bacteria 15954
311 Ga0373931_0007340 3300035691 Bacteria 5187
312 Ga0373947_0103533 3300035725 Bacteria 1792
313 Ga0373937_0134607 3300036401 Bacteria 2310
314 Ga0373925_0695748 3300037068 Bacteria 838
315 Ga0395899_0354178 3300037312 Bacteria 981
316 Ga0395900_0004580 3300037418 Bacteria 14589
317 Ga0395900_1370635 3300037418 Bacteria 620
318 Ga0395900_1929750 3300037418 Bacteria 501
319 Ga0395898_0000346 3300037466 Bacteria 104661
320 Ga0395898_0016726 3300037466 Bacteria 7496
321 Ga0395898_0763670 3300037466 Bacteria 908
322 Ga0395905_0000029 3300037471 Bacteria 293016
323 Ga0395905_0348600 3300037471 Bacteria 1372
324 Ga0395901_0000121 3300038443 Bacteria 100690
325 Ga0395901_0006662 3300038443 Bacteria 11673
326 Ga0436361_0561918 3300039447 Bacteria 4312
327 Ga0436363_1669135 3300039450 Bacteria 639
328 Ga0466969_0605391 3300044656 Unclassified 503
329 Ga0466966_0000951 3300044684 Bacteria 18538
330 Ga0466961_0278232 3300044693 Bacteria 1024
331 Ga0466963_0001997 3300044694 Bacteria 11201
332 Ga0466971_0044120 3300044719 Bacteria 2002
333 Ga0466970_0414041 3300044765 Bacteria 770
334 Ga0466957_0028563 3300044842 Bacteria 3322
335 Ga0466959_0192515 3300045049 Bacteria 1423
336 Ga0451576_0055690 3300045051 Bacteria 4136
337 Ga0451576_0230127 3300045051 Bacteria 1936
338 Ga0466958_0015976 3300045836 Bacteria 4315
339 Ga0466958_0540467 3300045836 Bacteria 757
340 Ga0466967_0360942 3300045976 Bacteria 1408
341 Ga0466967_0456084 3300045976 Bacteria 1250
342 Ga0466967_1562955 3300045976 Bacteria 657
343 Ga0495592_0033901 3300046454 Bacteria 3850
344 Ga0495592_0035132 3300046454 Bacteria 3777
345 Ga0495592_0280879 3300046454 Bacteria 1089
346 Ga0495592_0384318 3300046454 Bacteria 892
347 Ga0495603_0014369 3300046455 Bacteria 4788
348 Ga0495590_0002594 3300046457 Bacteria 7470
349 Ga0495590_0054388 3300046457 Bacteria 1398
350 Ga0495590_0346993 3300046457 Bacteria 564
351 Ga0495591_002266 3300046458 Bacteria 10936
352 Ga0495629_0000033 3300046459 Bacteria 120105
353 Ga0495629_0000142 3300046459 Bacteria 63219
354 Ga0495629_0000785 3300046459 Bacteria 25615
355 Ga0495629_0012785 3300046459 Bacteria 6074
356 Ga0495629_0013373 3300046459 Bacteria 5922
357 Ga0495629_0086583 3300046459 Bacteria 2185
358 Ga0495638_0004402 3300046460 Bacteria 10661
359 Ga0495638_0122328 3300046460 Bacteria 1536
360 Ga0495638_0154637 3300046460 Bacteria 1328
361 Ga0495641_0054008 3300046461 Bacteria 1826
362 Ga0495641_0088310 3300046461 Bacteria 1387
363 Ga0495651_0037932 3300046462 Bacteria 3752
364 Ga0495651_0269771 3300046462 Bacteria 1154
365 Ga0495651_0445490 3300046462 Bacteria 838
366 Ga0495653_0000124 3300046463 Bacteria 65049
367 Ga0495653_0003525 3300046463 Bacteria 12606
368 Ga0495653_0054003 3300046463 Bacteria 3071
369 Ga0495653_0233969 3300046463 Bacteria 1228
370 Ga0495653_0285827 3300046463 Bacteria 1080
371 Ga0495650_0002578 3300046471 Bacteria 14291
372 Ga0495650_0005022 3300046471 Bacteria 8787
373 Ga0495650_0011630 3300046471 Bacteria 4802
374 Ga0495650_0011914 3300046471 Bacteria 4714
375 Ga0495650_0040226 3300046471 Bacteria 2010
376 Ga0495580_0076248 3300046472 Bacteria 2339
377 Ga0495580_0112370 3300046472 Bacteria 1892
378 Ga0495580_0534890 3300046472 Bacteria 779
379 Ga0495582_0006750 3300046473 Bacteria 6383
380 Ga0495582_0019403 3300046473 Bacteria 3717
381 Ga0495582_0021328 3300046473 Bacteria 3546
382 Ga0495582_0282775 3300046473 Bacteria 953
383 Ga0495582_0301209 3300046473 Bacteria 921
384 Ga0495582_0397593 3300046473 Bacteria 795
385 Ga0495605_0009213 3300046474 Bacteria 5547
386 Ga0495605_0021689 3300046474 Bacteria 3399
387 Ga0495605_0220066 3300046474 Bacteria 821
388 Ga0495639_0187451 3300046475 Bacteria 1009
389 Ga0495662_0030289 3300046476 Bacteria 2612
390 Ga0495662_0223205 3300046476 Bacteria 929
391 Ga0495664_0031371 3300046477 Bacteria 3115
392 Ga0495664_0111389 3300046477 Bacteria 1652
393 Ga0495664_0221422 3300046477 Bacteria 1145
394 Ga0495664_0894062 3300046477 Bacteria 519
395 Ga0495584_0055628 3300046491 Bacteria 1991
396 Ga0495585_0154630 3300046492 Bacteria 1194
397 Ga0495585_0208282 3300046492 Bacteria 992
398 Ga0495596_0017064 3300046500 Bacteria 3011
399 Ga0495596_0044403 3300046500 Bacteria 1749
400 Ga0495596_0074695 3300046500 Bacteria 1316
401 Ga0495596_0076237 3300046500 Bacteria 1302
402 Ga0495596_0096569 3300046500 Bacteria 1147
403 Ga0495596_0294764 3300046500 Bacteria 631
404 Ga0495607_0225407 3300046501 Bacteria 914
405 Ga0495583_0086261 3300046506 Bacteria 1358
406 Ga0495606_0045036 3300046507 Bacteria 2928
407 Ga0495606_0045451 3300046507 Bacteria 2910
408 Ga0495606_0089931 3300046507 Bacteria 1890
409 Ga0495606_0119331 3300046507 Bacteria 1580
410 Ga0495606_0197620 3300046507 Bacteria 1148
411 Ga0495606_0316057 3300046507 Bacteria 841
412 Ga0495608_0001177 3300046511 Bacteria 18551
413 Ga0495608_0016902 3300046511 Bacteria 5049
414 Ga0495608_0588975 3300046511 Bacteria 668
415 Ga0495610_0018095 3300046512 Bacteria 3991
416 Ga0495618_0002775 3300046514 Bacteria 11132
417 Ga0495618_0671182 3300046514 Bacteria 611
418 Ga0495620_0059179 3300046515 Bacteria 1602
419 Ga0495628_0003048 3300046516 Bacteria 15013
420 Ga0495628_0007136 3300046516 Bacteria 9676
421 Ga0495628_0031261 3300046516 Bacteria 4306
422 Ga0495628_0034815 3300046516 Bacteria 4049
423 Ga0495628_0056486 3300046516 Bacteria 3089
424 Ga0495628_0090205 3300046516 Bacteria 2373
425 Ga0495628_0195914 3300046516 Bacteria 1524
426 Ga0495628_0318515 3300046516 Bacteria 1148
427 Ga0495628_0432629 3300046516 Bacteria 957
428 Ga0495630_0009128 3300046517 Bacteria 7132
429 Ga0495630_0010772 3300046517 Bacteria 6602
430 Ga0495630_0023814 3300046517 Bacteria 4526
431 Ga0495630_0034770 3300046517 Bacteria 3764
432 Ga0495630_0050595 3300046517 Bacteria 3109
433 Ga0495630_0317693 3300046517 Bacteria 1190
434 Ga0495630_0690018 3300046517 Bacteria 781
435 Ga0495631_0313650 3300046518 Bacteria 667
436 Ga0495632_0137373 3300046519 Bacteria 1135
437 Ga0495632_0273820 3300046519 Bacteria 753
438 Ga0495643_0099048 3300046522 Bacteria 1496
439 Ga0495643_0135978 3300046522 Bacteria 1230
440 Ga0495644_0035226 3300046523 Bacteria 1890
441 Ga0495644_0067529 3300046523 Bacteria 1343
442 Ga0495648_0029106 3300046524 Bacteria 3670
443 Ga0495648_0055185 3300046524 Bacteria 2396
444 Ga0495648_0165979 3300046524 Bacteria 1136
445 Ga0495648_0265452 3300046524 Bacteria 821
446 Ga0495648_0334647 3300046524 Bacteria 697
447 Ga0495666_0003381 3300046526 Bacteria 8047
448 Ga0495666_0010389 3300046526 Bacteria 4640
449 Ga0495666_0025653 3300046526 Bacteria 2910
450 Ga0495666_0129547 3300046526 Bacteria 1179
451 Ga0495642_0007962 3300046528 Bacteria 4055
452 Ga0495642_0016343 3300046528 Bacteria 2892
453 Ga0495652_0005293 3300046529 Bacteria 12165
454 Ga0495652_0009483 3300046529 Bacteria 8842
455 Ga0495652_0053780 3300046529 Bacteria 3431
456 Ga0495652_0083277 3300046529 Bacteria 2633
457 Ga0495652_0140556 3300046529 Bacteria 1899
458 Ga0495652_0218011 3300046529 Bacteria 1436
459 Ga0495654_0177750 3300046530 Bacteria 923
460 Ga0495665_0000058 3300046531 Bacteria 44835
461 Ga0495665_0007803 3300046531 Bacteria 5791
462 Ga0495665_0029398 3300046531 Bacteria 2944
463 Ga0495665_0212862 3300046531 Bacteria 1000
464 Ga0495640_0005999 3300046533 Bacteria 9633
465 Ga0495640_0013649 3300046533 Bacteria 6174
466 Ga0495640_0241049 3300046533 Bacteria 1135
467 Ga0495586_0025388 3300046535 Bacteria 3171
468 Ga0495586_0357520 3300046535 Bacteria 839
469 Ga0495587_0014954 3300046536 Bacteria 4854
470 Ga0495609_0177533 3300046538 Bacteria 897
471 Ga0495597_0124915 3300046542 Bacteria 1070
472 Ga0495597_0151605 3300046542 Bacteria 951
473 Ga0495597_0331484 3300046542 Bacteria 586
474 Ga0495645_0022793 3300046543 Bacteria 4531
475 Ga0495645_0036827 3300046543 Bacteria 3566
476 Ga0495645_0085088 3300046543 Bacteria 2264
477 Ga0495645_0243424 3300046543 Bacteria 1199
478 Ga0495645_0426598 3300046543 Bacteria 840
479 Ga0495645_0733451 3300046543 Bacteria 597
480 Ga0495622_0000089 3300046557 Bacteria 81851
481 Ga0495667_0025113 3300046559 Bacteria 4017
482 Ga0495667_0323650 3300046559 Bacteria 975
483 Ga0495667_0884258 3300046559 Bacteria 548
484 Ga0495634_0010398 3300046642 Bacteria 6819
485 Ga0495634_0091718 3300046642 Bacteria 1971
486 Ga0495634_0722898 3300046642 Bacteria 571
487 Ga0495611_0032969 3300046648 Bacteria 2285
488 Ga0495611_0047546 3300046648 Bacteria 1926
489 Ga0495611_0385201 3300046648 Bacteria 641
490 Ga0495625_0133886 3300046660 Bacteria 1677
491 Ga0495625_0208155 3300046660 Bacteria 1287
492 Ga0495635_0013821 3300046663 Bacteria 5646
493 Ga0495635_0016111 3300046663 Bacteria 5220
494 Ga0495635_0143055 3300046663 Bacteria 1628
495 Ga0495635_0713524 3300046663 Bacteria 649
496 Ga0495661_0010327 3300046665 Bacteria 6373
497 Ga0495661_0092602 3300046665 Bacteria 1717
498 Ga0495588_0309481 3300046674 Bacteria 831
499 Ga0495657_0193354 3300046675 Bacteria 1243
500 Ga0495599_0004469 3300046678 Bacteria 8285
501 Ga0495599_0015711 3300046678 Bacteria 4699
502 Ga0495599_0048480 3300046678 Bacteria 2663
503 Ga0495599_0110048 3300046678 Bacteria 1716
504 Ga0495599_0309466 3300046678 Bacteria 952
505 Ga0495623_0012896 3300046679 Bacteria 5414
506 Ga0495623_0019714 3300046679 Bacteria 4359
507 Ga0495623_0100042 3300046679 Bacteria 1767
508 Ga0495623_0103903 3300046679 Bacteria 1728
509 Ga0495623_0582472 3300046679 Bacteria 583
510 Ga0495646_0007705 3300046680 Bacteria 6842
511 Ga0495646_0013198 3300046680 Bacteria 5249
512 Ga0495646_0021423 3300046680 Bacteria 4082
513 Ga0495646_0033239 3300046680 Bacteria 3208
514 Ga0495646_0474487 3300046680 Bacteria 644
515 Ga0495647_0058950 3300046681 Bacteria 1510
516 Ga0495658_0103222 3300046683 Bacteria 1705
517 Ga0495658_0191993 3300046683 Bacteria 1270
518 Ga0495669_0009223 3300046684 Bacteria 4158
519 Ga0495669_0051378 3300046684 Bacteria 1850
520 Ga0495669_0054101 3300046684 Bacteria 1806
521 Ga0495669_0230107 3300046684 Bacteria 889
522 Ga0495669_0480762 3300046684 Bacteria 604
523 Ga0495613_0066559 3300046689 Bacteria 2631
524 Ga0495613_0135716 3300046689 Bacteria 1760
525 Ga0495613_0175339 3300046689 Bacteria 1520
526 Ga0495613_0505458 3300046689 Bacteria 813
527 Ga0495613_0952373 3300046689 Bacteria 553
528 Ga0495624_0002272 3300046690 Bacteria 14620
529 Ga0495624_0004795 3300046690 Bacteria 9831
530 Ga0495624_0007870 3300046690 Bacteria 7480
531 Ga0495624_0010158 3300046690 Bacteria 6491
532 Ga0495624_0018499 3300046690 Bacteria 4660
533 Ga0495624_0057478 3300046690 Bacteria 2445
534 Ga0495624_0269155 3300046690 Bacteria 1029
535 Ga0495670_0033657 3300046691 Bacteria 2550
536 Ga0495649_0005162 3300046694 Bacteria 8372
537 Ga0495649_0015586 3300046694 Bacteria 4323
538 Ga0495649_0030527 3300046694 Bacteria 2977
539 Ga0495649_0039960 3300046694 Bacteria 2571
540 Ga0495649_0182849 3300046694 Bacteria 1093
541 Ga0495589_0003136 3300046794 Bacteria 9044
542 Ga0495589_0006139 3300046794 Bacteria 6345
543 Ga0495589_0052788 3300046794 Bacteria 2007
544 Ga0495589_0052899 3300046794 Bacteria 2005
545 Ga0495589_0067124 3300046794 Bacteria 1756
546 Ga0495589_0428318 3300046794 Bacteria 606
547 Ga0495600_0032980 3300046809 Bacteria 3361
548 Ga0495600_0047522 3300046809 Bacteria 2799
549 Ga0495600_0533435 3300046809 Bacteria 719
550 Ga0495660_0073244 3300046810 Bacteria 1812
551 Ga0495660_0123661 3300046810 Bacteria 1306
552 Ga0495581_0005365 3300047315 Bacteria 7418
553 Ga0495581_0111704 3300047315 Bacteria 1589
554 Ga0495604_0001865 3300047317 Bacteria 17163
555 Ga0495604_0053070 3300047317 Bacteria 3136
556 Ga0495604_0064435 3300047317 Bacteria 2792
557 Ga0495604_0235934 3300047317 Bacteria 1253
558 Ga0495604_0444688 3300047317 Bacteria 847
559 Ga0495636_0129122 3300047318 Bacteria 1123
560 Ga0495674_0004714 3300047319 Bacteria 13119
561 Ga0495674_0020784 3300047319 Bacteria 6077
562 Ga0495674_0022441 3300047319 Bacteria 5821
563 Ga0495674_0042364 3300047319 Bacteria 4061
564 Ga0495674_0079024 3300047319 Bacteria 2825
565 Ga0495674_0209161 3300047319 Bacteria 1616
566 Ga0495674_0231611 3300047319 Bacteria 1524
567 Ga0495672_0020170 3300047320 Bacteria 4376
568 Ga0495676_0022411 3300047321 Bacteria 5494
569 Ga0495676_0126300 3300047321 Bacteria 1853
570 Ga0495676_0159501 3300047321 Bacteria 1597
571 Ga0495676_0199829 3300047321 Bacteria 1389
572 Ga0495680_0010147 3300047322 Bacteria 8418
573 Ga0495680_0047067 3300047322 Bacteria 3396
574 Ga0495680_0089380 3300047322 Bacteria 2312
575 Ga0495680_0154807 3300047322 Bacteria 1668
576 Ga0495680_0183763 3300047322 Bacteria 1507
577 Ga0495683_0002906 3300047323 Bacteria 10134
578 Ga0495683_0004010 3300047323 Bacteria 8456
579 Ga0495683_0015384 3300047323 Bacteria 3982
580 Ga0495683_0070715 3300047323 Bacteria 1713
581 Ga0495683_0159020 3300047323 Bacteria 1046
582 Ga0495683_0248511 3300047323 Bacteria 781
583 Ga0495687_013884 3300047443 Bacteria 4174
584 Ga0495687_024063 3300047443 Bacteria 2901
585 Ga0495675_0005828 3300047444 Bacteria 7526
586 Ga0495675_0152823 3300047444 Bacteria 1425
587 Ga0495675_0188491 3300047444 Bacteria 1260
588 Ga0495675_0217915 3300047444 Bacteria 1156
589 Ga0495679_000030 3300047446 Bacteria 180083
590 Ga0495679_001289 3300047446 Bacteria 14659
591 Ga0495679_127410 3300047446 Bacteria 692
592 Ga0495673_0026543 3300047469 Bacteria 2768
593 Ga0495673_0079239 3300047469 Bacteria 1363
594 Ga0495684_0052300 3300047471 Bacteria 3117
595 Ga0495684_0128013 3300047471 Bacteria 1909
596 Ga0495684_0292077 3300047471 Bacteria 1173
597 Ga0495686_0043212 3300047472 Bacteria 2859
598 Ga0495686_0261502 3300047472 Bacteria 969
599 Ga0495593_0014557 3300047673 Bacteria 4470
600 Ga0495593_0023051 3300047673 Bacteria 3463
601 Ga0495593_0052319 3300047673 Bacteria 2158
602 Ga0495593_0081044 3300047673 Bacteria 1678
603 Ga0495593_0168711 3300047673 Bacteria 1103
604 Ga0495602_0015070 3300048088 Bacteria 7818
605 Ga0495602_0075991 3300048088 Bacteria 2848
606 Ga0495602_0117703 3300048088 Bacteria 2144
607 Ga0495602_0274980 3300048088 Bacteria 1243
608 Ga0495602_1077496 3300048088 Bacteria 527
609 Ga0495614_0003743 3300048089 Bacteria 6837
610 Ga0495614_0005304 3300048089 Bacteria 5813
611 Ga0495614_0038323 3300048089 Bacteria 2057
612 Ga0495626_0013500 3300048091 Bacteria 4243
613 Ga0495626_0013928 3300048091 Bacteria 4165
614 Ga0495626_0023827 3300048091 Bacteria 3008
615 Ga0495626_0095496 3300048091 Bacteria 1302
616 Ga0496100_0127082 3300048903 Bacteria 1790
617 Ga0496100_0255967 3300048903 Bacteria 1297
618 Ga0496100_0321041 3300048903 Bacteria 1163
619 Ga0496100_1018295 3300048903 Bacteria 652
620 Ga0496101_0070423 3300048904 Bacteria 2561
621 Ga0496101_0171187 3300048904 Bacteria 1669
622 Ga0496101_0799486 3300048904 Bacteria 744
623 Ga0496102_0045278 3300048905 Bacteria 3995
624 Ga0496102_0051417 3300048905 Bacteria 3754
625 Ga0496102_0112752 3300048905 Bacteria 2536
626 Ga0496102_0317847 3300048905 Bacteria 1467
627 Ga0496103_0006244 3300048906 Bacteria 7122
628 Ga0496103_0125031 3300048906 Bacteria 1640
629 Ga0496103_0311707 3300048906 Bacteria 1012
630 Ga0496104_0035365 3300048907 Bacteria 4664
631 Ga0496104_0112733 3300048907 Bacteria 2608
632 Ga0496104_0525259 3300048907 Bacteria 1095
633 Ga0496104_1426894 3300048907 Bacteria 595
634 Ga0496104_1819175 3300048907 Bacteria 511
635 Ga0496105_0021935 3300048908 Bacteria 5168
636 Ga0496105_0216260 3300048908 Bacteria 1561
637 Ga0496106_0002264 3300048909 Bacteria 14354
638 Ga0496106_0094634 3300048909 Bacteria 2310
639 Ga0496106_0244798 3300048909 Bacteria 1433
640 Ga0496106_1181831 3300048909 Bacteria 597
641 Ga0496107_0104100 3300048910 Bacteria 2082
642 Ga0496107_0182899 3300048910 Bacteria 1556
643 Ga0496107_0636902 3300048910 Bacteria 786
644 Ga0496107_1067165 3300048910 Bacteria 584
645 Ga0496108_0105743 3300048911 Bacteria 2403
646 Ga0496109_0112302 3300048912 Bacteria 2534
647 Ga0496109_0407500 3300048912 Bacteria 1284
648 Ga0496109_0649771 3300048912 Bacteria 992
649 Ga0496109_1494094 3300048912 Bacteria 611
650 Ga0496109_1869081 3300048912 Bacteria 533
651 Ga0496110_0006940 3300048913 Bacteria 9007
652 Ga0496110_0315337 3300048913 Bacteria 1424
653 Ga0496110_0422425 3300048913 Bacteria 1215
654 Ga0496110_0552018 3300048913 Bacteria 1047
655 Ga0496110_1809994 3300048913 Bacteria 521
656 Ga0496112_0255165 3300048915 Bacteria 1704
657 Ga0496112_1033981 3300048915 Bacteria 741
658 Ga0496113_0063150 3300048916 Bacteria 2799
659 Ga0496113_0335892 3300048916 Bacteria 1212
660 Ga0496113_1105170 3300048916 Bacteria 622
661 Ga0496113_1187070 3300048916 Bacteria 596
662 Ga0496114_0025330 3300048917 Bacteria 4849
663 Ga0496114_0039154 3300048917 Bacteria 3922
664 Ga0496114_0375664 3300048917 Bacteria 1258
665 Ga0496114_0449068 3300048917 Bacteria 1142
666 Ga0496115_0018868 3300048918 Bacteria 5303
667 Ga0496115_0068656 3300048918 Bacteria 2870
668 Ga0496115_0072394 3300048918 Bacteria 2797
669 Ga0496116_0228487 3300048919 Bacteria 946
670 Ga0496116_0474385 3300048919 Bacteria 528
671 Ga0496117_0008879 3300048920 Bacteria 9478
672 Ga0496117_0053417 3300048920 Bacteria 2839
673 Ga0496117_0121758 3300048920 Bacteria 1601
674 Ga0496118_0000400 3300048921 Bacteria 73227
675 Ga0496118_0002919 3300048921 Bacteria 22208
676 Ga0496118_0079090 3300048921 Bacteria 2322
677 Ga0496118_0490502 3300048921 Bacteria 613
678 Ga0496120_0103910 3300048923 Bacteria 1496
679 Ga0496120_0201269 3300048923 Bacteria 964
680 Ga0496121_0108679 3300048924 Bacteria 2121
681 Ga0496121_0744163 3300048924 Bacteria 584
682 Ga0496121_0801813 3300048924 Bacteria 553
683 Ga0496121_0873664 3300048924 Bacteria 520
684 Ga0496122_0539692 3300048925 Bacteria 558
685 Ga0496123_0276061 3300048926 Bacteria 815
686 Ga0496124_0225375 3300048927 Bacteria 1406
687 Ga0496125_0008569 3300048928 Bacteria 10679
688 Ga0496125_0125597 3300048928 Bacteria 1819
689 Ga0496125_0311427 3300048928 Bacteria 959
690 Ga0496126_0000724 3300048929 Bacteria 59840
691 Ga0496126_0052279 3300048929 Bacteria 3714
692 Ga0496126_0510272 3300048929 Bacteria 960
693 Ga0496126_1044784 3300048929 Bacteria 610
694 Ga0495678_029976 3300049459 Bacteria 2281
695 Ga0495678_202572 3300049459 Bacteria 611
696 Ga0495682_0018559 3300049460 Bacteria 2620
697 Ga0495682_0052757 3300049460 Bacteria 1477
698 Ga0495682_0293020 3300049460 Bacteria 574
699 nmdc:mga0yw44_24181_c1 3300050492 Bacteria 3434
700 nmdc:mga0k408_329895_c1 3300050493 Bacteria 910
701 nmdc:mga07m45_168851_c1 3300050496 Bacteria 1271
702 nmdc:mga0qj67_251475_c1 3300050509 Bacteria 1434
703 nmdc:mga06r32_402478_c1 3300050510 Bacteria 1351
704 nmdc:mga0rr50_1495588_c1 3300050513 Bacteria 571
705 Ga0495601_0116484 3300053077 Bacteria 1733
706 Ga0495612_0069385 3300053078 Bacteria 1468
707 Ga0495595_0010791 3300053084 Bacteria 3807
708 Ga0495619_0197615 3300053085 Bacteria 1392
709 Ga0500578_0095708 3300053086 Bacteria 1883
710 Ga0500646_0281225 3300053090 Bacteria 593
711 Ga0500618_008297 3300053125 Bacteria 2906
712 Ga0500616_0203691 3300053153 Bacteria 875
713 Ga0500645_005981 3300053730 Bacteria 4400
714 Ga0500587_023020 3300053739 Bacteria 821
715 Ga0466962_0062747 3300061719 Bacteria 1774
716 2746089065 2744054900 Bacteria 8399525
717 2746097197 2744054901 Bacteria 8397047
718 2842350317 2842348783 Bacteria 9002918
719 2842456911 2842454564 Bacteria 8730687
720 2900638794 2900634093 Bacteria 10263517
721 2904436485 2904434214 Bacteria 6230908
722 2904489355 2904483920 Bacteria 7545285
723 2919531725 2919527303 Bacteria 7718827
724 642598001 642555112 Bacteria 8676562
725 642615193 642555113 Bacteria 8214658
726 8055271889 8055266321 Bacteria 7999742
727 8055305290 8055301274 Bacteria 8587385
728 Ga0070676_11004657
729 JGI24739J22299_10000809
730 JGI24739J22299_10165863
731 JGI24737J22298_10051138
732 JGI24735J21928_10027856
733 JGI24735J21928_10039776
734 JGI24738J21930_10002131
735 JGI25156J39149_1000210
736 Ga0006562J51391_1108973
737 Ga0055533_1000159
738 Ga0055533_1001666
739 Ga0055532_1000014
740 Ga0055525_1002806
741 Ga0055527_1000013
742 Ga0055535_1000011
743 Ga0055542_1000018
744 Ga0055529_1000017
745 JGI25405J52794_10126149
746 Ga0070658_10058310
747 Ga0070658_10137324
748 Ga0070676_10008713
749 Ga0070683_100070006
750 Ga0070683_100267971
751 Ga0070690_100591695
752 Ga0070670_100016883
753 Ga0070670_100717051
754 Ga0070677_10136258
755 Ga0070677_10621523
756 Ga0068869_100096408
757 Ga0070666_10054765
758 Ga0070666_10110052
759 Ga0070680_100720436
760 Ga0070682_100396922
761 Ga0070682_100525161
762 Ga0068868_100024055
763 Ga0070660_100020129
764 Ga0070660_100077211
765 Ga0070660_100189683
766 Ga0070689_101891399
767 Ga0070687_100101354
768 Ga0070661_100032158
769 Ga0070661_100244411
770 Ga0070668_100423899
771 Ga0070669_100145222
772 Ga0070675_100002601
773 Ga0070675_100006604
774 Ga0070671_100175690
775 Ga0070671_100225717
776 Ga0070671_102129420
777 Ga0070673_100005182
778 Ga0070673_100144820
779 Ga0070659_100079426
780 Ga0070659_100096019
781 Ga0070667_100087953
782 Ga0070667_100135232
783 Ga0070667_100278268
784 Ga0070701_10382675
785 Ga0070700_100570243
786 Ga0070663_100036215
787 Ga0070663_100094309
788 Ga0070663_100523010
789 Ga0070678_100004125
790 Ga0070678_100322608
791 Ga0070662_100033836
792 Ga0070662_100288331
793 Ga0070662_100864678
794 Ga0070681_10003273
795 Ga0068867_100307482
796 Ga0070679_100019456
797 Ga0070684_100006427
798 Ga0070684_100612733
799 Ga0068853_100046385
800 Ga0068853_100312813
801 Ga0070672_100001573
802 Ga0070672_100011490
803 Ga0070672_100016863
804 Ga0070695_100290530
805 Ga0070693_100337270
806 Ga0068855_100063329
807 Ga0068855_101100116
808 Ga0070664_100076618
809 Ga0068857_100438751
810 Ga0068854_100047210
811 Ga0068854_100215411
812 Ga0068856_100408754
813 Ga0068852_100002398
814 Ga0068852_100053125
815 Ga0068852_100081205
816 Ga0068852_100373991
817 Ga0068852_100465079
818 Ga0068864_100050563
819 Ga0068864_100160824
820 Ga0068861_100003571
821 Ga0068851_10014026
822 Ga0068851_10121024
823 Ga0068851_10524288
824 Ga0068863_100206645
825 Ga0068858_100008449
826 Ga0068860_100234085
827 Ga0068862_101123878
828 Ga0081455_10006696
829 Ga0081455_10044689
830 Ga0070717_10001267
831 Ga0070717_10413245
832 Ga0075365_10045261
833 Ga0075364_10163758
834 Ga0070712_100187875
835 Ga0075366_10631540
836 Ga0097621_100059042
837 Ga0097621_100063152
838 Ga0097621_100172020
839 Ga0075370_10122926
840 Ga0068871_100002820
841 Ga0068871_100101144
842 Ga0068871_100334634
843 Ga0075428_100028400
844 Ga0068865_100498267
845 Ga0075435_101952708
846 Ga0105251_10000085
847 Ga0105251_10172878
848 Ga0105244_10580020
849 Ga0105240_10340632
850 Ga0105240_10638317
851 Ga0105245_10200242
852 Ga0105247_10767782
853 Ga0105241_11013116
854 Ga0105241_11706311
855 Ga0105248_10003406
856 Ga0105248_10007820
857 Ga0105248_10514929
858 Ga0105238_10034853
859 Ga0105238_10052121
860 Ga0105238_10250684
861 Ga0105239_10223044
862 Ga0105239_11454738
863 Ga0105246_11962843
864 Ga0157373_10378305
865 Ga0157371_10163025
866 Ga0157369_10001860
867 Ga0157369_10122851
868 Ga0157369_10147697
869 Ga0157369_10164939
870 Ga0157369_10513224
871 Ga0157374_10316524
872 Ga0157374_10378633
873 Ga0163162_10001045
874 Ga0163162_10259306
875 Ga0163162_10272763
876 Ga0163162_11248669
877 Ga0157372_10011868
878 Ga0157372_10016369
879 Ga0157372_11423311
880 Ga0157375_10014900
881 Ga0157375_10466024
882 Ga0157375_10586331
883 Ga0157375_11410164
884 Ga0163163_10905339
885 Ga0157380_10005014
886 Ga0157380_11524339
887 Ga0182008_10155092
888 Ga0157377_10000667
889 Ga0157379_10019350
890 Ga0157379_10023126
891 Ga0157376_10005055
892 Ga0157376_10005738
893 Ga0182006_1222789
894 Ga0183361_10004
895 Ga0163161_10140028
896 Ga0163161_10683907
897 Ga0213872_10095493
898 Ga0209435_117001
899 Ga0209674_100049
900 Ga0209674_100051
901 Ga0209672_100027
902 Ga0209147_100035
903 Ga0209563_100411
904 Ga0207427_102536
905 Ga0209258_100052
906 Ga0209646_1023647
907 Ga0209677_115002
908 Ga0209148_1000064
909 Ga0209759_1000015
910 Ga0209759_1000041
911 Ga0209759_1000097
912 Ga0209233_1000073
913 Ga0209455_1000057
914 Ga0207697_10028537
915 Ga0207656_10021457
916 Ga0207656_10079305
917 Ga0207713_1000760
918 Ga0207682_10056127
919 Ga0207710_10270169
920 Ga0207688_10088296
921 Ga0207688_10995744
922 Ga0207680_10227521
923 Ga0207680_10953862
924 Ga0207680_11312253
925 Ga0207647_10009356
926 Ga0207647_10065619
927 Ga0207645_10838208
928 Ga0207705_10083595
929 Ga0207654_11204077
930 Ga0207707_10000419
931 Ga0207671_11219624
932 Ga0207693_10294801
933 Ga0207660_10075546
934 Ga0207662_10174897
935 Ga0207657_10003562
936 Ga0207657_10032649
937 Ga0207649_10009622
938 Ga0207649_10099140
939 Ga0207649_10491044
940 Ga0207652_10090468
941 Ga0207681_10232475
942 Ga0207694_10097130
943 Ga0207694_10100599
944 Ga0207650_10015893
945 Ga0207659_10001489
946 Ga0207659_10179717
947 Ga0207644_10166204
948 Ga0207644_10281119
949 Ga0207644_10316427
950 Ga0207690_10016568
951 Ga0207690_10281430
952 Ga0207706_10000892
953 Ga0207670_10648940
954 Ga0207704_10553602
955 Ga0207704_10690154
956 Ga0207691_10007224
957 Ga0207691_10009267
958 Ga0207711_10104099
959 Ga0207711_10266648
960 Ga0207711_11038697
961 Ga0207689_10000393
962 Ga0207661_10008899
963 Ga0207661_10715177
964 Ga0207679_10156925
965 Ga0207679_10734564
966 Ga0207667_10069682
967 Ga0207667_10462788
968 Ga0207667_10858517
969 Ga0207651_10035126
970 Ga0207651_10088740
971 Ga0207668_10225589
972 Ga0207640_10208929
973 Ga0207658_10277828
974 Ga0207658_10442588
975 Ga0207658_10542920
976 Ga0207677_10009028
977 Ga0207703_10291849
978 Ga0207703_10354020
979 Ga0207639_10040898
980 Ga0207639_10287076
981 Ga0207639_10310745
982 Ga0207678_10015576
983 Ga0207678_10041159
984 Ga0207708_10620223
985 Ga0207702_10072746
986 Ga0207702_10171031
987 Ga0207702_10344379
988 Ga0207641_10092317
989 Ga0207641_10125133
990 Ga0207648_10284811
991 Ga0207676_10030489
992 Ga0207676_10271277
993 Ga0207674_10025628
994 Ga0207675_100001783
995 Ga0207683_10008607
996 Ga0207683_10341664
997 Ga0207698_10262305
998 Ga0207698_10544810
999 Ga0207698_10611607
1000 Ga0209371_1010796
1001 Ga0268265_10219608
1002 Ga0268265_12699132
1003 Ga0268264_10003826
1004 Ga0268264_10607804
1005 Ga0307517_10001025
1006 Ga0268256_1015942
1007 Ga0307512_10040740
1008 Ga0307509_10003682
1009 Ga0307509_10481171
1010 Ga0307408_100640184
1011 Ga0307508_10074715
1012 Ga0307514_10234709
1013 Ga0307405_10025394
1014 Ga0307405_10032946
1015 Ga0307413_10028858
1016 Ga0307410_10080530
1017 Ga0307410_10247646
1018 Ga0307406_10226178
1019 Ga0307412_10000010
1020 Ga0307412_10302249
1021 Ga0307409_100012466
1022 Ga0307416_100017439
1023 Ga0307416_100147306
1024 Ga0307411_10078132
1025 Ga0307411_10445968
1026 Ga0307415_100006789
1027 Ga0307510_10519564
1028 Ga0373959_0093936
1029 Ga0373928_0071922
1030 Ga0373949_0191417
1031 Ga0373939_0043049
1032 Ga0373953_0481494
1033 Ga0373960_0055563
1034 Ga0373946_0063288
1035 Ga0373955_0300988
1036 Ga0373924_0077742
1037 Ga0373931_0000504
1038 Ga0373931_0007340
1039 Ga0373947_0103533
1040 Ga0373937_0134607
1041 Ga0373925_0695748
1042 Ga0395899_0354178
1043 Ga0395900_0004580
1044 Ga0395900_1370635
1045 Ga0395900_1929750
1046 Ga0395898_0000346
1047 Ga0395898_0016726
1048 Ga0395898_0763670
1049 Ga0395905_0000029
1050 Ga0395905_0348600
1051 Ga0395901_0000121
1052 Ga0395901_0006662
1053 Ga0436361_0561918
1054 Ga0436363_1669135
1055 Ga0466969_0605391
1056 Ga0466966_0000951
1057 Ga0466961_0278232
1058 Ga0466963_0001997
1059 Ga0466971_0044120
1060 Ga0466970_0414041
1061 Ga0466957_0028563
1062 Ga0466959_0192515
1063 Ga0451576_0055690
1064 Ga0451576_0230127
1065 Ga0466958_0015976
1066 Ga0466958_0540467
1067 Ga0466967_0360942
1068 Ga0466967_0456084
1069 Ga0466967_1562955
1070 Ga0495592_0033901
1071 Ga0495592_0035132
1072 Ga0495592_0280879
1073 Ga0495592_0384318
1074 Ga0495603_0014369
1075 Ga0495590_0002594
1076 Ga0495590_0054388
1077 Ga0495590_0346993
1078 Ga0495591_002266
1079 Ga0495629_0000033
1080 Ga0495629_0000142
1081 Ga0495629_0000785
1082 Ga0495629_0012785
1083 Ga0495629_0013373
1084 Ga0495629_0086583
1085 Ga0495638_0004402
1086 Ga0495638_0122328
1087 Ga0495638_0154637
1088 Ga0495641_0054008
1089 Ga0495641_0088310
1090 Ga0495651_0037932
1091 Ga0495651_0269771
1092 Ga0495651_0445490
1093 Ga0495653_0000124
1094 Ga0495653_0003525
1095 Ga0495653_0054003
1096 Ga0495653_0233969
1097 Ga0495653_0285827
1098 Ga0495650_0002578
1099 Ga0495650_0005022
1100 Ga0495650_0011630
1101 Ga0495650_0011914
1102 Ga0495650_0040226
1103 Ga0495580_0076248
1104 Ga0495580_0112370
1105 Ga0495580_0534890
1106 Ga0495582_0006750
1107 Ga0495582_0019403
1108 Ga0495582_0021328
1109 Ga0495582_0282775
1110 Ga0495582_0301209
1111 Ga0495582_0397593
1112 Ga0495605_0009213
1113 Ga0495605_0021689
1114 Ga0495605_0220066
1115 Ga0495639_0187451
1116 Ga0495662_0030289
1117 Ga0495662_0223205
1118 Ga0495664_0031371
1119 Ga0495664_0111389
1120 Ga0495664_0221422
1121 Ga0495664_0894062
1122 Ga0495584_0055628
1123 Ga0495585_0154630
1124 Ga0495585_0208282
1125 Ga0495596_0017064
1126 Ga0495596_0044403
1127 Ga0495596_0074695
1128 Ga0495596_0076237
1129 Ga0495596_0096569
1130 Ga0495596_0294764
1131 Ga0495607_0225407
1132 Ga0495583_0086261
1133 Ga0495606_0045036
1134 Ga0495606_0045451
1135 Ga0495606_0089931
1136 Ga0495606_0119331
1137 Ga0495606_0197620
1138 Ga0495606_0316057
1139 Ga0495608_0001177
1140 Ga0495608_0016902
1141 Ga0495608_0588975
1142 Ga0495610_0018095
1143 Ga0495618_0002775
1144 Ga0495618_0671182
1145 Ga0495620_0059179
1146 Ga0495628_0003048
1147 Ga0495628_0007136
1148 Ga0495628_0031261
1149 Ga0495628_0034815
1150 Ga0495628_0056486
1151 Ga0495628_0090205
1152 Ga0495628_0195914
1153 Ga0495628_0318515
1154 Ga0495628_0432629
1155 Ga0495630_0009128
1156 Ga0495630_0010772
1157 Ga0495630_0023814
1158 Ga0495630_0034770
1159 Ga0495630_0050595
1160 Ga0495630_0317693
1161 Ga0495630_0690018
1162 Ga0495631_0313650
1163 Ga0495632_0137373
1164 Ga0495632_0273820
1165 Ga0495643_0099048
1166 Ga0495643_0135978
1167 Ga0495644_0035226
1168 Ga0495644_0067529
1169 Ga0495648_0029106
1170 Ga0495648_0055185
1171 Ga0495648_0165979
1172 Ga0495648_0265452
1173 Ga0495648_0334647
1174 Ga0495666_0003381
1175 Ga0495666_0010389
1176 Ga0495666_0025653
1177 Ga0495666_0129547
1178 Ga0495642_0007962
1179 Ga0495642_0016343
1180 Ga0495652_0005293
1181 Ga0495652_0009483
1182 Ga0495652_0053780
1183 Ga0495652_0083277
1184 Ga0495652_0140556
1185 Ga0495652_0218011
1186 Ga0495654_0177750
1187 Ga0495665_0000058
1188 Ga0495665_0007803
1189 Ga0495665_0029398
1190 Ga0495665_0212862
1191 Ga0495640_0005999
1192 Ga0495640_0013649
1193 Ga0495640_0241049
1194 Ga0495586_0025388
1195 Ga0495586_0357520
1196 Ga0495587_0014954
1197 Ga0495609_0177533
1198 Ga0495597_0124915
1199 Ga0495597_0151605
1200 Ga0495597_0331484
1201 Ga0495645_0022793
1202 Ga0495645_0036827
1203 Ga0495645_0085088
1204 Ga0495645_0243424
1205 Ga0495645_0426598
1206 Ga0495645_0733451
1207 Ga0495622_0000089
1208 Ga0495667_0025113
1209 Ga0495667_0323650
1210 Ga0495667_0884258
1211 Ga0495634_0010398
1212 Ga0495634_0091718
1213 Ga0495634_0722898
1214 Ga0495611_0032969
1215 Ga0495611_0047546
1216 Ga0495611_0385201
1217 Ga0495625_0133886
1218 Ga0495625_0208155
1219 Ga0495635_0013821
1220 Ga0495635_0016111
1221 Ga0495635_0143055
1222 Ga0495635_0713524
1223 Ga0495661_0010327
1224 Ga0495661_0092602
1225 Ga0495588_0309481
1226 Ga0495657_0193354
1227 Ga0495599_0004469
1228 Ga0495599_0015711
1229 Ga0495599_0048480
1230 Ga0495599_0110048
1231 Ga0495599_0309466
1232 Ga0495623_0012896
1233 Ga0495623_0019714
1234 Ga0495623_0100042
1235 Ga0495623_0103903
1236 Ga0495623_0582472
1237 Ga0495646_0007705
1238 Ga0495646_0013198
1239 Ga0495646_0021423
1240 Ga0495646_0033239
1241 Ga0495646_0474487
1242 Ga0495647_0058950
1243 Ga0495658_0103222
1244 Ga0495658_0191993
1245 Ga0495669_0009223
1246 Ga0495669_0051378
1247 Ga0495669_0054101
1248 Ga0495669_0230107
1249 Ga0495669_0480762
1250 Ga0495613_0066559
1251 Ga0495613_0135716
1252 Ga0495613_0175339
1253 Ga0495613_0505458
1254 Ga0495613_0952373
1255 Ga0495624_0002272
1256 Ga0495624_0004795
1257 Ga0495624_0007870
1258 Ga0495624_0010158
1259 Ga0495624_0018499
1260 Ga0495624_0057478
1261 Ga0495624_0269155
1262 Ga0495670_0033657
1263 Ga0495649_0005162
1264 Ga0495649_0015586
1265 Ga0495649_0030527
1266 Ga0495649_0039960
1267 Ga0495649_0182849
1268 Ga0495589_0003136
1269 Ga0495589_0006139
1270 Ga0495589_0052788
1271 Ga0495589_0052899
1272 Ga0495589_0067124
1273 Ga0495589_0428318
1274 Ga0495600_0032980
1275 Ga0495600_0047522
1276 Ga0495600_0533435
1277 Ga0495660_0073244
1278 Ga0495660_0123661
1279 Ga0495581_0005365
1280 Ga0495581_0111704
1281 Ga0495604_0001865
1282 Ga0495604_0053070
1283 Ga0495604_0064435
1284 Ga0495604_0235934
1285 Ga0495604_0444688
1286 Ga0495636_0129122
1287 Ga0495674_0004714
1288 Ga0495674_0020784
1289 Ga0495674_0022441
1290 Ga0495674_0042364
1291 Ga0495674_0079024
1292 Ga0495674_0209161
1293 Ga0495674_0231611
1294 Ga0495672_0020170
1295 Ga0495676_0022411
1296 Ga0495676_0126300
1297 Ga0495676_0159501
1298 Ga0495676_0199829
1299 Ga0495680_0010147
1300 Ga0495680_0047067
1301 Ga0495680_0089380
1302 Ga0495680_0154807
1303 Ga0495680_0183763
1304 Ga0495683_0002906
1305 Ga0495683_0004010
1306 Ga0495683_0015384
1307 Ga0495683_0070715
1308 Ga0495683_0159020
1309 Ga0495683_0248511
1310 Ga0495687_013884
1311 Ga0495687_024063
1312 Ga0495675_0005828
1313 Ga0495675_0152823
1314 Ga0495675_0188491
1315 Ga0495675_0217915
1316 Ga0495679_000030
1317 Ga0495679_001289
1318 Ga0495679_127410
1319 Ga0495673_0026543
1320 Ga0495673_0079239
1321 Ga0495684_0052300
1322 Ga0495684_0128013
1323 Ga0495684_0292077
1324 Ga0495686_0043212
1325 Ga0495686_0261502
1326 Ga0495593_0014557
1327 Ga0495593_0023051
1328 Ga0495593_0052319
1329 Ga0495593_0081044
1330 Ga0495593_0168711
1331 Ga0495602_0015070
1332 Ga0495602_0075991
1333 Ga0495602_0117703
1334 Ga0495602_0274980
1335 Ga0495602_1077496
1336 Ga0495614_0003743
1337 Ga0495614_0005304
1338 Ga0495614_0038323
1339 Ga0495626_0013500
1340 Ga0495626_0013928
1341 Ga0495626_0023827
1342 Ga0495626_0095496
1343 Ga0496100_0127082
1344 Ga0496100_0255967
1345 Ga0496100_0321041
1346 Ga0496100_1018295
1347 Ga0496101_0070423
1348 Ga0496101_0171187
1349 Ga0496101_0799486
1350 Ga0496102_0045278
1351 Ga0496102_0051417
1352 Ga0496102_0112752
1353 Ga0496102_0317847
1354 Ga0496103_0006244
1355 Ga0496103_0125031
1356 Ga0496103_0311707
1357 Ga0496104_0035365
1358 Ga0496104_0112733
1359 Ga0496104_0525259
1360 Ga0496104_1426894
1361 Ga0496104_1819175
1362 Ga0496105_0021935
1363 Ga0496105_0216260
1364 Ga0496106_0002264
1365 Ga0496106_0094634
1366 Ga0496106_0244798
1367 Ga0496106_1181831
1368 Ga0496107_0104100
1369 Ga0496107_0182899
1370 Ga0496107_0636902
1371 Ga0496107_1067165
1372 Ga0496108_0105743
1373 Ga0496109_0112302
1374 Ga0496109_0407500
1375 Ga0496109_0649771
1376 Ga0496109_1494094
1377 Ga0496109_1869081
1378 Ga0496110_0006940
1379 Ga0496110_0315337
1380 Ga0496110_0422425
1381 Ga0496110_0552018
1382 Ga0496110_1809994
1383 Ga0496112_0255165
1384 Ga0496112_1033981
1385 Ga0496113_0063150
1386 Ga0496113_0335892
1387 Ga0496113_1105170
1388 Ga0496113_1187070
1389 Ga0496114_0025330
1390 Ga0496114_0039154
1391 Ga0496114_0375664
1392 Ga0496114_0449068
1393 Ga0496115_0018868
1394 Ga0496115_0068656
1395 Ga0496115_0072394
1396 Ga0496116_0228487
1397 Ga0496116_0474385
1398 Ga0496117_0008879
1399 Ga0496117_0053417
1400 Ga0496117_0121758
1401 Ga0496118_0000400
1402 Ga0496118_0002919
1403 Ga0496118_0079090
1404 Ga0496118_0490502
1405 Ga0496120_0103910
1406 Ga0496120_0201269
1407 Ga0496121_0108679
1408 Ga0496121_0744163
1409 Ga0496121_0801813
1410 Ga0496121_0873664
1411 Ga0496122_0539692
1412 Ga0496123_0276061
1413 Ga0496124_0225375
1414 Ga0496125_0008569
1415 Ga0496125_0125597
1416 Ga0496125_0311427
1417 Ga0496126_0000724
1418 Ga0496126_0052279
1419 Ga0496126_0510272
1420 Ga0496126_1044784
1421 Ga0495678_029976
1422 Ga0495678_202572
1423 Ga0495682_0018559
1424 Ga0495682_0052757
1425 Ga0495682_0293020
1426 nmdc:mga0yw44_24181_c1
1427 nmdc:mga0k408_329895_c1
1428 nmdc:mga07m45_168851_c1
1429 nmdc:mga0qj67_251475_c1
1430 nmdc:mga06r32_402478_c1
1431 nmdc:mga0rr50_1495588_c1
1432 Ga0495601_0116484
1433 Ga0495612_0069385
1434 Ga0495595_0010791
1435 Ga0495619_0197615
1436 Ga0500578_0095708
1437 Ga0500646_0281225
1438 Ga0500618_008297
1439 Ga0500616_0203691
1440 Ga0500645_005981
1441 Ga0500587_023020
1442 Ga0466962_0062747
1443 2746089065
1444 2746097197
1445 2842350317
1446 2842456911
1447 2900638794
1448 2904436485
1449 2904489355
1450 2919531725
1451 642598001
1452 642615193
1453 8055271889
1454 8055305290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23544

1

48

0.95

PF23544

43

84

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pi3-assembly2.cif.gz_K pfcyrpa bound to fab fragments from monoclonal antibodies cy.003, cy.004 and cy.007 0.6889 50 71
8dtu-assembly1.cif.gz_A the complex of nanobody 5344n74d with bcl11a zf6. 0.6709 48 71
7xt7-assembly1.cif.gz_j rna polymerase ii elongation complex transcribing a nucleosome (ec49b) 0.6375 3 26
7xtd-assembly1.cif.gz_j rna polymerase ii elongation complex transcribing a nucleosome (ec58oct) 0.6374 3 26
7xsx-assembly1.cif.gz_j rna polymerase ii elongation complex transcribing a nucleosome (ec49) 0.6374 3 26
ID Description Score Start End Superfamily
af_P33896_330_429_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8785 6 28 2.60.40.10
3ttsA03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.813 7 27 2.60.40.1180
af_Q7ZW47_490_558_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7941 7 25 3.30.160.20
3wcyA04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7911 6 26 2.60.40.10
af_Q5RHK5_4_99_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7525 3 26 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A3D3RUI2-F1-model_v4 deleted 0.984 1 77
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.9753 1 69
AF-A0A2P6N171-F1-model_v4 DUF1446 domain-containing protein 0.9748 5 77
AF-A0A3D3RUI2-F1-model_v4 deleted 0.9716 1 77
AF-A0A5C6XVF3-F1-model_v4 deleted 0.9618 1 73

Map