F477477

General Info

Members Datasets Scaffolds Average Seq Length
723 295 1446 100

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100065381|Ga0070708_1000653813
Length 115
Sequence MADMSEETTTQDKEGGAPTAEQVTEALKVVVDPELGINIVDLGLVYDVAVEDEVVKITYTLTTMGCPVGPLIEQQMQQVLTTLPGISNVESEMVFTPPWSPERMSEEARLAMGMF

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 3.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.48
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100065381 3300005445 Bacteria 3261
2 Ga0070658_11212884 3300005327 Bacteria 656
3 Ga0070683_100226322 3300005329 Bacteria 1777
4 Ga0070690_100069365 3300005330 Bacteria 2288
5 Ga0070690_100166404 3300005330 Bacteria 1514
6 Ga0068869_100130555 3300005334 Bacteria 1931
7 Ga0070680_100038117 3300005336 Bacteria 3886
8 Ga0070680_101738745 3300005336 Bacteria 540
9 Ga0070680_101901709 3300005336 Bacteria 516
10 Ga0070682_100012408 3300005337 Bacteria 4887
11 Ga0068868_100061984 3300005338 Bacteria 2963
12 Ga0068868_100476343 3300005338 Bacteria 1090
13 Ga0070660_100007596 3300005339 Bacteria 7557
14 Ga0070660_100021467 3300005339 Bacteria 4763
15 Ga0070660_100135957 3300005339 Bacteria 1969
16 Ga0070660_100351431 3300005339 Bacteria 1214
17 Ga0070689_100075774 3300005340 Bacteria 2634
18 Ga0070661_100060787 3300005344 Bacteria 2772
19 Ga0070661_100112887 3300005344 Bacteria 2030
20 Ga0070692_10009738 3300005345 Bacteria 4347
21 Ga0070671_100879510 3300005355 Bacteria 782
22 Ga0070674_100182410 3300005356 Bacteria 1609
23 Ga0070674_100272683 3300005356 Bacteria 1338
24 Ga0070673_101009370 3300005364 Bacteria 775
25 Ga0070688_100051117 3300005365 Bacteria 2578
26 Ga0070659_100035598 3300005366 Bacteria 3877
27 Ga0070659_100158972 3300005366 Bacteria 1847
28 Ga0070659_100345434 3300005366 Bacteria 1247
29 Ga0070667_100055300 3300005367 Bacteria 3352
30 Ga0070667_100514446 3300005367 Bacteria 1098
31 Ga0070667_101237269 3300005367 Bacteria 699
32 Ga0070714_100265556 3300005435 Bacteria 1590
33 Ga0070714_100546286 3300005435 Unclassified 1109
34 Ga0070713_100200477 3300005436 Bacteria 1802
35 Ga0070701_10174934 3300005438 Bacteria 1253
36 Ga0070711_100042752 3300005439 Bacteria 3065
37 Ga0070711_101576723 3300005439 Unclassified 574
38 Ga0070705_100095823 3300005440 Bacteria 1861
39 Ga0070705_100121261 3300005440 Bacteria 1689
40 Ga0070705_100863960 3300005440 Bacteria 725
41 Ga0070700_100249364 3300005441 Bacteria 1273
42 Ga0070694_100055019 3300005444 Bacteria 2698
43 Ga0070708_100042687 3300005445 Bacteria 3983
44 Ga0070708_100094407 3300005445 Bacteria 2729
45 Ga0070708_101033397 3300005445 Bacteria 770
46 Ga0070663_100640697 3300005455 Bacteria 898
47 Ga0070663_100733596 3300005455 Unclassified 842
48 Ga0070678_100008202 3300005456 Bacteria 6245
49 Ga0070678_101938165 3300005456 Bacteria 557
50 Ga0070681_10001955 3300005458 Bacteria 18619
51 Ga0070681_10510298 3300005458 Bacteria 1116
52 Ga0068867_100080687 3300005459 Bacteria 2451
53 Ga0070685_10335328 3300005466 Bacteria 1029
54 Ga0070685_10380813 3300005466 Bacteria 972
55 Ga0070706_100004684 3300005467 Bacteria 13117
56 Ga0070706_100211206 3300005467 Bacteria 1812
57 Ga0070706_100686813 3300005467 Bacteria 950
58 Ga0070706_100732961 3300005467 Bacteria 916
59 Ga0070707_100004513 3300005468 Bacteria 13032
60 Ga0070707_100273104 3300005468 Bacteria 1643
61 Ga0070707_100457585 3300005468 Bacteria 1237
62 Ga0070707_100672696 3300005468 Unclassified 998
63 Ga0070698_100056452 3300005471 Bacteria 3979
64 Ga0070698_100753766 3300005471 Unclassified 917
65 Ga0070699_100181915 3300005518 Bacteria 1865
66 Ga0070699_100471394 3300005518 Bacteria 1139
67 Ga0070679_100057784 3300005530 Bacteria 3867
68 Ga0070679_100135234 3300005530 Bacteria 2446
69 Ga0070679_100171278 3300005530 Bacteria 2144
70 Ga0070679_100322341 3300005530 Bacteria 1494
71 Ga0070684_100030942 3300005535 Bacteria 4552
72 Ga0070684_100061807 3300005535 Bacteria 3279
73 Ga0070684_100101616 3300005535 Bacteria 2569
74 Ga0070684_100132648 3300005535 Bacteria 2248
75 Ga0070684_100902244 3300005535 Bacteria 828
76 Ga0070697_100438854 3300005536 Bacteria 1136
77 Ga0070697_100672856 3300005536 Bacteria 912
78 Ga0068853_100052906 3300005539 Bacteria 3497
79 Ga0068853_102170324 3300005539 Bacteria 538
80 Ga0070686_100053965 3300005544 Bacteria 2569
81 Ga0070695_100529849 3300005545 Bacteria 915
82 Ga0070696_100041484 3300005546 Bacteria 3180
83 Ga0070696_100096200 3300005546 Bacteria 2116
84 Ga0070696_101897979 3300005546 Bacteria 516
85 Ga0070693_100005617 3300005547 Bacteria 6047
86 Ga0070693_100206652 3300005547 Bacteria 1279
87 Ga0070665_100314565 3300005548 Bacteria 1570
88 Ga0070665_100804462 3300005548 Bacteria 953
89 Ga0070704_100488166 3300005549 Bacteria 1067
90 Ga0070704_100553092 3300005549 Bacteria 1006
91 Ga0068855_100023960 3300005563 Bacteria 7308
92 Ga0068855_100555096 3300005563 Bacteria 1243
93 Ga0068855_100637854 3300005563 Bacteria 1145
94 Ga0070664_100179626 3300005564 Bacteria 1880
95 Ga0070664_100441521 3300005564 Bacteria 1194
96 Ga0068857_100011172 3300005577 Bacteria 7809
97 Ga0068857_100327735 3300005577 Bacteria 1415
98 Ga0068857_100364879 3300005577 Bacteria 1339
99 Ga0068854_100200137 3300005578 Bacteria 1570
100 Ga0068854_100825568 3300005578 Bacteria 810
101 Ga0068854_100995211 3300005578 Unclassified 742
102 Ga0068854_101037664 3300005578 Bacteria 728
103 Ga0068856_100091442 3300005614 Bacteria 3027
104 Ga0068856_100216927 3300005614 Bacteria 1928
105 Ga0068856_101554709 3300005614 Unclassified 675
106 Ga0068856_102206004 3300005614 Unclassified 560
107 Ga0070702_100033934 3300005615 Bacteria 2810
108 Ga0070702_100060507 3300005615 Bacteria 2202
109 Ga0068852_100085601 3300005616 Bacteria 2808
110 Ga0068852_100186384 3300005616 Bacteria 1954
111 Ga0068852_100232811 3300005616 Bacteria 1757
112 Ga0068859_101418953 3300005617 Bacteria 766
113 Ga0068864_101298219 3300005618 Bacteria 728
114 Ga0068866_10088089 3300005718 Bacteria 1684
115 Ga0068866_10488061 3300005718 Bacteria 813
116 Ga0068870_10801653 3300005840 Bacteria 658
117 Ga0068858_100016243 3300005842 Bacteria 6993
118 Ga0068858_100031994 3300005842 Bacteria 4887
119 Ga0068858_102458821 3300005842 Unclassified 515
120 Ga0068860_100020071 3300005843 Bacteria 6474
121 Ga0070717_10285063 3300006028 Unclassified 1466
122 Ga0070715_10014322 3300006163 Bacteria 2935
123 Ga0070715_10256955 3300006163 Bacteria 916
124 Ga0070716_100572563 3300006173 Bacteria 845
125 Ga0070712_100037595 3300006175 Bacteria 3301
126 Ga0097621_100010903 3300006237 Bacteria 6672
127 Ga0097621_100130048 3300006237 Bacteria 2142
128 Ga0097621_102205234 3300006237 Unclassified 527
129 Ga0068871_100052258 3300006358 Bacteria 3309
130 Ga0068871_100127541 3300006358 Bacteria 2155
131 Ga0068871_101182205 3300006358 Unclassified 717
132 Ga0075433_10077960 3300006852 Bacteria 2919
133 Ga0075434_100052014 3300006871 Bacteria 4070
134 Ga0068865_100014192 3300006881 Bacteria 5057
135 Ga0068865_100234368 3300006881 Bacteria 1442
136 Ga0075436_100171437 3300006914 Bacteria 1532
137 Ga0075436_100861195 3300006914 Bacteria 677
138 Ga0097620_101418885 3300006931 Bacteria 766
139 Ga0075435_100194889 3300007076 Bacteria 1716
140 Ga0105240_11517974 3300009093 Bacteria 702
141 Ga0105240_11572672 3300009093 Bacteria 688
142 Ga0105240_12229884 3300009093 Bacteria 568
143 Ga0111539_10814118 3300009094 Bacteria 1087
144 Ga0105245_10015320 3300009098 Bacteria 6682
145 Ga0105245_10224157 3300009098 Bacteria 1815
146 Ga0105245_10349933 3300009098 Bacteria 1464
147 Ga0105245_10936573 3300009098 Bacteria 909
148 Ga0105247_10052990 3300009101 Bacteria 2501
149 Ga0105247_10304565 3300009101 Bacteria 1107
150 Ga0105243_10047355 3300009148 Bacteria 3384
151 Ga0105243_10267127 3300009148 Bacteria 1534
152 Ga0105243_10658793 3300009148 Bacteria 1015
153 Ga0105243_11227939 3300009148 Bacteria 764
154 Ga0105241_10060149 3300009174 Bacteria 2922
155 Ga0105241_10084415 3300009174 Bacteria 2493
156 Ga0105241_10833959 3300009174 Bacteria 851
157 Ga0105242_10132083 3300009176 Bacteria 2157
158 Ga0105242_10139756 3300009176 Bacteria 2100
159 Ga0105242_10531565 3300009176 Unclassified 1124
160 Ga0105242_11804535 3300009176 Unclassified 650
161 Ga0105248_10291615 3300009177 Bacteria 1837
162 Ga0105248_10392689 3300009177 Bacteria 1562
163 Ga0105237_10091107 3300009545 Bacteria 3038
164 Ga0105237_10202129 3300009545 Bacteria 1987
165 Ga0105237_10250546 3300009545 Bacteria 1773
166 Ga0105237_11083411 3300009545 Bacteria 808
167 Ga0105238_10031640 3300009551 Bacteria 5386
168 Ga0105238_10043373 3300009551 Bacteria 4551
169 Ga0105238_10082150 3300009551 Bacteria 3212
170 Ga0105238_10822677 3300009551 Bacteria 945
171 Ga0105249_10197315 3300009553 Bacteria 1968
172 Ga0105249_11694934 3300009553 Bacteria 705
173 Ga0105249_13550048 3300009553 Bacteria 502
174 Ga0105239_10021168 3300010375 Bacteria 7172
175 Ga0105239_10064989 3300010375 Bacteria 4006
176 Ga0105239_13164434 3300010375 Bacteria 536
177 Ga0105246_10095445 3300011119 Bacteria 2153
178 Ga0105246_11270223 3300011119 Unclassified 681
179 Ga0105246_12551739 3300011119 Bacteria 504
180 Ga0157337_1026718 3300012483 Bacteria 567
181 Ga0157373_10055667 3300013100 Bacteria 2809
182 Ga0157371_10131658 3300013102 Bacteria 1780
183 Ga0157370_10026787 3300013104 Bacteria 5687
184 Ga0157370_10132385 3300013104 Bacteria 2325
185 Ga0157370_10192255 3300013104 Bacteria 1894
186 Ga0157370_10273348 3300013104 Bacteria 1561
187 Ga0157369_10030091 3300013105 Bacteria 5991
188 Ga0157369_10040930 3300013105 Bacteria 5057
189 Ga0157369_10104213 3300013105 Bacteria 3021
190 Ga0157369_10408792 3300013105 Bacteria 1408
191 Ga0157374_10021270 3300013296 Bacteria 5769
192 Ga0157374_10028775 3300013296 Bacteria 5023
193 Ga0157374_10170871 3300013296 Bacteria 2120
194 Ga0157374_11557326 3300013296 Bacteria 685
195 Ga0157378_10028470 3300013297 Bacteria 4930
196 Ga0157378_10069193 3300013297 Bacteria 3166
197 Ga0157378_12674430 3300013297 Unclassified 551
198 Ga0157372_10006332 3300013307 Bacteria 12594
199 Ga0157372_10051234 3300013307 Bacteria 4594
200 Ga0157372_10083881 3300013307 Bacteria 3610
201 Ga0157372_10185482 3300013307 Bacteria 2409
202 Ga0157372_12829193 3300013307 Bacteria 556
203 Ga0157375_10541034 3300013308 Bacteria 1327
204 Ga0157375_11423138 3300013308 Bacteria 817
205 Ga0157375_11945663 3300013308 Bacteria 698
206 Ga0163163_10488975 3300014325 Bacteria 1292
207 Ga0163163_11318267 3300014325 Bacteria 784
208 Ga0157380_10426993 3300014326 Unclassified 1266
209 Ga0157380_12597902 3300014326 Bacteria 573
210 Ga0157380_12794223 3300014326 Bacteria 555
211 Ga0182008_10125663 3300014497 Bacteria 1277
212 Ga0182008_10548333 3300014497 Bacteria 642
213 Ga0157379_10133885 3300014968 Bacteria 2232
214 Ga0157376_10229361 3300014969 Bacteria 1724
215 Ga0157376_10322620 3300014969 Bacteria 1469
216 Ga0157376_10597358 3300014969 Unclassified 1098
217 Ga0157376_11149807 3300014969 Bacteria 803
218 Ga0157376_12100000 3300014969 Bacteria 603
219 Ga0182006_1122101 3300015261 Bacteria 904
220 Ga0182007_10098967 3300015262 Bacteria 964
221 Ga0163161_10201118 3300017792 Bacteria 1535
222 Ga0163161_10505719 3300017792 Bacteria 985
223 Ga0163161_11440430 3300017792 Bacteria 603
224 Ga0197907_10913843 3300020069 Bacteria 1073
225 Ga0197907_11110821 3300020069 Bacteria 529
226 Ga0206356_10103907 3300020070 Bacteria 975
227 Ga0206356_10503281 3300020070 Bacteria 565
228 Ga0206356_10596004 3300020070 Bacteria 2000
229 Ga0206356_11115077 3300020070 Bacteria 845
230 Ga0206356_11478649 3300020070 Bacteria 509
231 Ga0206355_1251211 3300020076 Bacteria 503
232 Ga0206355_1287509 3300020076 Bacteria 991
233 Ga0206350_10489792 3300020080 Bacteria 856
234 Ga0206354_10295194 3300020081 Bacteria 930
235 Ga0206354_10412236 3300020081 Bacteria 831
236 Ga0206354_10669380 3300020081 Bacteria 2394
237 Ga0206353_11387566 3300020082 Bacteria 4498
238 Ga0206353_11491132 3300020082 Bacteria 1633
239 Ga0206353_11727024 3300020082 Bacteria 886
240 Ga0154015_1029663 3300020610 Bacteria 617
241 Ga0154015_1459760 3300020610 Bacteria 530
242 Ga0213874_10071190 3300021377 Bacteria 1110
243 Ga0213876_10177042 3300021384 Bacteria 1135
244 Ga0224712_10006171 3300022467 Bacteria 3393
245 Ga0224712_10135788 3300022467 Bacteria 1078
246 Ga0224712_10175531 3300022467 Bacteria 963
247 Ga0207642_10519908 3300025899 Bacteria 731
248 Ga0207710_10164818 3300025900 Bacteria 1081
249 Ga0207710_10168932 3300025900 Bacteria 1069
250 Ga0207688_10056833 3300025901 Bacteria 2199
251 Ga0207680_10213416 3300025903 Unclassified 1320
252 Ga0207647_10291542 3300025904 Bacteria 930
253 Ga0207647_10531479 3300025904 Bacteria 654
254 Ga0207685_10011554 3300025905 Bacteria 2659
255 Ga0207685_10155657 3300025905 Bacteria 1039
256 Ga0207643_10356051 3300025908 Bacteria 919
257 Ga0207705_10051988 3300025909 Bacteria 2949
258 Ga0207684_10004965 3300025910 Bacteria 12408
259 Ga0207684_10264467 3300025910 Bacteria 1484
260 Ga0207684_10955404 3300025910 Bacteria 718
261 Ga0207654_10116834 3300025911 Bacteria 1669
262 Ga0207654_10171698 3300025911 Bacteria 1408
263 Ga0207654_10238293 3300025911 Bacteria 1215
264 Ga0207654_10383394 3300025911 Bacteria 974
265 Ga0207654_10662506 3300025911 Bacteria 748
266 Ga0207707_10006792 3300025912 Bacteria 9984
267 Ga0207707_10008124 3300025912 Bacteria 9112
268 Ga0207695_10811588 3300025913 Bacteria 816
269 Ga0207671_10282570 3300025914 Bacteria 1309
270 Ga0207671_10414442 3300025914 Bacteria 1072
271 Ga0207671_11368290 3300025914 Bacteria 550
272 Ga0207693_10071680 3300025915 Bacteria 2712
273 Ga0207663_10066038 3300025916 Bacteria 2314
274 Ga0207663_10386863 3300025916 Unclassified 1067
275 Ga0207660_10214069 3300025917 Bacteria 1510
276 Ga0207660_10381928 3300025917 Bacteria 1132
277 Ga0207657_10004765 3300025919 Bacteria 14310
278 Ga0207657_10016023 3300025919 Bacteria 7235
279 Ga0207657_10196543 3300025919 Bacteria 1625
280 Ga0207649_10021258 3300025920 Bacteria 3732
281 Ga0207649_10081017 3300025920 Bacteria 2101
282 Ga0207649_10218566 3300025920 Bacteria 1356
283 Ga0207652_10027233 3300025921 Bacteria 4762
284 Ga0207652_10100346 3300025921 Bacteria 2555
285 Ga0207652_10442742 3300025921 Bacteria 1171
286 Ga0207652_11156007 3300025921 Bacteria 675
287 Ga0207646_10042572 3300025922 Bacteria 4079
288 Ga0207646_10182184 3300025922 Bacteria 1897
289 Ga0207646_10347464 3300025922 Bacteria 1340
290 Ga0207646_10519811 3300025922 Unclassified 1072
291 Ga0207694_10022612 3300025924 Bacteria 4770
292 Ga0207694_10255449 3300025924 Bacteria 1435
293 Ga0207687_10033171 3300025927 Bacteria 3501
294 Ga0207687_10087942 3300025927 Bacteria 2259
295 Ga0207687_10238094 3300025927 Bacteria 1441
296 Ga0207687_10456349 3300025927 Bacteria 1061
297 Ga0207687_10620651 3300025927 Unclassified 913
298 Ga0207664_10510534 3300025929 Unclassified 1077
299 Ga0207644_10802325 3300025931 Bacteria 787
300 Ga0207690_10098751 3300025932 Bacteria 2080
301 Ga0207690_10113010 3300025932 Bacteria 1959
302 Ga0207690_10375101 3300025932 Bacteria 1129
303 Ga0207706_10266441 3300025933 Bacteria 1495
304 Ga0207686_10027445 3300025934 Bacteria 3335
305 Ga0207686_10047765 3300025934 Bacteria 2648
306 Ga0207686_11763859 3300025934 Unclassified 512
307 Ga0207709_10017610 3300025935 Bacteria 3989
308 Ga0207709_10167895 3300025935 Bacteria 1537
309 Ga0207709_10712520 3300025935 Bacteria 804
310 Ga0207709_10991680 3300025935 Bacteria 686
311 Ga0207669_10040730 3300025937 Bacteria 2698
312 Ga0207704_10202833 3300025938 Bacteria 1453
313 Ga0207704_10230971 3300025938 Bacteria 1376
314 Ga0207704_10331760 3300025938 Unclassified 1177
315 Ga0207665_10138286 3300025939 Bacteria 1734
316 Ga0207711_10142535 3300025941 Bacteria 2157
317 Ga0207661_10372072 3300025944 Bacteria 1292
318 Ga0207661_10966109 3300025944 Bacteria 785
319 Ga0207661_11537705 3300025944 Bacteria 609
320 Ga0207661_11693779 3300025944 Bacteria 577
321 Ga0207679_10234865 3300025945 Bacteria 1550
322 Ga0207667_10205237 3300025949 Bacteria 2021
323 Ga0207667_10310643 3300025949 Bacteria 1610
324 Ga0207667_10344476 3300025949 Bacteria 1520
325 Ga0207667_10962024 3300025949 Unclassified 843
326 Ga0207651_10781922 3300025960 Unclassified 845
327 Ga0207651_10988283 3300025960 Bacteria 752
328 Ga0207712_10926934 3300025961 Bacteria 771
329 Ga0207640_10038906 3300025981 Bacteria 3005
330 Ga0207640_10705480 3300025981 Bacteria 865
331 Ga0207640_11349502 3300025981 Bacteria 638
332 Ga0207640_11636438 3300025981 Bacteria 580
333 Ga0207658_10105364 3300025986 Bacteria 2218
334 Ga0207658_11822664 3300025986 Bacteria 555
335 Ga0207677_11279497 3300026023 Bacteria 673
336 Ga0207703_10264621 3300026035 Bacteria 1555
337 Ga0207703_10411685 3300026035 Bacteria 1256
338 Ga0207639_10159484 3300026041 Bacteria 1899
339 Ga0207639_11992275 3300026041 Bacteria 542
340 Ga0207639_12289086 3300026041 Bacteria 502
341 Ga0207678_10097724 3300026067 Bacteria 2509
342 Ga0207678_10261429 3300026067 Bacteria 1483
343 Ga0207678_10523298 3300026067 Bacteria 1035
344 Ga0207708_10004026 3300026075 Bacteria 10811
345 Ga0207708_10687931 3300026075 Bacteria 873
346 Ga0207702_10107003 3300026078 Bacteria 2479
347 Ga0207702_10279314 3300026078 Bacteria 1578
348 Ga0207702_10373709 3300026078 Bacteria 1369
349 Ga0207702_10763958 3300026078 Bacteria 954
350 Ga0207648_10129610 3300026089 Bacteria 2220
351 Ga0207648_11997922 3300026089 Bacteria 541
352 Ga0207676_11131269 3300026095 Bacteria 775
353 Ga0207674_10034277 3300026116 Bacteria 5310
354 Ga0207674_10446681 3300026116 Bacteria 1250
355 Ga0207683_10000876 3300026121 Bacteria 27583
356 Ga0207698_10036602 3300026142 Bacteria 3604
357 Ga0207698_10402650 3300026142 Bacteria 1308
358 Ga0207698_10656217 3300026142 Bacteria 1040
359 Ga0207698_11419273 3300026142 Bacteria 709
360 Ga0207698_11754108 3300026142 Bacteria 636
361 Ga0268266_10080384 3300028379 Bacteria 2840
362 Ga0268266_10223952 3300028379 Bacteria 1730
363 Ga0268264_10050649 3300028381 Bacteria 3458
364 Ga0265319_1028375 3300028563 Bacteria 1974
365 Ga0265319_1054231 3300028563 Bacteria 1315
366 Ga0265334_10285742 3300028573 Bacteria 566
367 Ga0265318_10173648 3300028577 Bacteria 789
368 Ga0265338_10327795 3300028800 Unclassified 1107
369 Ga0265338_10881946 3300028800 Bacteria 610
370 Ga0265320_10009779 3300031240 Bacteria 5755
371 Ga0265320_10016252 3300031240 Bacteria 4176
372 Ga0265327_10057127 3300031251 Bacteria 2008
373 Ga0307416_100415878 3300032002 Unclassified 1387
374 Ga0373944_0024448 3300035089 Bacteria 1771
375 Ga0373944_0126481 3300035089 Bacteria 885
376 Ga0373936_0016183 3300035113 Bacteria 2867
377 Ga0373945_0003861 3300035116 Bacteria 4734
378 Ga0373943_0008082 3300035170 Bacteria 4718
379 Ga0373943_0544967 3300035170 Bacteria 680
380 Ga0373943_0799242 3300035170 Bacteria 561
381 Ga0373946_0529395 3300035171 Bacteria 606
382 Ga0373931_0381312 3300035691 Unclassified 889
383 Ga0373935_0094404 3300035692 Bacteria 1963
384 Ga0373935_1281963 3300035692 Bacteria 547
385 Ga0373927_0223428 3300035695 Bacteria 1237
386 Ga0373947_0000590 3300035725 Bacteria 21313
387 Ga0373947_0326136 3300035725 Bacteria 1027
388 Ga0373925_0025998 3300037068 Bacteria 4280
389 Ga0373925_0446395 3300037068 Bacteria 1059
390 Ga0373925_0498867 3300037068 Bacteria 999
391 Ga0373925_1403180 3300037068 Bacteria 572
392 Ga0395899_0055703 3300037312 Bacteria 2924
393 Ga0395899_0180397 3300037312 Bacteria 1483
394 Ga0395899_0299345 3300037312 Bacteria 1089
395 Ga0395899_0368691 3300037312 Bacteria 957
396 Ga0395899_0921280 3300037312 Bacteria 532
397 Ga0395900_0015152 3300037418 Bacteria 7861
398 Ga0395900_0406131 3300037418 Bacteria 1325
399 Ga0395900_0468924 3300037418 Bacteria 1213
400 Ga0395900_0474315 3300037418 Bacteria 1204
401 Ga0395900_1823630 3300037418 Bacteria 519
402 Ga0395898_0038285 3300037466 Bacteria 4754
403 Ga0395898_0077907 3300037466 Bacteria 3199
404 Ga0395898_0211411 3300037466 Bacteria 1850
405 Ga0395898_0616880 3300037466 Bacteria 1027
406 Ga0395898_1071953 3300037466 Bacteria 740
407 Ga0395898_1854759 3300037466 Bacteria 523
408 Ga0395905_0444462 3300037471 Bacteria 1194
409 Ga0395905_0741391 3300037471 Bacteria 885
410 Ga0395905_0845780 3300037471 Bacteria 818
411 Ga0395905_1331165 3300037471 Bacteria 622
412 Ga0395901_0079715 3300038443 Bacteria 3419
413 Ga0395901_0126642 3300038443 Bacteria 2684
414 Ga0395901_0128336 3300038443 Bacteria 2665
415 Ga0395901_0735536 3300038443 Bacteria 981
416 Ga0395901_0897983 3300038443 Bacteria 868
417 Ga0436365_0489299 3300039437 Bacteria 840
418 Ga0436365_0894153 3300039437 Bacteria 2567
419 Ga0436365_1695513 3300039437 Bacteria 681
420 Ga0436365_1738713 3300039437 Bacteria 2309
421 Ga0436363_1518906 3300039450 Bacteria 586
422 Ga0451839_0323294 3300041496 Bacteria 506
423 Ga0451853_1552171 3300041512 Bacteria 707
424 Ga0439448_0044150 3300042005 Bacteria 1449
425 Ga0450920_006037 3300042122 Bacteria 2168
426 Ga0450907_096719 3300042146 Unclassified 514
427 Ga0439459_0155262 3300042438 Bacteria 601
428 Ga0450918_032812 3300042531 Unclassified 919
429 Ga0466972_0283130 3300044658 Bacteria 775
430 Ga0466972_0290705 3300044658 Bacteria 764
431 Ga0466965_0407738 3300044683 Bacteria 752
432 Ga0466966_0002834 3300044684 Bacteria 11411
433 Ga0466966_0108652 3300044684 Bacteria 1711
434 Ga0466966_0280549 3300044684 Bacteria 1002
435 Ga0466961_0011148 3300044693 Bacteria 5746
436 Ga0466961_0040813 3300044693 Bacteria 2975
437 Ga0466961_0142256 3300044693 Bacteria 1501
438 Ga0466961_0904722 3300044693 Bacteria 525
439 Ga0466963_0000037 3300044694 Bacteria 42541
440 Ga0466963_0012580 3300044694 Bacteria 5184
441 Ga0466963_0019970 3300044694 Bacteria 4210
442 Ga0466963_0025907 3300044694 Bacteria 3745
443 Ga0466963_0039167 3300044694 Bacteria 3103
444 Ga0466963_0107955 3300044694 Bacteria 1909
445 Ga0466963_0434860 3300044694 Bacteria 925
446 Ga0466964_0016749 3300044706 Bacteria 2801
447 Ga0466964_0025011 3300044706 Bacteria 2330
448 Ga0466964_0148086 3300044706 Bacteria 1085
449 Ga0466964_0175895 3300044706 Bacteria 1011
450 Ga0466964_0186342 3300044706 Bacteria 987
451 Ga0466964_0835282 3300044706 Bacteria 523
452 Ga0466971_0150491 3300044719 Bacteria 1086
453 Ga0466971_0356469 3300044719 Bacteria 708
454 Ga0466971_0474972 3300044719 Bacteria 615
455 Ga0466968_0015622 3300044735 Bacteria 3012
456 Ga0466968_0653972 3300044735 Bacteria 534
457 Ga0466970_0189969 3300044765 Bacteria 1141
458 Ga0466970_0223888 3300044765 Bacteria 1050
459 Ga0466957_0106615 3300044842 Bacteria 1773
460 Ga0466957_0340807 3300044842 Bacteria 1015
461 Ga0466957_0487690 3300044842 Bacteria 853
462 Ga0466957_0562358 3300044842 Bacteria 795
463 Ga0466960_0756336 3300044901 Bacteria 586
464 Ga0466959_0009015 3300045049 Bacteria 7075
465 Ga0466959_0101180 3300045049 Bacteria 2063
466 Ga0466959_0199798 3300045049 Bacteria 1392
467 Ga0466959_0286203 3300045049 Bacteria 1130
468 Ga0466959_0722936 3300045049 Bacteria 667
469 Ga0466958_0062153 3300045836 Bacteria 2276
470 Ga0466958_0179435 3300045836 Bacteria 1343
471 Ga0466958_0650196 3300045836 Bacteria 686
472 Ga0466967_0005846 3300045976 Bacteria 8607
473 Ga0466967_0006284 3300045976 Bacteria 8380
474 Ga0466967_0018080 3300045976 Bacteria 5623
475 Ga0466967_0048083 3300045976 Bacteria 3723
476 Ga0466967_0075125 3300045976 Bacteria 3037
477 Ga0466967_0088756 3300045976 Bacteria 2806
478 Ga0466967_0112904 3300045976 Bacteria 2499
479 Ga0466967_0114331 3300045976 Bacteria 2484
480 Ga0466967_0114427 3300045976 Bacteria 2483
481 Ga0466967_0178941 3300045976 Bacteria 1999
482 Ga0466967_0215476 3300045976 Bacteria 1822
483 Ga0466967_0387149 3300045976 Bacteria 1358
484 Ga0466967_0490601 3300045976 Bacteria 1204
485 Ga0466967_0529334 3300045976 Bacteria 1159
486 Ga0466967_0558042 3300045976 Archaea 1128
487 Ga0466967_0610262 3300045976 Bacteria 1077
488 Ga0466967_0625919 3300045976 Bacteria 1063
489 Ga0466967_0631097 3300045976 Unclassified 1059
490 Ga0466967_0733273 3300045976 Unclassified 980
491 Ga0466967_0790312 3300045976 Bacteria 942
492 Ga0466967_0849445 3300045976 Bacteria 907
493 Ga0466967_0947326 3300045976 Bacteria 857
494 Ga0466967_0974087 3300045976 Bacteria 844
495 Ga0466967_1128168 3300045976 Bacteria 781
496 Ga0495603_0097150 3300046455 Bacteria 1721
497 Ga0495603_0187160 3300046455 Bacteria 1197
498 Ga0495603_0189117 3300046455 Unclassified 1190
499 Ga0495641_0024564 3300046461 Bacteria 2973
500 Ga0495641_0114789 3300046461 Bacteria 1201
501 Ga0495641_0118566 3300046461 Bacteria 1180
502 Ga0495653_0223428 3300046463 Bacteria 1265
503 Ga0495580_0201644 3300046472 Bacteria 1370
504 Ga0495582_0042237 3300046473 Bacteria 2512
505 Ga0495582_0125183 3300046473 Unclassified 1450
506 Ga0495582_0170654 3300046473 Bacteria 1238
507 Ga0495582_0237450 3300046473 Bacteria 1044
508 Ga0495639_0244442 3300046475 Bacteria 886
509 Ga0495639_0421677 3300046475 Unclassified 676
510 Ga0495584_0646709 3300046491 Bacteria 539
511 Ga0495594_0153577 3300046499 Bacteria 1307
512 Ga0495608_0216221 3300046511 Bacteria 1204
513 Ga0495630_0143360 3300046517 Bacteria 1816
514 Ga0495630_0160665 3300046517 Bacteria 1711
515 Ga0495630_0202847 3300046517 Bacteria 1513
516 Ga0495630_1081795 3300046517 Bacteria 608
517 Ga0495640_0256980 3300046533 Bacteria 1092
518 Ga0495586_0006168 3300046535 Bacteria 6409
519 Ga0495586_0121463 3300046535 Unclassified 1460
520 Ga0495587_0110294 3300046536 Bacteria 1581
521 Ga0495587_0216860 3300046536 Bacteria 1080
522 Ga0495667_0376677 3300046559 Bacteria 895
523 Ga0495656_0673042 3300046615 Bacteria 556
524 Ga0495634_0117263 3300046642 Bacteria 1707
525 Ga0495634_0489784 3300046642 Bacteria 722
526 Ga0495588_0066979 3300046674 Bacteria 1864
527 Ga0495646_0507906 3300046680 Unclassified 618
528 Ga0495647_0075764 3300046681 Bacteria 1355
529 Ga0495658_0030986 3300046683 Bacteria 2909
530 Ga0495658_0273735 3300046683 Unclassified 1065
531 Ga0495670_0836024 3300046691 Unclassified 503
532 Ga0495649_0423914 3300046694 Bacteria 666
533 Ga0495581_0751410 3300047315 Bacteria 561
534 Ga0495604_0774357 3300047317 Bacteria 606
535 Ga0495674_0126270 3300047319 Bacteria 2158
536 Ga0495674_0237914 3300047319 Bacteria 1501
537 Ga0495674_0359859 3300047319 Bacteria 1180
538 Ga0495676_0154000 3300047321 Unclassified 1633
539 Ga0495676_0329227 3300047321 Unclassified 1025
540 Ga0495676_0700229 3300047321 Bacteria 655
541 Ga0495680_0864477 3300047322 Bacteria 587
542 Ga0495593_0072214 3300047673 Bacteria 1792
543 Ga0496100_0017728 3300048903 Bacteria 4210
544 Ga0496100_0028950 3300048903 Bacteria 3421
545 Ga0496100_0030673 3300048903 Bacteria 3336
546 Ga0496100_0566871 3300048903 Bacteria 880
547 Ga0496100_1020944 3300048903 Bacteria 651
548 Ga0496101_0000692 3300048904 Bacteria 20340
549 Ga0496101_0049101 3300048904 Bacteria 3034
550 Ga0496101_0140299 3300048904 Bacteria 1841
551 Ga0496101_0152153 3300048904 Bacteria 1770
552 Ga0496101_0746118 3300048904 Bacteria 772
553 Ga0496102_0005991 3300048905 Bacteria 10353
554 Ga0496102_0053045 3300048905 Bacteria 3696
555 Ga0496102_0335135 3300048905 Bacteria 1425
556 Ga0496102_0960865 3300048905 Bacteria 775
557 Ga0496103_0011503 3300048906 Bacteria 5244
558 Ga0496103_0196712 3300048906 Bacteria 1296
559 Ga0496103_0199074 3300048906 Bacteria 1288
560 Ga0496103_0449315 3300048906 Bacteria 827
561 Ga0496104_0002218 3300048907 Bacteria 16788
562 Ga0496104_0011990 3300048907 Bacteria 7776
563 Ga0496104_0038000 3300048907 Bacteria 4502
564 Ga0496104_0303474 3300048907 Bacteria 1509
565 Ga0496104_0447155 3300048907 Unclassified 1204
566 Ga0496104_0813858 3300048907 Bacteria 840
567 Ga0496105_0002671 3300048908 Bacteria 12983
568 Ga0496105_0014914 3300048908 Bacteria 6186
569 Ga0496105_0025956 3300048908 Bacteria 4774
570 Ga0496106_0003662 3300048909 Bacteria 11458
571 Ga0496106_0003900 3300048909 Bacteria 11133
572 Ga0496106_0026843 3300048909 Bacteria 4288
573 Ga0496106_0047654 3300048909 Bacteria 3226
574 Ga0496106_0372413 3300048909 Bacteria 1148
575 Ga0496107_0016367 3300048910 Bacteria 5204
576 Ga0496107_0102525 3300048910 Bacteria 2098
577 Ga0496107_0222140 3300048910 Bacteria 1405
578 Ga0496107_0263535 3300048910 Bacteria 1282
579 Ga0496107_0343101 3300048910 Bacteria 1111
580 Ga0496107_0358709 3300048910 Bacteria 1085
581 Ga0496107_0950971 3300048910 Bacteria 625
582 Ga0496108_0006069 3300048911 Bacteria 9769
583 Ga0496108_0057187 3300048911 Bacteria 3277
584 Ga0496108_0180373 3300048911 Bacteria 1828
585 Ga0496108_0275534 3300048911 Bacteria 1465
586 Ga0496108_0451628 3300048911 Bacteria 1123
587 Ga0496108_0640216 3300048911 Bacteria 925
588 Ga0496108_1472549 3300048911 Bacteria 567
589 Ga0496109_0002789 3300048912 Bacteria 14634
590 Ga0496109_0022559 3300048912 Bacteria 5577
591 Ga0496109_0024902 3300048912 Bacteria 5327
592 Ga0496109_0165720 3300048912 Bacteria 2071
593 Ga0496109_0264127 3300048912 Bacteria 1621
594 Ga0496109_0997186 3300048912 Bacteria 775
595 Ga0496110_0004178 3300048913 Bacteria 11153
596 Ga0496110_0066822 3300048913 Bacteria 3180
597 Ga0496111_0010710 3300048914 Bacteria 6167
598 Ga0496111_0033409 3300048914 Bacteria 3669
599 Ga0496111_0150008 3300048914 Bacteria 1729
600 Ga0496111_0179718 3300048914 Bacteria 1573
601 Ga0496111_0284008 3300048914 Bacteria 1228
602 Ga0496111_0921586 3300048914 Bacteria 629
603 Ga0496112_0198220 3300048915 Bacteria 1968
604 Ga0496112_0298617 3300048915 Bacteria 1556
605 Ga0496112_0329180 3300048915 Bacteria 1472
606 Ga0496112_0446110 3300048915 Bacteria 1232
607 Ga0496112_0584436 3300048915 Bacteria 1049
608 Ga0496112_0818046 3300048915 Bacteria 856
609 Ga0496112_1102233 3300048915 Bacteria 712
610 Ga0496112_1638728 3300048915 Bacteria 556
611 Ga0496112_1692982 3300048915 Bacteria 545
612 Ga0496113_0026347 3300048916 Bacteria 4156
613 Ga0496113_0071185 3300048916 Bacteria 2645
614 Ga0496113_0324999 3300048916 Bacteria 1233
615 Ga0496113_0359706 3300048916 Bacteria 1168
616 Ga0496114_0002457 3300048917 Bacteria 14154
617 Ga0496114_0008736 3300048917 Bacteria 8027
618 Ga0496114_0229566 3300048917 Bacteria 1630
619 Ga0496114_0258633 3300048917 Bacteria 1532
620 Ga0496114_0282877 3300048917 Bacteria 1462
621 Ga0496114_0618246 3300048917 Unclassified 954
622 Ga0496114_0685957 3300048917 Bacteria 899
623 Ga0496115_0005151 3300048918 Bacteria 9511
624 Ga0496115_0108794 3300048918 Bacteria 2276
625 Ga0496115_0224670 3300048918 Bacteria 1549
626 Ga0501031_0344451 3300049568 Bacteria 965
627 Ga0501032_0242821 3300049569 Bacteria 1170
628 Ga0501033_1052515 3300049570 Bacteria 542
629 Ga0501034_0321166 3300049571 Bacteria 1481
630 Ga0501036_0356252 3300049572 Bacteria 1222
631 Ga0501036_0547212 3300049572 Bacteria 962
632 Ga0501036_1398409 3300049572 Bacteria 567
633 Ga0501039_0941766 3300049575 Bacteria 672
634 Ga0501039_1042575 3300049575 Bacteria 635
635 Ga0501039_1249633 3300049575 Bacteria 574
636 Ga0501040_0131703 3300049576 Bacteria 1759
637 Ga0501041_0214980 3300049577 Bacteria 1206
638 Ga0501041_0562229 3300049577 Bacteria 727
639 Ga0501046_0848257 3300049580 Bacteria 639
640 Ga0501047_0061170 3300049581 Bacteria 3634
641 Ga0501047_0219398 3300049581 Bacteria 1758
642 Ga0501047_0696142 3300049581 Bacteria 834
643 Ga0501048_0242298 3300049582 Bacteria 1280
644 Ga0501048_1066701 3300049582 Bacteria 581
645 Ga0501048_1373482 3300049582 Bacteria 508
646 Ga0501067_0000163 3300049583 Bacteria 37467
647 Ga0501067_0080425 3300049583 Unclassified 1806
648 Ga0501068_0082316 3300049584 Bacteria 1977
649 Ga0501069_0003809 3300049585 Bacteria 7759
650 Ga0501069_0129026 3300049585 Unclassified 1447
651 Ga0501069_0325813 3300049585 Bacteria 903
652 Ga0501069_0647349 3300049585 Bacteria 636
653 Ga0501070_0003032 3300049586 Bacteria 14629
654 Ga0501070_0067716 3300049586 Bacteria 2957
655 Ga0501070_0310143 3300049586 Bacteria 1284
656 Ga0501070_0323861 3300049586 Bacteria 1253
657 Ga0501070_0396149 3300049586 Bacteria 1117
658 Ga0501070_0883218 3300049586 Unclassified 698
659 Ga0501071_0128485 3300049587 Bacteria 1882
660 Ga0501071_0268424 3300049587 Bacteria 1290
661 Ga0501072_0307219 3300049588 Bacteria 1261
662 Ga0501072_0391156 3300049588 Bacteria 1103
663 Ga0501073_0739985 3300049589 Bacteria 678
664 Ga0501073_1126670 3300049589 Bacteria 539
665 Ga0501074_0012591 3300049590 Bacteria 6149
666 Ga0501074_0200257 3300049590 Bacteria 1423
667 Ga0501075_0179876 3300049591 Bacteria 1614
668 Ga0501075_0185043 3300049591 Bacteria 1589
669 Ga0501075_0190546 3300049591 Bacteria 1564
670 Ga0501075_0595823 3300049591 Bacteria 843
671 Ga0501075_1475497 3300049591 Unclassified 515
672 Ga0501076_0636894 3300049592 Bacteria 880
673 Ga0501076_1797433 3300049592 Bacteria 502
674 Ga0501077_0057161 3300049593 Bacteria 2477
675 Ga0501077_0261169 3300049593 Bacteria 1101
676 Ga0501077_0373892 3300049593 Bacteria 910
677 Ga0501257_217013 3300049686 Unclassified 556
678 Ga0501079_0178201 3300049741 Bacteria 1658
679 Ga0501079_0386254 3300049741 Bacteria 1098
680 Ga0501079_0918928 3300049741 Bacteria 689
681 Ga0501079_1580998 3300049741 Unclassified 516
682 Ga0501080_0186373 3300049742 Bacteria 1908
683 Ga0501080_0248406 3300049742 Bacteria 1622
684 Ga0501080_0261699 3300049742 Unclassified 1576
685 Ga0501080_0497086 3300049742 Bacteria 1090
686 Ga0501081_0147649 3300049743 Bacteria 1688
687 Ga0501081_0332671 3300049743 Unclassified 1118
688 Ga0501081_0903815 3300049743 Bacteria 666
689 Ga0501081_1177611 3300049743 Bacteria 580
690 Ga0501083_0217934 3300049744 Bacteria 1244
691 Ga0501275_079780 3300049772 Unclassified 529
692 Ga0501044_0588971 3300049823 Unclassified 1006
693 nmdc:mga05p37_1933563_c1 3300050507 Bacteria 562
694 nmdc:mga0n895_892_c1 3300050512 Bacteria 21498
695 nmdc:mga0rr50_11460_c1 3300050513 Bacteria 5678
696 nmdc:mga0rr50_1340870_c1 3300050513 Bacteria 606
697 nmdc:mga0rr50_1766530_c1 3300050513 Unclassified 521
698 nmdc:mga0rr50_442247_c1 3300050513 Bacteria 1101
699 nmdc:mga08x19_292384_c1 3300050514 Bacteria 1130
700 nmdc:mga08x19_633109_c1 3300050514 Bacteria 758
701 nmdc:mga08x19_784147_c1 3300050514 Bacteria 677
702 nmdc:mga0a205_249680_c1 3300050515 Bacteria 1654
703 nmdc:mga0a205_28719_c1 3300050515 Bacteria 5319
704 Ga0495612_0120485 3300053078 Unclassified 1128
705 Ga0495612_0180125 3300053078 Bacteria 928
706 Ga0495595_0403410 3300053084 Bacteria 693
707 Ga0501084_0373600 3300054114 Bacteria 1205
708 Ga0501084_0444499 3300054114 Bacteria 1096
709 Ga0501084_0647747 3300054114 Bacteria 892
710 Ga0587070_168066 3300059491 Bacteria 562
711 Ga0587073_0203421 3300059492 Bacteria 595
712 Ga0587083_0217381 3300059505 Bacteria 554
713 Ga0587083_0244555 3300059505 Bacteria 532
714 Ga0587115_082845 3300059626 Bacteria 571
715 Ga0587115_115216 3300059626 Bacteria 512
716 Ga0587075_003998 3300059644 Bacteria 1687
717 Ga0501082_0116044 3300060353 Bacteria 2319
718 Ga0501082_1798094 3300060353 Bacteria 534
719 Ga0466962_0014187 3300061719 Bacteria 3838
720 Ga0466962_0023570 3300061719 Bacteria 2958
721 Ga0530510_0314571 3300061734 Bacteria 1173
722 Ga0530510_0952596 3300061734 Bacteria 656
723 Ga0530510_0970792 3300061734 Bacteria 650
724 Ga0070708_100065381
725 Ga0070658_11212884
726 Ga0070683_100226322
727 Ga0070690_100069365
728 Ga0070690_100166404
729 Ga0068869_100130555
730 Ga0070680_100038117
731 Ga0070680_101738745
732 Ga0070680_101901709
733 Ga0070682_100012408
734 Ga0068868_100061984
735 Ga0068868_100476343
736 Ga0070660_100007596
737 Ga0070660_100021467
738 Ga0070660_100135957
739 Ga0070660_100351431
740 Ga0070689_100075774
741 Ga0070661_100060787
742 Ga0070661_100112887
743 Ga0070692_10009738
744 Ga0070671_100879510
745 Ga0070674_100182410
746 Ga0070674_100272683
747 Ga0070673_101009370
748 Ga0070688_100051117
749 Ga0070659_100035598
750 Ga0070659_100158972
751 Ga0070659_100345434
752 Ga0070667_100055300
753 Ga0070667_100514446
754 Ga0070667_101237269
755 Ga0070714_100265556
756 Ga0070714_100546286
757 Ga0070713_100200477
758 Ga0070701_10174934
759 Ga0070711_100042752
760 Ga0070711_101576723
761 Ga0070705_100095823
762 Ga0070705_100121261
763 Ga0070705_100863960
764 Ga0070700_100249364
765 Ga0070694_100055019
766 Ga0070708_100042687
767 Ga0070708_100094407
768 Ga0070708_101033397
769 Ga0070663_100640697
770 Ga0070663_100733596
771 Ga0070678_100008202
772 Ga0070678_101938165
773 Ga0070681_10001955
774 Ga0070681_10510298
775 Ga0068867_100080687
776 Ga0070685_10335328
777 Ga0070685_10380813
778 Ga0070706_100004684
779 Ga0070706_100211206
780 Ga0070706_100686813
781 Ga0070706_100732961
782 Ga0070707_100004513
783 Ga0070707_100273104
784 Ga0070707_100457585
785 Ga0070707_100672696
786 Ga0070698_100056452
787 Ga0070698_100753766
788 Ga0070699_100181915
789 Ga0070699_100471394
790 Ga0070679_100057784
791 Ga0070679_100135234
792 Ga0070679_100171278
793 Ga0070679_100322341
794 Ga0070684_100030942
795 Ga0070684_100061807
796 Ga0070684_100101616
797 Ga0070684_100132648
798 Ga0070684_100902244
799 Ga0070697_100438854
800 Ga0070697_100672856
801 Ga0068853_100052906
802 Ga0068853_102170324
803 Ga0070686_100053965
804 Ga0070695_100529849
805 Ga0070696_100041484
806 Ga0070696_100096200
807 Ga0070696_101897979
808 Ga0070693_100005617
809 Ga0070693_100206652
810 Ga0070665_100314565
811 Ga0070665_100804462
812 Ga0070704_100488166
813 Ga0070704_100553092
814 Ga0068855_100023960
815 Ga0068855_100555096
816 Ga0068855_100637854
817 Ga0070664_100179626
818 Ga0070664_100441521
819 Ga0068857_100011172
820 Ga0068857_100327735
821 Ga0068857_100364879
822 Ga0068854_100200137
823 Ga0068854_100825568
824 Ga0068854_100995211
825 Ga0068854_101037664
826 Ga0068856_100091442
827 Ga0068856_100216927
828 Ga0068856_101554709
829 Ga0068856_102206004
830 Ga0070702_100033934
831 Ga0070702_100060507
832 Ga0068852_100085601
833 Ga0068852_100186384
834 Ga0068852_100232811
835 Ga0068859_101418953
836 Ga0068864_101298219
837 Ga0068866_10088089
838 Ga0068866_10488061
839 Ga0068870_10801653
840 Ga0068858_100016243
841 Ga0068858_100031994
842 Ga0068858_102458821
843 Ga0068860_100020071
844 Ga0070717_10285063
845 Ga0070715_10014322
846 Ga0070715_10256955
847 Ga0070716_100572563
848 Ga0070712_100037595
849 Ga0097621_100010903
850 Ga0097621_100130048
851 Ga0097621_102205234
852 Ga0068871_100052258
853 Ga0068871_100127541
854 Ga0068871_101182205
855 Ga0075433_10077960
856 Ga0075434_100052014
857 Ga0068865_100014192
858 Ga0068865_100234368
859 Ga0075436_100171437
860 Ga0075436_100861195
861 Ga0097620_101418885
862 Ga0075435_100194889
863 Ga0105240_11517974
864 Ga0105240_11572672
865 Ga0105240_12229884
866 Ga0111539_10814118
867 Ga0105245_10015320
868 Ga0105245_10224157
869 Ga0105245_10349933
870 Ga0105245_10936573
871 Ga0105247_10052990
872 Ga0105247_10304565
873 Ga0105243_10047355
874 Ga0105243_10267127
875 Ga0105243_10658793
876 Ga0105243_11227939
877 Ga0105241_10060149
878 Ga0105241_10084415
879 Ga0105241_10833959
880 Ga0105242_10132083
881 Ga0105242_10139756
882 Ga0105242_10531565
883 Ga0105242_11804535
884 Ga0105248_10291615
885 Ga0105248_10392689
886 Ga0105237_10091107
887 Ga0105237_10202129
888 Ga0105237_10250546
889 Ga0105237_11083411
890 Ga0105238_10031640
891 Ga0105238_10043373
892 Ga0105238_10082150
893 Ga0105238_10822677
894 Ga0105249_10197315
895 Ga0105249_11694934
896 Ga0105249_13550048
897 Ga0105239_10021168
898 Ga0105239_10064989
899 Ga0105239_13164434
900 Ga0105246_10095445
901 Ga0105246_11270223
902 Ga0105246_12551739
903 Ga0157337_1026718
904 Ga0157373_10055667
905 Ga0157371_10131658
906 Ga0157370_10026787
907 Ga0157370_10132385
908 Ga0157370_10192255
909 Ga0157370_10273348
910 Ga0157369_10030091
911 Ga0157369_10040930
912 Ga0157369_10104213
913 Ga0157369_10408792
914 Ga0157374_10021270
915 Ga0157374_10028775
916 Ga0157374_10170871
917 Ga0157374_11557326
918 Ga0157378_10028470
919 Ga0157378_10069193
920 Ga0157378_12674430
921 Ga0157372_10006332
922 Ga0157372_10051234
923 Ga0157372_10083881
924 Ga0157372_10185482
925 Ga0157372_12829193
926 Ga0157375_10541034
927 Ga0157375_11423138
928 Ga0157375_11945663
929 Ga0163163_10488975
930 Ga0163163_11318267
931 Ga0157380_10426993
932 Ga0157380_12597902
933 Ga0157380_12794223
934 Ga0182008_10125663
935 Ga0182008_10548333
936 Ga0157379_10133885
937 Ga0157376_10229361
938 Ga0157376_10322620
939 Ga0157376_10597358
940 Ga0157376_11149807
941 Ga0157376_12100000
942 Ga0182006_1122101
943 Ga0182007_10098967
944 Ga0163161_10201118
945 Ga0163161_10505719
946 Ga0163161_11440430
947 Ga0197907_10913843
948 Ga0197907_11110821
949 Ga0206356_10103907
950 Ga0206356_10503281
951 Ga0206356_10596004
952 Ga0206356_11115077
953 Ga0206356_11478649
954 Ga0206355_1251211
955 Ga0206355_1287509
956 Ga0206350_10489792
957 Ga0206354_10295194
958 Ga0206354_10412236
959 Ga0206354_10669380
960 Ga0206353_11387566
961 Ga0206353_11491132
962 Ga0206353_11727024
963 Ga0154015_1029663
964 Ga0154015_1459760
965 Ga0213874_10071190
966 Ga0213876_10177042
967 Ga0224712_10006171
968 Ga0224712_10135788
969 Ga0224712_10175531
970 Ga0207642_10519908
971 Ga0207710_10164818
972 Ga0207710_10168932
973 Ga0207688_10056833
974 Ga0207680_10213416
975 Ga0207647_10291542
976 Ga0207647_10531479
977 Ga0207685_10011554
978 Ga0207685_10155657
979 Ga0207643_10356051
980 Ga0207705_10051988
981 Ga0207684_10004965
982 Ga0207684_10264467
983 Ga0207684_10955404
984 Ga0207654_10116834
985 Ga0207654_10171698
986 Ga0207654_10238293
987 Ga0207654_10383394
988 Ga0207654_10662506
989 Ga0207707_10006792
990 Ga0207707_10008124
991 Ga0207695_10811588
992 Ga0207671_10282570
993 Ga0207671_10414442
994 Ga0207671_11368290
995 Ga0207693_10071680
996 Ga0207663_10066038
997 Ga0207663_10386863
998 Ga0207660_10214069
999 Ga0207660_10381928
1000 Ga0207657_10004765
1001 Ga0207657_10016023
1002 Ga0207657_10196543
1003 Ga0207649_10021258
1004 Ga0207649_10081017
1005 Ga0207649_10218566
1006 Ga0207652_10027233
1007 Ga0207652_10100346
1008 Ga0207652_10442742
1009 Ga0207652_11156007
1010 Ga0207646_10042572
1011 Ga0207646_10182184
1012 Ga0207646_10347464
1013 Ga0207646_10519811
1014 Ga0207694_10022612
1015 Ga0207694_10255449
1016 Ga0207687_10033171
1017 Ga0207687_10087942
1018 Ga0207687_10238094
1019 Ga0207687_10456349
1020 Ga0207687_10620651
1021 Ga0207664_10510534
1022 Ga0207644_10802325
1023 Ga0207690_10098751
1024 Ga0207690_10113010
1025 Ga0207690_10375101
1026 Ga0207706_10266441
1027 Ga0207686_10027445
1028 Ga0207686_10047765
1029 Ga0207686_11763859
1030 Ga0207709_10017610
1031 Ga0207709_10167895
1032 Ga0207709_10712520
1033 Ga0207709_10991680
1034 Ga0207669_10040730
1035 Ga0207704_10202833
1036 Ga0207704_10230971
1037 Ga0207704_10331760
1038 Ga0207665_10138286
1039 Ga0207711_10142535
1040 Ga0207661_10372072
1041 Ga0207661_10966109
1042 Ga0207661_11537705
1043 Ga0207661_11693779
1044 Ga0207679_10234865
1045 Ga0207667_10205237
1046 Ga0207667_10310643
1047 Ga0207667_10344476
1048 Ga0207667_10962024
1049 Ga0207651_10781922
1050 Ga0207651_10988283
1051 Ga0207712_10926934
1052 Ga0207640_10038906
1053 Ga0207640_10705480
1054 Ga0207640_11349502
1055 Ga0207640_11636438
1056 Ga0207658_10105364
1057 Ga0207658_11822664
1058 Ga0207677_11279497
1059 Ga0207703_10264621
1060 Ga0207703_10411685
1061 Ga0207639_10159484
1062 Ga0207639_11992275
1063 Ga0207639_12289086
1064 Ga0207678_10097724
1065 Ga0207678_10261429
1066 Ga0207678_10523298
1067 Ga0207708_10004026
1068 Ga0207708_10687931
1069 Ga0207702_10107003
1070 Ga0207702_10279314
1071 Ga0207702_10373709
1072 Ga0207702_10763958
1073 Ga0207648_10129610
1074 Ga0207648_11997922
1075 Ga0207676_11131269
1076 Ga0207674_10034277
1077 Ga0207674_10446681
1078 Ga0207683_10000876
1079 Ga0207698_10036602
1080 Ga0207698_10402650
1081 Ga0207698_10656217
1082 Ga0207698_11419273
1083 Ga0207698_11754108
1084 Ga0268266_10080384
1085 Ga0268266_10223952
1086 Ga0268264_10050649
1087 Ga0265319_1028375
1088 Ga0265319_1054231
1089 Ga0265334_10285742
1090 Ga0265318_10173648
1091 Ga0265338_10327795
1092 Ga0265338_10881946
1093 Ga0265320_10009779
1094 Ga0265320_10016252
1095 Ga0265327_10057127
1096 Ga0307416_100415878
1097 Ga0373944_0024448
1098 Ga0373944_0126481
1099 Ga0373936_0016183
1100 Ga0373945_0003861
1101 Ga0373943_0008082
1102 Ga0373943_0544967
1103 Ga0373943_0799242
1104 Ga0373946_0529395
1105 Ga0373931_0381312
1106 Ga0373935_0094404
1107 Ga0373935_1281963
1108 Ga0373927_0223428
1109 Ga0373947_0000590
1110 Ga0373947_0326136
1111 Ga0373925_0025998
1112 Ga0373925_0446395
1113 Ga0373925_0498867
1114 Ga0373925_1403180
1115 Ga0395899_0055703
1116 Ga0395899_0180397
1117 Ga0395899_0299345
1118 Ga0395899_0368691
1119 Ga0395899_0921280
1120 Ga0395900_0015152
1121 Ga0395900_0406131
1122 Ga0395900_0468924
1123 Ga0395900_0474315
1124 Ga0395900_1823630
1125 Ga0395898_0038285
1126 Ga0395898_0077907
1127 Ga0395898_0211411
1128 Ga0395898_0616880
1129 Ga0395898_1071953
1130 Ga0395898_1854759
1131 Ga0395905_0444462
1132 Ga0395905_0741391
1133 Ga0395905_0845780
1134 Ga0395905_1331165
1135 Ga0395901_0079715
1136 Ga0395901_0126642
1137 Ga0395901_0128336
1138 Ga0395901_0735536
1139 Ga0395901_0897983
1140 Ga0436365_0489299
1141 Ga0436365_0894153
1142 Ga0436365_1695513
1143 Ga0436365_1738713
1144 Ga0436363_1518906
1145 Ga0451839_0323294
1146 Ga0451853_1552171
1147 Ga0439448_0044150
1148 Ga0450920_006037
1149 Ga0450907_096719
1150 Ga0439459_0155262
1151 Ga0450918_032812
1152 Ga0466972_0283130
1153 Ga0466972_0290705
1154 Ga0466965_0407738
1155 Ga0466966_0002834
1156 Ga0466966_0108652
1157 Ga0466966_0280549
1158 Ga0466961_0011148
1159 Ga0466961_0040813
1160 Ga0466961_0142256
1161 Ga0466961_0904722
1162 Ga0466963_0000037
1163 Ga0466963_0012580
1164 Ga0466963_0019970
1165 Ga0466963_0025907
1166 Ga0466963_0039167
1167 Ga0466963_0107955
1168 Ga0466963_0434860
1169 Ga0466964_0016749
1170 Ga0466964_0025011
1171 Ga0466964_0148086
1172 Ga0466964_0175895
1173 Ga0466964_0186342
1174 Ga0466964_0835282
1175 Ga0466971_0150491
1176 Ga0466971_0356469
1177 Ga0466971_0474972
1178 Ga0466968_0015622
1179 Ga0466968_0653972
1180 Ga0466970_0189969
1181 Ga0466970_0223888
1182 Ga0466957_0106615
1183 Ga0466957_0340807
1184 Ga0466957_0487690
1185 Ga0466957_0562358
1186 Ga0466960_0756336
1187 Ga0466959_0009015
1188 Ga0466959_0101180
1189 Ga0466959_0199798
1190 Ga0466959_0286203
1191 Ga0466959_0722936
1192 Ga0466958_0062153
1193 Ga0466958_0179435
1194 Ga0466958_0650196
1195 Ga0466967_0005846
1196 Ga0466967_0006284
1197 Ga0466967_0018080
1198 Ga0466967_0048083
1199 Ga0466967_0075125
1200 Ga0466967_0088756
1201 Ga0466967_0112904
1202 Ga0466967_0114331
1203 Ga0466967_0114427
1204 Ga0466967_0178941
1205 Ga0466967_0215476
1206 Ga0466967_0387149
1207 Ga0466967_0490601
1208 Ga0466967_0529334
1209 Ga0466967_0558042
1210 Ga0466967_0610262
1211 Ga0466967_0625919
1212 Ga0466967_0631097
1213 Ga0466967_0733273
1214 Ga0466967_0790312
1215 Ga0466967_0849445
1216 Ga0466967_0947326
1217 Ga0466967_0974087
1218 Ga0466967_1128168
1219 Ga0495603_0097150
1220 Ga0495603_0187160
1221 Ga0495603_0189117
1222 Ga0495641_0024564
1223 Ga0495641_0114789
1224 Ga0495641_0118566
1225 Ga0495653_0223428
1226 Ga0495580_0201644
1227 Ga0495582_0042237
1228 Ga0495582_0125183
1229 Ga0495582_0170654
1230 Ga0495582_0237450
1231 Ga0495639_0244442
1232 Ga0495639_0421677
1233 Ga0495584_0646709
1234 Ga0495594_0153577
1235 Ga0495608_0216221
1236 Ga0495630_0143360
1237 Ga0495630_0160665
1238 Ga0495630_0202847
1239 Ga0495630_1081795
1240 Ga0495640_0256980
1241 Ga0495586_0006168
1242 Ga0495586_0121463
1243 Ga0495587_0110294
1244 Ga0495587_0216860
1245 Ga0495667_0376677
1246 Ga0495656_0673042
1247 Ga0495634_0117263
1248 Ga0495634_0489784
1249 Ga0495588_0066979
1250 Ga0495646_0507906
1251 Ga0495647_0075764
1252 Ga0495658_0030986
1253 Ga0495658_0273735
1254 Ga0495670_0836024
1255 Ga0495649_0423914
1256 Ga0495581_0751410
1257 Ga0495604_0774357
1258 Ga0495674_0126270
1259 Ga0495674_0237914
1260 Ga0495674_0359859
1261 Ga0495676_0154000
1262 Ga0495676_0329227
1263 Ga0495676_0700229
1264 Ga0495680_0864477
1265 Ga0495593_0072214
1266 Ga0496100_0017728
1267 Ga0496100_0028950
1268 Ga0496100_0030673
1269 Ga0496100_0566871
1270 Ga0496100_1020944
1271 Ga0496101_0000692
1272 Ga0496101_0049101
1273 Ga0496101_0140299
1274 Ga0496101_0152153
1275 Ga0496101_0746118
1276 Ga0496102_0005991
1277 Ga0496102_0053045
1278 Ga0496102_0335135
1279 Ga0496102_0960865
1280 Ga0496103_0011503
1281 Ga0496103_0196712
1282 Ga0496103_0199074
1283 Ga0496103_0449315
1284 Ga0496104_0002218
1285 Ga0496104_0011990
1286 Ga0496104_0038000
1287 Ga0496104_0303474
1288 Ga0496104_0447155
1289 Ga0496104_0813858
1290 Ga0496105_0002671
1291 Ga0496105_0014914
1292 Ga0496105_0025956
1293 Ga0496106_0003662
1294 Ga0496106_0003900
1295 Ga0496106_0026843
1296 Ga0496106_0047654
1297 Ga0496106_0372413
1298 Ga0496107_0016367
1299 Ga0496107_0102525
1300 Ga0496107_0222140
1301 Ga0496107_0263535
1302 Ga0496107_0343101
1303 Ga0496107_0358709
1304 Ga0496107_0950971
1305 Ga0496108_0006069
1306 Ga0496108_0057187
1307 Ga0496108_0180373
1308 Ga0496108_0275534
1309 Ga0496108_0451628
1310 Ga0496108_0640216
1311 Ga0496108_1472549
1312 Ga0496109_0002789
1313 Ga0496109_0022559
1314 Ga0496109_0024902
1315 Ga0496109_0165720
1316 Ga0496109_0264127
1317 Ga0496109_0997186
1318 Ga0496110_0004178
1319 Ga0496110_0066822
1320 Ga0496111_0010710
1321 Ga0496111_0033409
1322 Ga0496111_0150008
1323 Ga0496111_0179718
1324 Ga0496111_0284008
1325 Ga0496111_0921586
1326 Ga0496112_0198220
1327 Ga0496112_0298617
1328 Ga0496112_0329180
1329 Ga0496112_0446110
1330 Ga0496112_0584436
1331 Ga0496112_0818046
1332 Ga0496112_1102233
1333 Ga0496112_1638728
1334 Ga0496112_1692982
1335 Ga0496113_0026347
1336 Ga0496113_0071185
1337 Ga0496113_0324999
1338 Ga0496113_0359706
1339 Ga0496114_0002457
1340 Ga0496114_0008736
1341 Ga0496114_0229566
1342 Ga0496114_0258633
1343 Ga0496114_0282877
1344 Ga0496114_0618246
1345 Ga0496114_0685957
1346 Ga0496115_0005151
1347 Ga0496115_0108794
1348 Ga0496115_0224670
1349 Ga0501031_0344451
1350 Ga0501032_0242821
1351 Ga0501033_1052515
1352 Ga0501034_0321166
1353 Ga0501036_0356252
1354 Ga0501036_0547212
1355 Ga0501036_1398409
1356 Ga0501039_0941766
1357 Ga0501039_1042575
1358 Ga0501039_1249633
1359 Ga0501040_0131703
1360 Ga0501041_0214980
1361 Ga0501041_0562229
1362 Ga0501046_0848257
1363 Ga0501047_0061170
1364 Ga0501047_0219398
1365 Ga0501047_0696142
1366 Ga0501048_0242298
1367 Ga0501048_1066701
1368 Ga0501048_1373482
1369 Ga0501067_0000163
1370 Ga0501067_0080425
1371 Ga0501068_0082316
1372 Ga0501069_0003809
1373 Ga0501069_0129026
1374 Ga0501069_0325813
1375 Ga0501069_0647349
1376 Ga0501070_0003032
1377 Ga0501070_0067716
1378 Ga0501070_0310143
1379 Ga0501070_0323861
1380 Ga0501070_0396149
1381 Ga0501070_0883218
1382 Ga0501071_0128485
1383 Ga0501071_0268424
1384 Ga0501072_0307219
1385 Ga0501072_0391156
1386 Ga0501073_0739985
1387 Ga0501073_1126670
1388 Ga0501074_0012591
1389 Ga0501074_0200257
1390 Ga0501075_0179876
1391 Ga0501075_0185043
1392 Ga0501075_0190546
1393 Ga0501075_0595823
1394 Ga0501075_1475497
1395 Ga0501076_0636894
1396 Ga0501076_1797433
1397 Ga0501077_0057161
1398 Ga0501077_0261169
1399 Ga0501077_0373892
1400 Ga0501257_217013
1401 Ga0501079_0178201
1402 Ga0501079_0386254
1403 Ga0501079_0918928
1404 Ga0501079_1580998
1405 Ga0501080_0186373
1406 Ga0501080_0248406
1407 Ga0501080_0261699
1408 Ga0501080_0497086
1409 Ga0501081_0147649
1410 Ga0501081_0332671
1411 Ga0501081_0903815
1412 Ga0501081_1177611
1413 Ga0501083_0217934
1414 Ga0501275_079780
1415 Ga0501044_0588971
1416 nmdc:mga05p37_1933563_c1
1417 nmdc:mga0n895_892_c1
1418 nmdc:mga0rr50_11460_c1
1419 nmdc:mga0rr50_1340870_c1
1420 nmdc:mga0rr50_1766530_c1
1421 nmdc:mga0rr50_442247_c1
1422 nmdc:mga08x19_292384_c1
1423 nmdc:mga08x19_633109_c1
1424 nmdc:mga08x19_784147_c1
1425 nmdc:mga0a205_249680_c1
1426 nmdc:mga0a205_28719_c1
1427 Ga0495612_0120485
1428 Ga0495612_0180125
1429 Ga0495595_0403410
1430 Ga0501084_0373600
1431 Ga0501084_0444499
1432 Ga0501084_0647747
1433 Ga0587070_168066
1434 Ga0587073_0203421
1435 Ga0587083_0217381
1436 Ga0587083_0244555
1437 Ga0587115_082845
1438 Ga0587115_115216
1439 Ga0587075_003998
1440 Ga0501082_0116044
1441 Ga0501082_1798094
1442 Ga0466962_0014187
1443 Ga0466962_0023570
1444 Ga0530510_0314571
1445 Ga0530510_0952596
1446 Ga0530510_0970792

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

20

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9327 5 99
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.9066 1 97
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.9021 2 91
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.8892 2 97
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8892 1 97
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9722 13 97 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9403 5 78 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9295 13 97 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9221 2 97 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9204 5 78 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7V9JNX4-F1-model_v4 Metal-sulfur cluster assembly factor 0.9945 1 99
AF-A0A2E9VW27-F1-model_v4 Rieske domain-containing protein 0.9942 7 97 GO:0046872
GO:0051537
AF-A0A7V5A2L2-F1-model_v4 DUF59 domain-containing protein 0.9926 2 97
AF-A0A257VM95-F1-model_v4 Rieske domain-containing protein 0.9899 2 99 GO:0046872
GO:0051537
AF-A0A7Y5N2I1-F1-model_v4 DUF59 domain-containing protein 0.9889 1 99

Map