F477477
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 295 | 1446 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100065381|Ga0070708_1000653813 |
| Length | 115 |
| Sequence | MADMSEETTTQDKEGGAPTAEQVTEALKVVVDPELGINIVDLGLVYDVAVEDEVVKITYTLTTMGCPVGPLIEQQMQQVLTTLPGISNVESEMVFTPPWSPERMSEEARLAMGMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 103 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 191 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 192 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.13 |
| Metatranscriptomes | 3.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.48 |
| Rhizosphere | 87.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100065381 | 3300005445 | Bacteria | 3261 |
| 2 | Ga0070658_11212884 | 3300005327 | Bacteria | 656 |
| 3 | Ga0070683_100226322 | 3300005329 | Bacteria | 1777 |
| 4 | Ga0070690_100069365 | 3300005330 | Bacteria | 2288 |
| 5 | Ga0070690_100166404 | 3300005330 | Bacteria | 1514 |
| 6 | Ga0068869_100130555 | 3300005334 | Bacteria | 1931 |
| 7 | Ga0070680_100038117 | 3300005336 | Bacteria | 3886 |
| 8 | Ga0070680_101738745 | 3300005336 | Bacteria | 540 |
| 9 | Ga0070680_101901709 | 3300005336 | Bacteria | 516 |
| 10 | Ga0070682_100012408 | 3300005337 | Bacteria | 4887 |
| 11 | Ga0068868_100061984 | 3300005338 | Bacteria | 2963 |
| 12 | Ga0068868_100476343 | 3300005338 | Bacteria | 1090 |
| 13 | Ga0070660_100007596 | 3300005339 | Bacteria | 7557 |
| 14 | Ga0070660_100021467 | 3300005339 | Bacteria | 4763 |
| 15 | Ga0070660_100135957 | 3300005339 | Bacteria | 1969 |
| 16 | Ga0070660_100351431 | 3300005339 | Bacteria | 1214 |
| 17 | Ga0070689_100075774 | 3300005340 | Bacteria | 2634 |
| 18 | Ga0070661_100060787 | 3300005344 | Bacteria | 2772 |
| 19 | Ga0070661_100112887 | 3300005344 | Bacteria | 2030 |
| 20 | Ga0070692_10009738 | 3300005345 | Bacteria | 4347 |
| 21 | Ga0070671_100879510 | 3300005355 | Bacteria | 782 |
| 22 | Ga0070674_100182410 | 3300005356 | Bacteria | 1609 |
| 23 | Ga0070674_100272683 | 3300005356 | Bacteria | 1338 |
| 24 | Ga0070673_101009370 | 3300005364 | Bacteria | 775 |
| 25 | Ga0070688_100051117 | 3300005365 | Bacteria | 2578 |
| 26 | Ga0070659_100035598 | 3300005366 | Bacteria | 3877 |
| 27 | Ga0070659_100158972 | 3300005366 | Bacteria | 1847 |
| 28 | Ga0070659_100345434 | 3300005366 | Bacteria | 1247 |
| 29 | Ga0070667_100055300 | 3300005367 | Bacteria | 3352 |
| 30 | Ga0070667_100514446 | 3300005367 | Bacteria | 1098 |
| 31 | Ga0070667_101237269 | 3300005367 | Bacteria | 699 |
| 32 | Ga0070714_100265556 | 3300005435 | Bacteria | 1590 |
| 33 | Ga0070714_100546286 | 3300005435 | Unclassified | 1109 |
| 34 | Ga0070713_100200477 | 3300005436 | Bacteria | 1802 |
| 35 | Ga0070701_10174934 | 3300005438 | Bacteria | 1253 |
| 36 | Ga0070711_100042752 | 3300005439 | Bacteria | 3065 |
| 37 | Ga0070711_101576723 | 3300005439 | Unclassified | 574 |
| 38 | Ga0070705_100095823 | 3300005440 | Bacteria | 1861 |
| 39 | Ga0070705_100121261 | 3300005440 | Bacteria | 1689 |
| 40 | Ga0070705_100863960 | 3300005440 | Bacteria | 725 |
| 41 | Ga0070700_100249364 | 3300005441 | Bacteria | 1273 |
| 42 | Ga0070694_100055019 | 3300005444 | Bacteria | 2698 |
| 43 | Ga0070708_100042687 | 3300005445 | Bacteria | 3983 |
| 44 | Ga0070708_100094407 | 3300005445 | Bacteria | 2729 |
| 45 | Ga0070708_101033397 | 3300005445 | Bacteria | 770 |
| 46 | Ga0070663_100640697 | 3300005455 | Bacteria | 898 |
| 47 | Ga0070663_100733596 | 3300005455 | Unclassified | 842 |
| 48 | Ga0070678_100008202 | 3300005456 | Bacteria | 6245 |
| 49 | Ga0070678_101938165 | 3300005456 | Bacteria | 557 |
| 50 | Ga0070681_10001955 | 3300005458 | Bacteria | 18619 |
| 51 | Ga0070681_10510298 | 3300005458 | Bacteria | 1116 |
| 52 | Ga0068867_100080687 | 3300005459 | Bacteria | 2451 |
| 53 | Ga0070685_10335328 | 3300005466 | Bacteria | 1029 |
| 54 | Ga0070685_10380813 | 3300005466 | Bacteria | 972 |
| 55 | Ga0070706_100004684 | 3300005467 | Bacteria | 13117 |
| 56 | Ga0070706_100211206 | 3300005467 | Bacteria | 1812 |
| 57 | Ga0070706_100686813 | 3300005467 | Bacteria | 950 |
| 58 | Ga0070706_100732961 | 3300005467 | Bacteria | 916 |
| 59 | Ga0070707_100004513 | 3300005468 | Bacteria | 13032 |
| 60 | Ga0070707_100273104 | 3300005468 | Bacteria | 1643 |
| 61 | Ga0070707_100457585 | 3300005468 | Bacteria | 1237 |
| 62 | Ga0070707_100672696 | 3300005468 | Unclassified | 998 |
| 63 | Ga0070698_100056452 | 3300005471 | Bacteria | 3979 |
| 64 | Ga0070698_100753766 | 3300005471 | Unclassified | 917 |
| 65 | Ga0070699_100181915 | 3300005518 | Bacteria | 1865 |
| 66 | Ga0070699_100471394 | 3300005518 | Bacteria | 1139 |
| 67 | Ga0070679_100057784 | 3300005530 | Bacteria | 3867 |
| 68 | Ga0070679_100135234 | 3300005530 | Bacteria | 2446 |
| 69 | Ga0070679_100171278 | 3300005530 | Bacteria | 2144 |
| 70 | Ga0070679_100322341 | 3300005530 | Bacteria | 1494 |
| 71 | Ga0070684_100030942 | 3300005535 | Bacteria | 4552 |
| 72 | Ga0070684_100061807 | 3300005535 | Bacteria | 3279 |
| 73 | Ga0070684_100101616 | 3300005535 | Bacteria | 2569 |
| 74 | Ga0070684_100132648 | 3300005535 | Bacteria | 2248 |
| 75 | Ga0070684_100902244 | 3300005535 | Bacteria | 828 |
| 76 | Ga0070697_100438854 | 3300005536 | Bacteria | 1136 |
| 77 | Ga0070697_100672856 | 3300005536 | Bacteria | 912 |
| 78 | Ga0068853_100052906 | 3300005539 | Bacteria | 3497 |
| 79 | Ga0068853_102170324 | 3300005539 | Bacteria | 538 |
| 80 | Ga0070686_100053965 | 3300005544 | Bacteria | 2569 |
| 81 | Ga0070695_100529849 | 3300005545 | Bacteria | 915 |
| 82 | Ga0070696_100041484 | 3300005546 | Bacteria | 3180 |
| 83 | Ga0070696_100096200 | 3300005546 | Bacteria | 2116 |
| 84 | Ga0070696_101897979 | 3300005546 | Bacteria | 516 |
| 85 | Ga0070693_100005617 | 3300005547 | Bacteria | 6047 |
| 86 | Ga0070693_100206652 | 3300005547 | Bacteria | 1279 |
| 87 | Ga0070665_100314565 | 3300005548 | Bacteria | 1570 |
| 88 | Ga0070665_100804462 | 3300005548 | Bacteria | 953 |
| 89 | Ga0070704_100488166 | 3300005549 | Bacteria | 1067 |
| 90 | Ga0070704_100553092 | 3300005549 | Bacteria | 1006 |
| 91 | Ga0068855_100023960 | 3300005563 | Bacteria | 7308 |
| 92 | Ga0068855_100555096 | 3300005563 | Bacteria | 1243 |
| 93 | Ga0068855_100637854 | 3300005563 | Bacteria | 1145 |
| 94 | Ga0070664_100179626 | 3300005564 | Bacteria | 1880 |
| 95 | Ga0070664_100441521 | 3300005564 | Bacteria | 1194 |
| 96 | Ga0068857_100011172 | 3300005577 | Bacteria | 7809 |
| 97 | Ga0068857_100327735 | 3300005577 | Bacteria | 1415 |
| 98 | Ga0068857_100364879 | 3300005577 | Bacteria | 1339 |
| 99 | Ga0068854_100200137 | 3300005578 | Bacteria | 1570 |
| 100 | Ga0068854_100825568 | 3300005578 | Bacteria | 810 |
| 101 | Ga0068854_100995211 | 3300005578 | Unclassified | 742 |
| 102 | Ga0068854_101037664 | 3300005578 | Bacteria | 728 |
| 103 | Ga0068856_100091442 | 3300005614 | Bacteria | 3027 |
| 104 | Ga0068856_100216927 | 3300005614 | Bacteria | 1928 |
| 105 | Ga0068856_101554709 | 3300005614 | Unclassified | 675 |
| 106 | Ga0068856_102206004 | 3300005614 | Unclassified | 560 |
| 107 | Ga0070702_100033934 | 3300005615 | Bacteria | 2810 |
| 108 | Ga0070702_100060507 | 3300005615 | Bacteria | 2202 |
| 109 | Ga0068852_100085601 | 3300005616 | Bacteria | 2808 |
| 110 | Ga0068852_100186384 | 3300005616 | Bacteria | 1954 |
| 111 | Ga0068852_100232811 | 3300005616 | Bacteria | 1757 |
| 112 | Ga0068859_101418953 | 3300005617 | Bacteria | 766 |
| 113 | Ga0068864_101298219 | 3300005618 | Bacteria | 728 |
| 114 | Ga0068866_10088089 | 3300005718 | Bacteria | 1684 |
| 115 | Ga0068866_10488061 | 3300005718 | Bacteria | 813 |
| 116 | Ga0068870_10801653 | 3300005840 | Bacteria | 658 |
| 117 | Ga0068858_100016243 | 3300005842 | Bacteria | 6993 |
| 118 | Ga0068858_100031994 | 3300005842 | Bacteria | 4887 |
| 119 | Ga0068858_102458821 | 3300005842 | Unclassified | 515 |
| 120 | Ga0068860_100020071 | 3300005843 | Bacteria | 6474 |
| 121 | Ga0070717_10285063 | 3300006028 | Unclassified | 1466 |
| 122 | Ga0070715_10014322 | 3300006163 | Bacteria | 2935 |
| 123 | Ga0070715_10256955 | 3300006163 | Bacteria | 916 |
| 124 | Ga0070716_100572563 | 3300006173 | Bacteria | 845 |
| 125 | Ga0070712_100037595 | 3300006175 | Bacteria | 3301 |
| 126 | Ga0097621_100010903 | 3300006237 | Bacteria | 6672 |
| 127 | Ga0097621_100130048 | 3300006237 | Bacteria | 2142 |
| 128 | Ga0097621_102205234 | 3300006237 | Unclassified | 527 |
| 129 | Ga0068871_100052258 | 3300006358 | Bacteria | 3309 |
| 130 | Ga0068871_100127541 | 3300006358 | Bacteria | 2155 |
| 131 | Ga0068871_101182205 | 3300006358 | Unclassified | 717 |
| 132 | Ga0075433_10077960 | 3300006852 | Bacteria | 2919 |
| 133 | Ga0075434_100052014 | 3300006871 | Bacteria | 4070 |
| 134 | Ga0068865_100014192 | 3300006881 | Bacteria | 5057 |
| 135 | Ga0068865_100234368 | 3300006881 | Bacteria | 1442 |
| 136 | Ga0075436_100171437 | 3300006914 | Bacteria | 1532 |
| 137 | Ga0075436_100861195 | 3300006914 | Bacteria | 677 |
| 138 | Ga0097620_101418885 | 3300006931 | Bacteria | 766 |
| 139 | Ga0075435_100194889 | 3300007076 | Bacteria | 1716 |
| 140 | Ga0105240_11517974 | 3300009093 | Bacteria | 702 |
| 141 | Ga0105240_11572672 | 3300009093 | Bacteria | 688 |
| 142 | Ga0105240_12229884 | 3300009093 | Bacteria | 568 |
| 143 | Ga0111539_10814118 | 3300009094 | Bacteria | 1087 |
| 144 | Ga0105245_10015320 | 3300009098 | Bacteria | 6682 |
| 145 | Ga0105245_10224157 | 3300009098 | Bacteria | 1815 |
| 146 | Ga0105245_10349933 | 3300009098 | Bacteria | 1464 |
| 147 | Ga0105245_10936573 | 3300009098 | Bacteria | 909 |
| 148 | Ga0105247_10052990 | 3300009101 | Bacteria | 2501 |
| 149 | Ga0105247_10304565 | 3300009101 | Bacteria | 1107 |
| 150 | Ga0105243_10047355 | 3300009148 | Bacteria | 3384 |
| 151 | Ga0105243_10267127 | 3300009148 | Bacteria | 1534 |
| 152 | Ga0105243_10658793 | 3300009148 | Bacteria | 1015 |
| 153 | Ga0105243_11227939 | 3300009148 | Bacteria | 764 |
| 154 | Ga0105241_10060149 | 3300009174 | Bacteria | 2922 |
| 155 | Ga0105241_10084415 | 3300009174 | Bacteria | 2493 |
| 156 | Ga0105241_10833959 | 3300009174 | Bacteria | 851 |
| 157 | Ga0105242_10132083 | 3300009176 | Bacteria | 2157 |
| 158 | Ga0105242_10139756 | 3300009176 | Bacteria | 2100 |
| 159 | Ga0105242_10531565 | 3300009176 | Unclassified | 1124 |
| 160 | Ga0105242_11804535 | 3300009176 | Unclassified | 650 |
| 161 | Ga0105248_10291615 | 3300009177 | Bacteria | 1837 |
| 162 | Ga0105248_10392689 | 3300009177 | Bacteria | 1562 |
| 163 | Ga0105237_10091107 | 3300009545 | Bacteria | 3038 |
| 164 | Ga0105237_10202129 | 3300009545 | Bacteria | 1987 |
| 165 | Ga0105237_10250546 | 3300009545 | Bacteria | 1773 |
| 166 | Ga0105237_11083411 | 3300009545 | Bacteria | 808 |
| 167 | Ga0105238_10031640 | 3300009551 | Bacteria | 5386 |
| 168 | Ga0105238_10043373 | 3300009551 | Bacteria | 4551 |
| 169 | Ga0105238_10082150 | 3300009551 | Bacteria | 3212 |
| 170 | Ga0105238_10822677 | 3300009551 | Bacteria | 945 |
| 171 | Ga0105249_10197315 | 3300009553 | Bacteria | 1968 |
| 172 | Ga0105249_11694934 | 3300009553 | Bacteria | 705 |
| 173 | Ga0105249_13550048 | 3300009553 | Bacteria | 502 |
| 174 | Ga0105239_10021168 | 3300010375 | Bacteria | 7172 |
| 175 | Ga0105239_10064989 | 3300010375 | Bacteria | 4006 |
| 176 | Ga0105239_13164434 | 3300010375 | Bacteria | 536 |
| 177 | Ga0105246_10095445 | 3300011119 | Bacteria | 2153 |
| 178 | Ga0105246_11270223 | 3300011119 | Unclassified | 681 |
| 179 | Ga0105246_12551739 | 3300011119 | Bacteria | 504 |
| 180 | Ga0157337_1026718 | 3300012483 | Bacteria | 567 |
| 181 | Ga0157373_10055667 | 3300013100 | Bacteria | 2809 |
| 182 | Ga0157371_10131658 | 3300013102 | Bacteria | 1780 |
| 183 | Ga0157370_10026787 | 3300013104 | Bacteria | 5687 |
| 184 | Ga0157370_10132385 | 3300013104 | Bacteria | 2325 |
| 185 | Ga0157370_10192255 | 3300013104 | Bacteria | 1894 |
| 186 | Ga0157370_10273348 | 3300013104 | Bacteria | 1561 |
| 187 | Ga0157369_10030091 | 3300013105 | Bacteria | 5991 |
| 188 | Ga0157369_10040930 | 3300013105 | Bacteria | 5057 |
| 189 | Ga0157369_10104213 | 3300013105 | Bacteria | 3021 |
| 190 | Ga0157369_10408792 | 3300013105 | Bacteria | 1408 |
| 191 | Ga0157374_10021270 | 3300013296 | Bacteria | 5769 |
| 192 | Ga0157374_10028775 | 3300013296 | Bacteria | 5023 |
| 193 | Ga0157374_10170871 | 3300013296 | Bacteria | 2120 |
| 194 | Ga0157374_11557326 | 3300013296 | Bacteria | 685 |
| 195 | Ga0157378_10028470 | 3300013297 | Bacteria | 4930 |
| 196 | Ga0157378_10069193 | 3300013297 | Bacteria | 3166 |
| 197 | Ga0157378_12674430 | 3300013297 | Unclassified | 551 |
| 198 | Ga0157372_10006332 | 3300013307 | Bacteria | 12594 |
| 199 | Ga0157372_10051234 | 3300013307 | Bacteria | 4594 |
| 200 | Ga0157372_10083881 | 3300013307 | Bacteria | 3610 |
| 201 | Ga0157372_10185482 | 3300013307 | Bacteria | 2409 |
| 202 | Ga0157372_12829193 | 3300013307 | Bacteria | 556 |
| 203 | Ga0157375_10541034 | 3300013308 | Bacteria | 1327 |
| 204 | Ga0157375_11423138 | 3300013308 | Bacteria | 817 |
| 205 | Ga0157375_11945663 | 3300013308 | Bacteria | 698 |
| 206 | Ga0163163_10488975 | 3300014325 | Bacteria | 1292 |
| 207 | Ga0163163_11318267 | 3300014325 | Bacteria | 784 |
| 208 | Ga0157380_10426993 | 3300014326 | Unclassified | 1266 |
| 209 | Ga0157380_12597902 | 3300014326 | Bacteria | 573 |
| 210 | Ga0157380_12794223 | 3300014326 | Bacteria | 555 |
| 211 | Ga0182008_10125663 | 3300014497 | Bacteria | 1277 |
| 212 | Ga0182008_10548333 | 3300014497 | Bacteria | 642 |
| 213 | Ga0157379_10133885 | 3300014968 | Bacteria | 2232 |
| 214 | Ga0157376_10229361 | 3300014969 | Bacteria | 1724 |
| 215 | Ga0157376_10322620 | 3300014969 | Bacteria | 1469 |
| 216 | Ga0157376_10597358 | 3300014969 | Unclassified | 1098 |
| 217 | Ga0157376_11149807 | 3300014969 | Bacteria | 803 |
| 218 | Ga0157376_12100000 | 3300014969 | Bacteria | 603 |
| 219 | Ga0182006_1122101 | 3300015261 | Bacteria | 904 |
| 220 | Ga0182007_10098967 | 3300015262 | Bacteria | 964 |
| 221 | Ga0163161_10201118 | 3300017792 | Bacteria | 1535 |
| 222 | Ga0163161_10505719 | 3300017792 | Bacteria | 985 |
| 223 | Ga0163161_11440430 | 3300017792 | Bacteria | 603 |
| 224 | Ga0197907_10913843 | 3300020069 | Bacteria | 1073 |
| 225 | Ga0197907_11110821 | 3300020069 | Bacteria | 529 |
| 226 | Ga0206356_10103907 | 3300020070 | Bacteria | 975 |
| 227 | Ga0206356_10503281 | 3300020070 | Bacteria | 565 |
| 228 | Ga0206356_10596004 | 3300020070 | Bacteria | 2000 |
| 229 | Ga0206356_11115077 | 3300020070 | Bacteria | 845 |
| 230 | Ga0206356_11478649 | 3300020070 | Bacteria | 509 |
| 231 | Ga0206355_1251211 | 3300020076 | Bacteria | 503 |
| 232 | Ga0206355_1287509 | 3300020076 | Bacteria | 991 |
| 233 | Ga0206350_10489792 | 3300020080 | Bacteria | 856 |
| 234 | Ga0206354_10295194 | 3300020081 | Bacteria | 930 |
| 235 | Ga0206354_10412236 | 3300020081 | Bacteria | 831 |
| 236 | Ga0206354_10669380 | 3300020081 | Bacteria | 2394 |
| 237 | Ga0206353_11387566 | 3300020082 | Bacteria | 4498 |
| 238 | Ga0206353_11491132 | 3300020082 | Bacteria | 1633 |
| 239 | Ga0206353_11727024 | 3300020082 | Bacteria | 886 |
| 240 | Ga0154015_1029663 | 3300020610 | Bacteria | 617 |
| 241 | Ga0154015_1459760 | 3300020610 | Bacteria | 530 |
| 242 | Ga0213874_10071190 | 3300021377 | Bacteria | 1110 |
| 243 | Ga0213876_10177042 | 3300021384 | Bacteria | 1135 |
| 244 | Ga0224712_10006171 | 3300022467 | Bacteria | 3393 |
| 245 | Ga0224712_10135788 | 3300022467 | Bacteria | 1078 |
| 246 | Ga0224712_10175531 | 3300022467 | Bacteria | 963 |
| 247 | Ga0207642_10519908 | 3300025899 | Bacteria | 731 |
| 248 | Ga0207710_10164818 | 3300025900 | Bacteria | 1081 |
| 249 | Ga0207710_10168932 | 3300025900 | Bacteria | 1069 |
| 250 | Ga0207688_10056833 | 3300025901 | Bacteria | 2199 |
| 251 | Ga0207680_10213416 | 3300025903 | Unclassified | 1320 |
| 252 | Ga0207647_10291542 | 3300025904 | Bacteria | 930 |
| 253 | Ga0207647_10531479 | 3300025904 | Bacteria | 654 |
| 254 | Ga0207685_10011554 | 3300025905 | Bacteria | 2659 |
| 255 | Ga0207685_10155657 | 3300025905 | Bacteria | 1039 |
| 256 | Ga0207643_10356051 | 3300025908 | Bacteria | 919 |
| 257 | Ga0207705_10051988 | 3300025909 | Bacteria | 2949 |
| 258 | Ga0207684_10004965 | 3300025910 | Bacteria | 12408 |
| 259 | Ga0207684_10264467 | 3300025910 | Bacteria | 1484 |
| 260 | Ga0207684_10955404 | 3300025910 | Bacteria | 718 |
| 261 | Ga0207654_10116834 | 3300025911 | Bacteria | 1669 |
| 262 | Ga0207654_10171698 | 3300025911 | Bacteria | 1408 |
| 263 | Ga0207654_10238293 | 3300025911 | Bacteria | 1215 |
| 264 | Ga0207654_10383394 | 3300025911 | Bacteria | 974 |
| 265 | Ga0207654_10662506 | 3300025911 | Bacteria | 748 |
| 266 | Ga0207707_10006792 | 3300025912 | Bacteria | 9984 |
| 267 | Ga0207707_10008124 | 3300025912 | Bacteria | 9112 |
| 268 | Ga0207695_10811588 | 3300025913 | Bacteria | 816 |
| 269 | Ga0207671_10282570 | 3300025914 | Bacteria | 1309 |
| 270 | Ga0207671_10414442 | 3300025914 | Bacteria | 1072 |
| 271 | Ga0207671_11368290 | 3300025914 | Bacteria | 550 |
| 272 | Ga0207693_10071680 | 3300025915 | Bacteria | 2712 |
| 273 | Ga0207663_10066038 | 3300025916 | Bacteria | 2314 |
| 274 | Ga0207663_10386863 | 3300025916 | Unclassified | 1067 |
| 275 | Ga0207660_10214069 | 3300025917 | Bacteria | 1510 |
| 276 | Ga0207660_10381928 | 3300025917 | Bacteria | 1132 |
| 277 | Ga0207657_10004765 | 3300025919 | Bacteria | 14310 |
| 278 | Ga0207657_10016023 | 3300025919 | Bacteria | 7235 |
| 279 | Ga0207657_10196543 | 3300025919 | Bacteria | 1625 |
| 280 | Ga0207649_10021258 | 3300025920 | Bacteria | 3732 |
| 281 | Ga0207649_10081017 | 3300025920 | Bacteria | 2101 |
| 282 | Ga0207649_10218566 | 3300025920 | Bacteria | 1356 |
| 283 | Ga0207652_10027233 | 3300025921 | Bacteria | 4762 |
| 284 | Ga0207652_10100346 | 3300025921 | Bacteria | 2555 |
| 285 | Ga0207652_10442742 | 3300025921 | Bacteria | 1171 |
| 286 | Ga0207652_11156007 | 3300025921 | Bacteria | 675 |
| 287 | Ga0207646_10042572 | 3300025922 | Bacteria | 4079 |
| 288 | Ga0207646_10182184 | 3300025922 | Bacteria | 1897 |
| 289 | Ga0207646_10347464 | 3300025922 | Bacteria | 1340 |
| 290 | Ga0207646_10519811 | 3300025922 | Unclassified | 1072 |
| 291 | Ga0207694_10022612 | 3300025924 | Bacteria | 4770 |
| 292 | Ga0207694_10255449 | 3300025924 | Bacteria | 1435 |
| 293 | Ga0207687_10033171 | 3300025927 | Bacteria | 3501 |
| 294 | Ga0207687_10087942 | 3300025927 | Bacteria | 2259 |
| 295 | Ga0207687_10238094 | 3300025927 | Bacteria | 1441 |
| 296 | Ga0207687_10456349 | 3300025927 | Bacteria | 1061 |
| 297 | Ga0207687_10620651 | 3300025927 | Unclassified | 913 |
| 298 | Ga0207664_10510534 | 3300025929 | Unclassified | 1077 |
| 299 | Ga0207644_10802325 | 3300025931 | Bacteria | 787 |
| 300 | Ga0207690_10098751 | 3300025932 | Bacteria | 2080 |
| 301 | Ga0207690_10113010 | 3300025932 | Bacteria | 1959 |
| 302 | Ga0207690_10375101 | 3300025932 | Bacteria | 1129 |
| 303 | Ga0207706_10266441 | 3300025933 | Bacteria | 1495 |
| 304 | Ga0207686_10027445 | 3300025934 | Bacteria | 3335 |
| 305 | Ga0207686_10047765 | 3300025934 | Bacteria | 2648 |
| 306 | Ga0207686_11763859 | 3300025934 | Unclassified | 512 |
| 307 | Ga0207709_10017610 | 3300025935 | Bacteria | 3989 |
| 308 | Ga0207709_10167895 | 3300025935 | Bacteria | 1537 |
| 309 | Ga0207709_10712520 | 3300025935 | Bacteria | 804 |
| 310 | Ga0207709_10991680 | 3300025935 | Bacteria | 686 |
| 311 | Ga0207669_10040730 | 3300025937 | Bacteria | 2698 |
| 312 | Ga0207704_10202833 | 3300025938 | Bacteria | 1453 |
| 313 | Ga0207704_10230971 | 3300025938 | Bacteria | 1376 |
| 314 | Ga0207704_10331760 | 3300025938 | Unclassified | 1177 |
| 315 | Ga0207665_10138286 | 3300025939 | Bacteria | 1734 |
| 316 | Ga0207711_10142535 | 3300025941 | Bacteria | 2157 |
| 317 | Ga0207661_10372072 | 3300025944 | Bacteria | 1292 |
| 318 | Ga0207661_10966109 | 3300025944 | Bacteria | 785 |
| 319 | Ga0207661_11537705 | 3300025944 | Bacteria | 609 |
| 320 | Ga0207661_11693779 | 3300025944 | Bacteria | 577 |
| 321 | Ga0207679_10234865 | 3300025945 | Bacteria | 1550 |
| 322 | Ga0207667_10205237 | 3300025949 | Bacteria | 2021 |
| 323 | Ga0207667_10310643 | 3300025949 | Bacteria | 1610 |
| 324 | Ga0207667_10344476 | 3300025949 | Bacteria | 1520 |
| 325 | Ga0207667_10962024 | 3300025949 | Unclassified | 843 |
| 326 | Ga0207651_10781922 | 3300025960 | Unclassified | 845 |
| 327 | Ga0207651_10988283 | 3300025960 | Bacteria | 752 |
| 328 | Ga0207712_10926934 | 3300025961 | Bacteria | 771 |
| 329 | Ga0207640_10038906 | 3300025981 | Bacteria | 3005 |
| 330 | Ga0207640_10705480 | 3300025981 | Bacteria | 865 |
| 331 | Ga0207640_11349502 | 3300025981 | Bacteria | 638 |
| 332 | Ga0207640_11636438 | 3300025981 | Bacteria | 580 |
| 333 | Ga0207658_10105364 | 3300025986 | Bacteria | 2218 |
| 334 | Ga0207658_11822664 | 3300025986 | Bacteria | 555 |
| 335 | Ga0207677_11279497 | 3300026023 | Bacteria | 673 |
| 336 | Ga0207703_10264621 | 3300026035 | Bacteria | 1555 |
| 337 | Ga0207703_10411685 | 3300026035 | Bacteria | 1256 |
| 338 | Ga0207639_10159484 | 3300026041 | Bacteria | 1899 |
| 339 | Ga0207639_11992275 | 3300026041 | Bacteria | 542 |
| 340 | Ga0207639_12289086 | 3300026041 | Bacteria | 502 |
| 341 | Ga0207678_10097724 | 3300026067 | Bacteria | 2509 |
| 342 | Ga0207678_10261429 | 3300026067 | Bacteria | 1483 |
| 343 | Ga0207678_10523298 | 3300026067 | Bacteria | 1035 |
| 344 | Ga0207708_10004026 | 3300026075 | Bacteria | 10811 |
| 345 | Ga0207708_10687931 | 3300026075 | Bacteria | 873 |
| 346 | Ga0207702_10107003 | 3300026078 | Bacteria | 2479 |
| 347 | Ga0207702_10279314 | 3300026078 | Bacteria | 1578 |
| 348 | Ga0207702_10373709 | 3300026078 | Bacteria | 1369 |
| 349 | Ga0207702_10763958 | 3300026078 | Bacteria | 954 |
| 350 | Ga0207648_10129610 | 3300026089 | Bacteria | 2220 |
| 351 | Ga0207648_11997922 | 3300026089 | Bacteria | 541 |
| 352 | Ga0207676_11131269 | 3300026095 | Bacteria | 775 |
| 353 | Ga0207674_10034277 | 3300026116 | Bacteria | 5310 |
| 354 | Ga0207674_10446681 | 3300026116 | Bacteria | 1250 |
| 355 | Ga0207683_10000876 | 3300026121 | Bacteria | 27583 |
| 356 | Ga0207698_10036602 | 3300026142 | Bacteria | 3604 |
| 357 | Ga0207698_10402650 | 3300026142 | Bacteria | 1308 |
| 358 | Ga0207698_10656217 | 3300026142 | Bacteria | 1040 |
| 359 | Ga0207698_11419273 | 3300026142 | Bacteria | 709 |
| 360 | Ga0207698_11754108 | 3300026142 | Bacteria | 636 |
| 361 | Ga0268266_10080384 | 3300028379 | Bacteria | 2840 |
| 362 | Ga0268266_10223952 | 3300028379 | Bacteria | 1730 |
| 363 | Ga0268264_10050649 | 3300028381 | Bacteria | 3458 |
| 364 | Ga0265319_1028375 | 3300028563 | Bacteria | 1974 |
| 365 | Ga0265319_1054231 | 3300028563 | Bacteria | 1315 |
| 366 | Ga0265334_10285742 | 3300028573 | Bacteria | 566 |
| 367 | Ga0265318_10173648 | 3300028577 | Bacteria | 789 |
| 368 | Ga0265338_10327795 | 3300028800 | Unclassified | 1107 |
| 369 | Ga0265338_10881946 | 3300028800 | Bacteria | 610 |
| 370 | Ga0265320_10009779 | 3300031240 | Bacteria | 5755 |
| 371 | Ga0265320_10016252 | 3300031240 | Bacteria | 4176 |
| 372 | Ga0265327_10057127 | 3300031251 | Bacteria | 2008 |
| 373 | Ga0307416_100415878 | 3300032002 | Unclassified | 1387 |
| 374 | Ga0373944_0024448 | 3300035089 | Bacteria | 1771 |
| 375 | Ga0373944_0126481 | 3300035089 | Bacteria | 885 |
| 376 | Ga0373936_0016183 | 3300035113 | Bacteria | 2867 |
| 377 | Ga0373945_0003861 | 3300035116 | Bacteria | 4734 |
| 378 | Ga0373943_0008082 | 3300035170 | Bacteria | 4718 |
| 379 | Ga0373943_0544967 | 3300035170 | Bacteria | 680 |
| 380 | Ga0373943_0799242 | 3300035170 | Bacteria | 561 |
| 381 | Ga0373946_0529395 | 3300035171 | Bacteria | 606 |
| 382 | Ga0373931_0381312 | 3300035691 | Unclassified | 889 |
| 383 | Ga0373935_0094404 | 3300035692 | Bacteria | 1963 |
| 384 | Ga0373935_1281963 | 3300035692 | Bacteria | 547 |
| 385 | Ga0373927_0223428 | 3300035695 | Bacteria | 1237 |
| 386 | Ga0373947_0000590 | 3300035725 | Bacteria | 21313 |
| 387 | Ga0373947_0326136 | 3300035725 | Bacteria | 1027 |
| 388 | Ga0373925_0025998 | 3300037068 | Bacteria | 4280 |
| 389 | Ga0373925_0446395 | 3300037068 | Bacteria | 1059 |
| 390 | Ga0373925_0498867 | 3300037068 | Bacteria | 999 |
| 391 | Ga0373925_1403180 | 3300037068 | Bacteria | 572 |
| 392 | Ga0395899_0055703 | 3300037312 | Bacteria | 2924 |
| 393 | Ga0395899_0180397 | 3300037312 | Bacteria | 1483 |
| 394 | Ga0395899_0299345 | 3300037312 | Bacteria | 1089 |
| 395 | Ga0395899_0368691 | 3300037312 | Bacteria | 957 |
| 396 | Ga0395899_0921280 | 3300037312 | Bacteria | 532 |
| 397 | Ga0395900_0015152 | 3300037418 | Bacteria | 7861 |
| 398 | Ga0395900_0406131 | 3300037418 | Bacteria | 1325 |
| 399 | Ga0395900_0468924 | 3300037418 | Bacteria | 1213 |
| 400 | Ga0395900_0474315 | 3300037418 | Bacteria | 1204 |
| 401 | Ga0395900_1823630 | 3300037418 | Bacteria | 519 |
| 402 | Ga0395898_0038285 | 3300037466 | Bacteria | 4754 |
| 403 | Ga0395898_0077907 | 3300037466 | Bacteria | 3199 |
| 404 | Ga0395898_0211411 | 3300037466 | Bacteria | 1850 |
| 405 | Ga0395898_0616880 | 3300037466 | Bacteria | 1027 |
| 406 | Ga0395898_1071953 | 3300037466 | Bacteria | 740 |
| 407 | Ga0395898_1854759 | 3300037466 | Bacteria | 523 |
| 408 | Ga0395905_0444462 | 3300037471 | Bacteria | 1194 |
| 409 | Ga0395905_0741391 | 3300037471 | Bacteria | 885 |
| 410 | Ga0395905_0845780 | 3300037471 | Bacteria | 818 |
| 411 | Ga0395905_1331165 | 3300037471 | Bacteria | 622 |
| 412 | Ga0395901_0079715 | 3300038443 | Bacteria | 3419 |
| 413 | Ga0395901_0126642 | 3300038443 | Bacteria | 2684 |
| 414 | Ga0395901_0128336 | 3300038443 | Bacteria | 2665 |
| 415 | Ga0395901_0735536 | 3300038443 | Bacteria | 981 |
| 416 | Ga0395901_0897983 | 3300038443 | Bacteria | 868 |
| 417 | Ga0436365_0489299 | 3300039437 | Bacteria | 840 |
| 418 | Ga0436365_0894153 | 3300039437 | Bacteria | 2567 |
| 419 | Ga0436365_1695513 | 3300039437 | Bacteria | 681 |
| 420 | Ga0436365_1738713 | 3300039437 | Bacteria | 2309 |
| 421 | Ga0436363_1518906 | 3300039450 | Bacteria | 586 |
| 422 | Ga0451839_0323294 | 3300041496 | Bacteria | 506 |
| 423 | Ga0451853_1552171 | 3300041512 | Bacteria | 707 |
| 424 | Ga0439448_0044150 | 3300042005 | Bacteria | 1449 |
| 425 | Ga0450920_006037 | 3300042122 | Bacteria | 2168 |
| 426 | Ga0450907_096719 | 3300042146 | Unclassified | 514 |
| 427 | Ga0439459_0155262 | 3300042438 | Bacteria | 601 |
| 428 | Ga0450918_032812 | 3300042531 | Unclassified | 919 |
| 429 | Ga0466972_0283130 | 3300044658 | Bacteria | 775 |
| 430 | Ga0466972_0290705 | 3300044658 | Bacteria | 764 |
| 431 | Ga0466965_0407738 | 3300044683 | Bacteria | 752 |
| 432 | Ga0466966_0002834 | 3300044684 | Bacteria | 11411 |
| 433 | Ga0466966_0108652 | 3300044684 | Bacteria | 1711 |
| 434 | Ga0466966_0280549 | 3300044684 | Bacteria | 1002 |
| 435 | Ga0466961_0011148 | 3300044693 | Bacteria | 5746 |
| 436 | Ga0466961_0040813 | 3300044693 | Bacteria | 2975 |
| 437 | Ga0466961_0142256 | 3300044693 | Bacteria | 1501 |
| 438 | Ga0466961_0904722 | 3300044693 | Bacteria | 525 |
| 439 | Ga0466963_0000037 | 3300044694 | Bacteria | 42541 |
| 440 | Ga0466963_0012580 | 3300044694 | Bacteria | 5184 |
| 441 | Ga0466963_0019970 | 3300044694 | Bacteria | 4210 |
| 442 | Ga0466963_0025907 | 3300044694 | Bacteria | 3745 |
| 443 | Ga0466963_0039167 | 3300044694 | Bacteria | 3103 |
| 444 | Ga0466963_0107955 | 3300044694 | Bacteria | 1909 |
| 445 | Ga0466963_0434860 | 3300044694 | Bacteria | 925 |
| 446 | Ga0466964_0016749 | 3300044706 | Bacteria | 2801 |
| 447 | Ga0466964_0025011 | 3300044706 | Bacteria | 2330 |
| 448 | Ga0466964_0148086 | 3300044706 | Bacteria | 1085 |
| 449 | Ga0466964_0175895 | 3300044706 | Bacteria | 1011 |
| 450 | Ga0466964_0186342 | 3300044706 | Bacteria | 987 |
| 451 | Ga0466964_0835282 | 3300044706 | Bacteria | 523 |
| 452 | Ga0466971_0150491 | 3300044719 | Bacteria | 1086 |
| 453 | Ga0466971_0356469 | 3300044719 | Bacteria | 708 |
| 454 | Ga0466971_0474972 | 3300044719 | Bacteria | 615 |
| 455 | Ga0466968_0015622 | 3300044735 | Bacteria | 3012 |
| 456 | Ga0466968_0653972 | 3300044735 | Bacteria | 534 |
| 457 | Ga0466970_0189969 | 3300044765 | Bacteria | 1141 |
| 458 | Ga0466970_0223888 | 3300044765 | Bacteria | 1050 |
| 459 | Ga0466957_0106615 | 3300044842 | Bacteria | 1773 |
| 460 | Ga0466957_0340807 | 3300044842 | Bacteria | 1015 |
| 461 | Ga0466957_0487690 | 3300044842 | Bacteria | 853 |
| 462 | Ga0466957_0562358 | 3300044842 | Bacteria | 795 |
| 463 | Ga0466960_0756336 | 3300044901 | Bacteria | 586 |
| 464 | Ga0466959_0009015 | 3300045049 | Bacteria | 7075 |
| 465 | Ga0466959_0101180 | 3300045049 | Bacteria | 2063 |
| 466 | Ga0466959_0199798 | 3300045049 | Bacteria | 1392 |
| 467 | Ga0466959_0286203 | 3300045049 | Bacteria | 1130 |
| 468 | Ga0466959_0722936 | 3300045049 | Bacteria | 667 |
| 469 | Ga0466958_0062153 | 3300045836 | Bacteria | 2276 |
| 470 | Ga0466958_0179435 | 3300045836 | Bacteria | 1343 |
| 471 | Ga0466958_0650196 | 3300045836 | Bacteria | 686 |
| 472 | Ga0466967_0005846 | 3300045976 | Bacteria | 8607 |
| 473 | Ga0466967_0006284 | 3300045976 | Bacteria | 8380 |
| 474 | Ga0466967_0018080 | 3300045976 | Bacteria | 5623 |
| 475 | Ga0466967_0048083 | 3300045976 | Bacteria | 3723 |
| 476 | Ga0466967_0075125 | 3300045976 | Bacteria | 3037 |
| 477 | Ga0466967_0088756 | 3300045976 | Bacteria | 2806 |
| 478 | Ga0466967_0112904 | 3300045976 | Bacteria | 2499 |
| 479 | Ga0466967_0114331 | 3300045976 | Bacteria | 2484 |
| 480 | Ga0466967_0114427 | 3300045976 | Bacteria | 2483 |
| 481 | Ga0466967_0178941 | 3300045976 | Bacteria | 1999 |
| 482 | Ga0466967_0215476 | 3300045976 | Bacteria | 1822 |
| 483 | Ga0466967_0387149 | 3300045976 | Bacteria | 1358 |
| 484 | Ga0466967_0490601 | 3300045976 | Bacteria | 1204 |
| 485 | Ga0466967_0529334 | 3300045976 | Bacteria | 1159 |
| 486 | Ga0466967_0558042 | 3300045976 | Archaea | 1128 |
| 487 | Ga0466967_0610262 | 3300045976 | Bacteria | 1077 |
| 488 | Ga0466967_0625919 | 3300045976 | Bacteria | 1063 |
| 489 | Ga0466967_0631097 | 3300045976 | Unclassified | 1059 |
| 490 | Ga0466967_0733273 | 3300045976 | Unclassified | 980 |
| 491 | Ga0466967_0790312 | 3300045976 | Bacteria | 942 |
| 492 | Ga0466967_0849445 | 3300045976 | Bacteria | 907 |
| 493 | Ga0466967_0947326 | 3300045976 | Bacteria | 857 |
| 494 | Ga0466967_0974087 | 3300045976 | Bacteria | 844 |
| 495 | Ga0466967_1128168 | 3300045976 | Bacteria | 781 |
| 496 | Ga0495603_0097150 | 3300046455 | Bacteria | 1721 |
| 497 | Ga0495603_0187160 | 3300046455 | Bacteria | 1197 |
| 498 | Ga0495603_0189117 | 3300046455 | Unclassified | 1190 |
| 499 | Ga0495641_0024564 | 3300046461 | Bacteria | 2973 |
| 500 | Ga0495641_0114789 | 3300046461 | Bacteria | 1201 |
| 501 | Ga0495641_0118566 | 3300046461 | Bacteria | 1180 |
| 502 | Ga0495653_0223428 | 3300046463 | Bacteria | 1265 |
| 503 | Ga0495580_0201644 | 3300046472 | Bacteria | 1370 |
| 504 | Ga0495582_0042237 | 3300046473 | Bacteria | 2512 |
| 505 | Ga0495582_0125183 | 3300046473 | Unclassified | 1450 |
| 506 | Ga0495582_0170654 | 3300046473 | Bacteria | 1238 |
| 507 | Ga0495582_0237450 | 3300046473 | Bacteria | 1044 |
| 508 | Ga0495639_0244442 | 3300046475 | Bacteria | 886 |
| 509 | Ga0495639_0421677 | 3300046475 | Unclassified | 676 |
| 510 | Ga0495584_0646709 | 3300046491 | Bacteria | 539 |
| 511 | Ga0495594_0153577 | 3300046499 | Bacteria | 1307 |
| 512 | Ga0495608_0216221 | 3300046511 | Bacteria | 1204 |
| 513 | Ga0495630_0143360 | 3300046517 | Bacteria | 1816 |
| 514 | Ga0495630_0160665 | 3300046517 | Bacteria | 1711 |
| 515 | Ga0495630_0202847 | 3300046517 | Bacteria | 1513 |
| 516 | Ga0495630_1081795 | 3300046517 | Bacteria | 608 |
| 517 | Ga0495640_0256980 | 3300046533 | Bacteria | 1092 |
| 518 | Ga0495586_0006168 | 3300046535 | Bacteria | 6409 |
| 519 | Ga0495586_0121463 | 3300046535 | Unclassified | 1460 |
| 520 | Ga0495587_0110294 | 3300046536 | Bacteria | 1581 |
| 521 | Ga0495587_0216860 | 3300046536 | Bacteria | 1080 |
| 522 | Ga0495667_0376677 | 3300046559 | Bacteria | 895 |
| 523 | Ga0495656_0673042 | 3300046615 | Bacteria | 556 |
| 524 | Ga0495634_0117263 | 3300046642 | Bacteria | 1707 |
| 525 | Ga0495634_0489784 | 3300046642 | Bacteria | 722 |
| 526 | Ga0495588_0066979 | 3300046674 | Bacteria | 1864 |
| 527 | Ga0495646_0507906 | 3300046680 | Unclassified | 618 |
| 528 | Ga0495647_0075764 | 3300046681 | Bacteria | 1355 |
| 529 | Ga0495658_0030986 | 3300046683 | Bacteria | 2909 |
| 530 | Ga0495658_0273735 | 3300046683 | Unclassified | 1065 |
| 531 | Ga0495670_0836024 | 3300046691 | Unclassified | 503 |
| 532 | Ga0495649_0423914 | 3300046694 | Bacteria | 666 |
| 533 | Ga0495581_0751410 | 3300047315 | Bacteria | 561 |
| 534 | Ga0495604_0774357 | 3300047317 | Bacteria | 606 |
| 535 | Ga0495674_0126270 | 3300047319 | Bacteria | 2158 |
| 536 | Ga0495674_0237914 | 3300047319 | Bacteria | 1501 |
| 537 | Ga0495674_0359859 | 3300047319 | Bacteria | 1180 |
| 538 | Ga0495676_0154000 | 3300047321 | Unclassified | 1633 |
| 539 | Ga0495676_0329227 | 3300047321 | Unclassified | 1025 |
| 540 | Ga0495676_0700229 | 3300047321 | Bacteria | 655 |
| 541 | Ga0495680_0864477 | 3300047322 | Bacteria | 587 |
| 542 | Ga0495593_0072214 | 3300047673 | Bacteria | 1792 |
| 543 | Ga0496100_0017728 | 3300048903 | Bacteria | 4210 |
| 544 | Ga0496100_0028950 | 3300048903 | Bacteria | 3421 |
| 545 | Ga0496100_0030673 | 3300048903 | Bacteria | 3336 |
| 546 | Ga0496100_0566871 | 3300048903 | Bacteria | 880 |
| 547 | Ga0496100_1020944 | 3300048903 | Bacteria | 651 |
| 548 | Ga0496101_0000692 | 3300048904 | Bacteria | 20340 |
| 549 | Ga0496101_0049101 | 3300048904 | Bacteria | 3034 |
| 550 | Ga0496101_0140299 | 3300048904 | Bacteria | 1841 |
| 551 | Ga0496101_0152153 | 3300048904 | Bacteria | 1770 |
| 552 | Ga0496101_0746118 | 3300048904 | Bacteria | 772 |
| 553 | Ga0496102_0005991 | 3300048905 | Bacteria | 10353 |
| 554 | Ga0496102_0053045 | 3300048905 | Bacteria | 3696 |
| 555 | Ga0496102_0335135 | 3300048905 | Bacteria | 1425 |
| 556 | Ga0496102_0960865 | 3300048905 | Bacteria | 775 |
| 557 | Ga0496103_0011503 | 3300048906 | Bacteria | 5244 |
| 558 | Ga0496103_0196712 | 3300048906 | Bacteria | 1296 |
| 559 | Ga0496103_0199074 | 3300048906 | Bacteria | 1288 |
| 560 | Ga0496103_0449315 | 3300048906 | Bacteria | 827 |
| 561 | Ga0496104_0002218 | 3300048907 | Bacteria | 16788 |
| 562 | Ga0496104_0011990 | 3300048907 | Bacteria | 7776 |
| 563 | Ga0496104_0038000 | 3300048907 | Bacteria | 4502 |
| 564 | Ga0496104_0303474 | 3300048907 | Bacteria | 1509 |
| 565 | Ga0496104_0447155 | 3300048907 | Unclassified | 1204 |
| 566 | Ga0496104_0813858 | 3300048907 | Bacteria | 840 |
| 567 | Ga0496105_0002671 | 3300048908 | Bacteria | 12983 |
| 568 | Ga0496105_0014914 | 3300048908 | Bacteria | 6186 |
| 569 | Ga0496105_0025956 | 3300048908 | Bacteria | 4774 |
| 570 | Ga0496106_0003662 | 3300048909 | Bacteria | 11458 |
| 571 | Ga0496106_0003900 | 3300048909 | Bacteria | 11133 |
| 572 | Ga0496106_0026843 | 3300048909 | Bacteria | 4288 |
| 573 | Ga0496106_0047654 | 3300048909 | Bacteria | 3226 |
| 574 | Ga0496106_0372413 | 3300048909 | Bacteria | 1148 |
| 575 | Ga0496107_0016367 | 3300048910 | Bacteria | 5204 |
| 576 | Ga0496107_0102525 | 3300048910 | Bacteria | 2098 |
| 577 | Ga0496107_0222140 | 3300048910 | Bacteria | 1405 |
| 578 | Ga0496107_0263535 | 3300048910 | Bacteria | 1282 |
| 579 | Ga0496107_0343101 | 3300048910 | Bacteria | 1111 |
| 580 | Ga0496107_0358709 | 3300048910 | Bacteria | 1085 |
| 581 | Ga0496107_0950971 | 3300048910 | Bacteria | 625 |
| 582 | Ga0496108_0006069 | 3300048911 | Bacteria | 9769 |
| 583 | Ga0496108_0057187 | 3300048911 | Bacteria | 3277 |
| 584 | Ga0496108_0180373 | 3300048911 | Bacteria | 1828 |
| 585 | Ga0496108_0275534 | 3300048911 | Bacteria | 1465 |
| 586 | Ga0496108_0451628 | 3300048911 | Bacteria | 1123 |
| 587 | Ga0496108_0640216 | 3300048911 | Bacteria | 925 |
| 588 | Ga0496108_1472549 | 3300048911 | Bacteria | 567 |
| 589 | Ga0496109_0002789 | 3300048912 | Bacteria | 14634 |
| 590 | Ga0496109_0022559 | 3300048912 | Bacteria | 5577 |
| 591 | Ga0496109_0024902 | 3300048912 | Bacteria | 5327 |
| 592 | Ga0496109_0165720 | 3300048912 | Bacteria | 2071 |
| 593 | Ga0496109_0264127 | 3300048912 | Bacteria | 1621 |
| 594 | Ga0496109_0997186 | 3300048912 | Bacteria | 775 |
| 595 | Ga0496110_0004178 | 3300048913 | Bacteria | 11153 |
| 596 | Ga0496110_0066822 | 3300048913 | Bacteria | 3180 |
| 597 | Ga0496111_0010710 | 3300048914 | Bacteria | 6167 |
| 598 | Ga0496111_0033409 | 3300048914 | Bacteria | 3669 |
| 599 | Ga0496111_0150008 | 3300048914 | Bacteria | 1729 |
| 600 | Ga0496111_0179718 | 3300048914 | Bacteria | 1573 |
| 601 | Ga0496111_0284008 | 3300048914 | Bacteria | 1228 |
| 602 | Ga0496111_0921586 | 3300048914 | Bacteria | 629 |
| 603 | Ga0496112_0198220 | 3300048915 | Bacteria | 1968 |
| 604 | Ga0496112_0298617 | 3300048915 | Bacteria | 1556 |
| 605 | Ga0496112_0329180 | 3300048915 | Bacteria | 1472 |
| 606 | Ga0496112_0446110 | 3300048915 | Bacteria | 1232 |
| 607 | Ga0496112_0584436 | 3300048915 | Bacteria | 1049 |
| 608 | Ga0496112_0818046 | 3300048915 | Bacteria | 856 |
| 609 | Ga0496112_1102233 | 3300048915 | Bacteria | 712 |
| 610 | Ga0496112_1638728 | 3300048915 | Bacteria | 556 |
| 611 | Ga0496112_1692982 | 3300048915 | Bacteria | 545 |
| 612 | Ga0496113_0026347 | 3300048916 | Bacteria | 4156 |
| 613 | Ga0496113_0071185 | 3300048916 | Bacteria | 2645 |
| 614 | Ga0496113_0324999 | 3300048916 | Bacteria | 1233 |
| 615 | Ga0496113_0359706 | 3300048916 | Bacteria | 1168 |
| 616 | Ga0496114_0002457 | 3300048917 | Bacteria | 14154 |
| 617 | Ga0496114_0008736 | 3300048917 | Bacteria | 8027 |
| 618 | Ga0496114_0229566 | 3300048917 | Bacteria | 1630 |
| 619 | Ga0496114_0258633 | 3300048917 | Bacteria | 1532 |
| 620 | Ga0496114_0282877 | 3300048917 | Bacteria | 1462 |
| 621 | Ga0496114_0618246 | 3300048917 | Unclassified | 954 |
| 622 | Ga0496114_0685957 | 3300048917 | Bacteria | 899 |
| 623 | Ga0496115_0005151 | 3300048918 | Bacteria | 9511 |
| 624 | Ga0496115_0108794 | 3300048918 | Bacteria | 2276 |
| 625 | Ga0496115_0224670 | 3300048918 | Bacteria | 1549 |
| 626 | Ga0501031_0344451 | 3300049568 | Bacteria | 965 |
| 627 | Ga0501032_0242821 | 3300049569 | Bacteria | 1170 |
| 628 | Ga0501033_1052515 | 3300049570 | Bacteria | 542 |
| 629 | Ga0501034_0321166 | 3300049571 | Bacteria | 1481 |
| 630 | Ga0501036_0356252 | 3300049572 | Bacteria | 1222 |
| 631 | Ga0501036_0547212 | 3300049572 | Bacteria | 962 |
| 632 | Ga0501036_1398409 | 3300049572 | Bacteria | 567 |
| 633 | Ga0501039_0941766 | 3300049575 | Bacteria | 672 |
| 634 | Ga0501039_1042575 | 3300049575 | Bacteria | 635 |
| 635 | Ga0501039_1249633 | 3300049575 | Bacteria | 574 |
| 636 | Ga0501040_0131703 | 3300049576 | Bacteria | 1759 |
| 637 | Ga0501041_0214980 | 3300049577 | Bacteria | 1206 |
| 638 | Ga0501041_0562229 | 3300049577 | Bacteria | 727 |
| 639 | Ga0501046_0848257 | 3300049580 | Bacteria | 639 |
| 640 | Ga0501047_0061170 | 3300049581 | Bacteria | 3634 |
| 641 | Ga0501047_0219398 | 3300049581 | Bacteria | 1758 |
| 642 | Ga0501047_0696142 | 3300049581 | Bacteria | 834 |
| 643 | Ga0501048_0242298 | 3300049582 | Bacteria | 1280 |
| 644 | Ga0501048_1066701 | 3300049582 | Bacteria | 581 |
| 645 | Ga0501048_1373482 | 3300049582 | Bacteria | 508 |
| 646 | Ga0501067_0000163 | 3300049583 | Bacteria | 37467 |
| 647 | Ga0501067_0080425 | 3300049583 | Unclassified | 1806 |
| 648 | Ga0501068_0082316 | 3300049584 | Bacteria | 1977 |
| 649 | Ga0501069_0003809 | 3300049585 | Bacteria | 7759 |
| 650 | Ga0501069_0129026 | 3300049585 | Unclassified | 1447 |
| 651 | Ga0501069_0325813 | 3300049585 | Bacteria | 903 |
| 652 | Ga0501069_0647349 | 3300049585 | Bacteria | 636 |
| 653 | Ga0501070_0003032 | 3300049586 | Bacteria | 14629 |
| 654 | Ga0501070_0067716 | 3300049586 | Bacteria | 2957 |
| 655 | Ga0501070_0310143 | 3300049586 | Bacteria | 1284 |
| 656 | Ga0501070_0323861 | 3300049586 | Bacteria | 1253 |
| 657 | Ga0501070_0396149 | 3300049586 | Bacteria | 1117 |
| 658 | Ga0501070_0883218 | 3300049586 | Unclassified | 698 |
| 659 | Ga0501071_0128485 | 3300049587 | Bacteria | 1882 |
| 660 | Ga0501071_0268424 | 3300049587 | Bacteria | 1290 |
| 661 | Ga0501072_0307219 | 3300049588 | Bacteria | 1261 |
| 662 | Ga0501072_0391156 | 3300049588 | Bacteria | 1103 |
| 663 | Ga0501073_0739985 | 3300049589 | Bacteria | 678 |
| 664 | Ga0501073_1126670 | 3300049589 | Bacteria | 539 |
| 665 | Ga0501074_0012591 | 3300049590 | Bacteria | 6149 |
| 666 | Ga0501074_0200257 | 3300049590 | Bacteria | 1423 |
| 667 | Ga0501075_0179876 | 3300049591 | Bacteria | 1614 |
| 668 | Ga0501075_0185043 | 3300049591 | Bacteria | 1589 |
| 669 | Ga0501075_0190546 | 3300049591 | Bacteria | 1564 |
| 670 | Ga0501075_0595823 | 3300049591 | Bacteria | 843 |
| 671 | Ga0501075_1475497 | 3300049591 | Unclassified | 515 |
| 672 | Ga0501076_0636894 | 3300049592 | Bacteria | 880 |
| 673 | Ga0501076_1797433 | 3300049592 | Bacteria | 502 |
| 674 | Ga0501077_0057161 | 3300049593 | Bacteria | 2477 |
| 675 | Ga0501077_0261169 | 3300049593 | Bacteria | 1101 |
| 676 | Ga0501077_0373892 | 3300049593 | Bacteria | 910 |
| 677 | Ga0501257_217013 | 3300049686 | Unclassified | 556 |
| 678 | Ga0501079_0178201 | 3300049741 | Bacteria | 1658 |
| 679 | Ga0501079_0386254 | 3300049741 | Bacteria | 1098 |
| 680 | Ga0501079_0918928 | 3300049741 | Bacteria | 689 |
| 681 | Ga0501079_1580998 | 3300049741 | Unclassified | 516 |
| 682 | Ga0501080_0186373 | 3300049742 | Bacteria | 1908 |
| 683 | Ga0501080_0248406 | 3300049742 | Bacteria | 1622 |
| 684 | Ga0501080_0261699 | 3300049742 | Unclassified | 1576 |
| 685 | Ga0501080_0497086 | 3300049742 | Bacteria | 1090 |
| 686 | Ga0501081_0147649 | 3300049743 | Bacteria | 1688 |
| 687 | Ga0501081_0332671 | 3300049743 | Unclassified | 1118 |
| 688 | Ga0501081_0903815 | 3300049743 | Bacteria | 666 |
| 689 | Ga0501081_1177611 | 3300049743 | Bacteria | 580 |
| 690 | Ga0501083_0217934 | 3300049744 | Bacteria | 1244 |
| 691 | Ga0501275_079780 | 3300049772 | Unclassified | 529 |
| 692 | Ga0501044_0588971 | 3300049823 | Unclassified | 1006 |
| 693 | nmdc:mga05p37_1933563_c1 | 3300050507 | Bacteria | 562 |
| 694 | nmdc:mga0n895_892_c1 | 3300050512 | Bacteria | 21498 |
| 695 | nmdc:mga0rr50_11460_c1 | 3300050513 | Bacteria | 5678 |
| 696 | nmdc:mga0rr50_1340870_c1 | 3300050513 | Bacteria | 606 |
| 697 | nmdc:mga0rr50_1766530_c1 | 3300050513 | Unclassified | 521 |
| 698 | nmdc:mga0rr50_442247_c1 | 3300050513 | Bacteria | 1101 |
| 699 | nmdc:mga08x19_292384_c1 | 3300050514 | Bacteria | 1130 |
| 700 | nmdc:mga08x19_633109_c1 | 3300050514 | Bacteria | 758 |
| 701 | nmdc:mga08x19_784147_c1 | 3300050514 | Bacteria | 677 |
| 702 | nmdc:mga0a205_249680_c1 | 3300050515 | Bacteria | 1654 |
| 703 | nmdc:mga0a205_28719_c1 | 3300050515 | Bacteria | 5319 |
| 704 | Ga0495612_0120485 | 3300053078 | Unclassified | 1128 |
| 705 | Ga0495612_0180125 | 3300053078 | Bacteria | 928 |
| 706 | Ga0495595_0403410 | 3300053084 | Bacteria | 693 |
| 707 | Ga0501084_0373600 | 3300054114 | Bacteria | 1205 |
| 708 | Ga0501084_0444499 | 3300054114 | Bacteria | 1096 |
| 709 | Ga0501084_0647747 | 3300054114 | Bacteria | 892 |
| 710 | Ga0587070_168066 | 3300059491 | Bacteria | 562 |
| 711 | Ga0587073_0203421 | 3300059492 | Bacteria | 595 |
| 712 | Ga0587083_0217381 | 3300059505 | Bacteria | 554 |
| 713 | Ga0587083_0244555 | 3300059505 | Bacteria | 532 |
| 714 | Ga0587115_082845 | 3300059626 | Bacteria | 571 |
| 715 | Ga0587115_115216 | 3300059626 | Bacteria | 512 |
| 716 | Ga0587075_003998 | 3300059644 | Bacteria | 1687 |
| 717 | Ga0501082_0116044 | 3300060353 | Bacteria | 2319 |
| 718 | Ga0501082_1798094 | 3300060353 | Bacteria | 534 |
| 719 | Ga0466962_0014187 | 3300061719 | Bacteria | 3838 |
| 720 | Ga0466962_0023570 | 3300061719 | Bacteria | 2958 |
| 721 | Ga0530510_0314571 | 3300061734 | Bacteria | 1173 |
| 722 | Ga0530510_0952596 | 3300061734 | Bacteria | 656 |
| 723 | Ga0530510_0970792 | 3300061734 | Bacteria | 650 |
| 724 | Ga0070708_100065381 | |||
| 725 | Ga0070658_11212884 | |||
| 726 | Ga0070683_100226322 | |||
| 727 | Ga0070690_100069365 | |||
| 728 | Ga0070690_100166404 | |||
| 729 | Ga0068869_100130555 | |||
| 730 | Ga0070680_100038117 | |||
| 731 | Ga0070680_101738745 | |||
| 732 | Ga0070680_101901709 | |||
| 733 | Ga0070682_100012408 | |||
| 734 | Ga0068868_100061984 | |||
| 735 | Ga0068868_100476343 | |||
| 736 | Ga0070660_100007596 | |||
| 737 | Ga0070660_100021467 | |||
| 738 | Ga0070660_100135957 | |||
| 739 | Ga0070660_100351431 | |||
| 740 | Ga0070689_100075774 | |||
| 741 | Ga0070661_100060787 | |||
| 742 | Ga0070661_100112887 | |||
| 743 | Ga0070692_10009738 | |||
| 744 | Ga0070671_100879510 | |||
| 745 | Ga0070674_100182410 | |||
| 746 | Ga0070674_100272683 | |||
| 747 | Ga0070673_101009370 | |||
| 748 | Ga0070688_100051117 | |||
| 749 | Ga0070659_100035598 | |||
| 750 | Ga0070659_100158972 | |||
| 751 | Ga0070659_100345434 | |||
| 752 | Ga0070667_100055300 | |||
| 753 | Ga0070667_100514446 | |||
| 754 | Ga0070667_101237269 | |||
| 755 | Ga0070714_100265556 | |||
| 756 | Ga0070714_100546286 | |||
| 757 | Ga0070713_100200477 | |||
| 758 | Ga0070701_10174934 | |||
| 759 | Ga0070711_100042752 | |||
| 760 | Ga0070711_101576723 | |||
| 761 | Ga0070705_100095823 | |||
| 762 | Ga0070705_100121261 | |||
| 763 | Ga0070705_100863960 | |||
| 764 | Ga0070700_100249364 | |||
| 765 | Ga0070694_100055019 | |||
| 766 | Ga0070708_100042687 | |||
| 767 | Ga0070708_100094407 | |||
| 768 | Ga0070708_101033397 | |||
| 769 | Ga0070663_100640697 | |||
| 770 | Ga0070663_100733596 | |||
| 771 | Ga0070678_100008202 | |||
| 772 | Ga0070678_101938165 | |||
| 773 | Ga0070681_10001955 | |||
| 774 | Ga0070681_10510298 | |||
| 775 | Ga0068867_100080687 | |||
| 776 | Ga0070685_10335328 | |||
| 777 | Ga0070685_10380813 | |||
| 778 | Ga0070706_100004684 | |||
| 779 | Ga0070706_100211206 | |||
| 780 | Ga0070706_100686813 | |||
| 781 | Ga0070706_100732961 | |||
| 782 | Ga0070707_100004513 | |||
| 783 | Ga0070707_100273104 | |||
| 784 | Ga0070707_100457585 | |||
| 785 | Ga0070707_100672696 | |||
| 786 | Ga0070698_100056452 | |||
| 787 | Ga0070698_100753766 | |||
| 788 | Ga0070699_100181915 | |||
| 789 | Ga0070699_100471394 | |||
| 790 | Ga0070679_100057784 | |||
| 791 | Ga0070679_100135234 | |||
| 792 | Ga0070679_100171278 | |||
| 793 | Ga0070679_100322341 | |||
| 794 | Ga0070684_100030942 | |||
| 795 | Ga0070684_100061807 | |||
| 796 | Ga0070684_100101616 | |||
| 797 | Ga0070684_100132648 | |||
| 798 | Ga0070684_100902244 | |||
| 799 | Ga0070697_100438854 | |||
| 800 | Ga0070697_100672856 | |||
| 801 | Ga0068853_100052906 | |||
| 802 | Ga0068853_102170324 | |||
| 803 | Ga0070686_100053965 | |||
| 804 | Ga0070695_100529849 | |||
| 805 | Ga0070696_100041484 | |||
| 806 | Ga0070696_100096200 | |||
| 807 | Ga0070696_101897979 | |||
| 808 | Ga0070693_100005617 | |||
| 809 | Ga0070693_100206652 | |||
| 810 | Ga0070665_100314565 | |||
| 811 | Ga0070665_100804462 | |||
| 812 | Ga0070704_100488166 | |||
| 813 | Ga0070704_100553092 | |||
| 814 | Ga0068855_100023960 | |||
| 815 | Ga0068855_100555096 | |||
| 816 | Ga0068855_100637854 | |||
| 817 | Ga0070664_100179626 | |||
| 818 | Ga0070664_100441521 | |||
| 819 | Ga0068857_100011172 | |||
| 820 | Ga0068857_100327735 | |||
| 821 | Ga0068857_100364879 | |||
| 822 | Ga0068854_100200137 | |||
| 823 | Ga0068854_100825568 | |||
| 824 | Ga0068854_100995211 | |||
| 825 | Ga0068854_101037664 | |||
| 826 | Ga0068856_100091442 | |||
| 827 | Ga0068856_100216927 | |||
| 828 | Ga0068856_101554709 | |||
| 829 | Ga0068856_102206004 | |||
| 830 | Ga0070702_100033934 | |||
| 831 | Ga0070702_100060507 | |||
| 832 | Ga0068852_100085601 | |||
| 833 | Ga0068852_100186384 | |||
| 834 | Ga0068852_100232811 | |||
| 835 | Ga0068859_101418953 | |||
| 836 | Ga0068864_101298219 | |||
| 837 | Ga0068866_10088089 | |||
| 838 | Ga0068866_10488061 | |||
| 839 | Ga0068870_10801653 | |||
| 840 | Ga0068858_100016243 | |||
| 841 | Ga0068858_100031994 | |||
| 842 | Ga0068858_102458821 | |||
| 843 | Ga0068860_100020071 | |||
| 844 | Ga0070717_10285063 | |||
| 845 | Ga0070715_10014322 | |||
| 846 | Ga0070715_10256955 | |||
| 847 | Ga0070716_100572563 | |||
| 848 | Ga0070712_100037595 | |||
| 849 | Ga0097621_100010903 | |||
| 850 | Ga0097621_100130048 | |||
| 851 | Ga0097621_102205234 | |||
| 852 | Ga0068871_100052258 | |||
| 853 | Ga0068871_100127541 | |||
| 854 | Ga0068871_101182205 | |||
| 855 | Ga0075433_10077960 | |||
| 856 | Ga0075434_100052014 | |||
| 857 | Ga0068865_100014192 | |||
| 858 | Ga0068865_100234368 | |||
| 859 | Ga0075436_100171437 | |||
| 860 | Ga0075436_100861195 | |||
| 861 | Ga0097620_101418885 | |||
| 862 | Ga0075435_100194889 | |||
| 863 | Ga0105240_11517974 | |||
| 864 | Ga0105240_11572672 | |||
| 865 | Ga0105240_12229884 | |||
| 866 | Ga0111539_10814118 | |||
| 867 | Ga0105245_10015320 | |||
| 868 | Ga0105245_10224157 | |||
| 869 | Ga0105245_10349933 | |||
| 870 | Ga0105245_10936573 | |||
| 871 | Ga0105247_10052990 | |||
| 872 | Ga0105247_10304565 | |||
| 873 | Ga0105243_10047355 | |||
| 874 | Ga0105243_10267127 | |||
| 875 | Ga0105243_10658793 | |||
| 876 | Ga0105243_11227939 | |||
| 877 | Ga0105241_10060149 | |||
| 878 | Ga0105241_10084415 | |||
| 879 | Ga0105241_10833959 | |||
| 880 | Ga0105242_10132083 | |||
| 881 | Ga0105242_10139756 | |||
| 882 | Ga0105242_10531565 | |||
| 883 | Ga0105242_11804535 | |||
| 884 | Ga0105248_10291615 | |||
| 885 | Ga0105248_10392689 | |||
| 886 | Ga0105237_10091107 | |||
| 887 | Ga0105237_10202129 | |||
| 888 | Ga0105237_10250546 | |||
| 889 | Ga0105237_11083411 | |||
| 890 | Ga0105238_10031640 | |||
| 891 | Ga0105238_10043373 | |||
| 892 | Ga0105238_10082150 | |||
| 893 | Ga0105238_10822677 | |||
| 894 | Ga0105249_10197315 | |||
| 895 | Ga0105249_11694934 | |||
| 896 | Ga0105249_13550048 | |||
| 897 | Ga0105239_10021168 | |||
| 898 | Ga0105239_10064989 | |||
| 899 | Ga0105239_13164434 | |||
| 900 | Ga0105246_10095445 | |||
| 901 | Ga0105246_11270223 | |||
| 902 | Ga0105246_12551739 | |||
| 903 | Ga0157337_1026718 | |||
| 904 | Ga0157373_10055667 | |||
| 905 | Ga0157371_10131658 | |||
| 906 | Ga0157370_10026787 | |||
| 907 | Ga0157370_10132385 | |||
| 908 | Ga0157370_10192255 | |||
| 909 | Ga0157370_10273348 | |||
| 910 | Ga0157369_10030091 | |||
| 911 | Ga0157369_10040930 | |||
| 912 | Ga0157369_10104213 | |||
| 913 | Ga0157369_10408792 | |||
| 914 | Ga0157374_10021270 | |||
| 915 | Ga0157374_10028775 | |||
| 916 | Ga0157374_10170871 | |||
| 917 | Ga0157374_11557326 | |||
| 918 | Ga0157378_10028470 | |||
| 919 | Ga0157378_10069193 | |||
| 920 | Ga0157378_12674430 | |||
| 921 | Ga0157372_10006332 | |||
| 922 | Ga0157372_10051234 | |||
| 923 | Ga0157372_10083881 | |||
| 924 | Ga0157372_10185482 | |||
| 925 | Ga0157372_12829193 | |||
| 926 | Ga0157375_10541034 | |||
| 927 | Ga0157375_11423138 | |||
| 928 | Ga0157375_11945663 | |||
| 929 | Ga0163163_10488975 | |||
| 930 | Ga0163163_11318267 | |||
| 931 | Ga0157380_10426993 | |||
| 932 | Ga0157380_12597902 | |||
| 933 | Ga0157380_12794223 | |||
| 934 | Ga0182008_10125663 | |||
| 935 | Ga0182008_10548333 | |||
| 936 | Ga0157379_10133885 | |||
| 937 | Ga0157376_10229361 | |||
| 938 | Ga0157376_10322620 | |||
| 939 | Ga0157376_10597358 | |||
| 940 | Ga0157376_11149807 | |||
| 941 | Ga0157376_12100000 | |||
| 942 | Ga0182006_1122101 | |||
| 943 | Ga0182007_10098967 | |||
| 944 | Ga0163161_10201118 | |||
| 945 | Ga0163161_10505719 | |||
| 946 | Ga0163161_11440430 | |||
| 947 | Ga0197907_10913843 | |||
| 948 | Ga0197907_11110821 | |||
| 949 | Ga0206356_10103907 | |||
| 950 | Ga0206356_10503281 | |||
| 951 | Ga0206356_10596004 | |||
| 952 | Ga0206356_11115077 | |||
| 953 | Ga0206356_11478649 | |||
| 954 | Ga0206355_1251211 | |||
| 955 | Ga0206355_1287509 | |||
| 956 | Ga0206350_10489792 | |||
| 957 | Ga0206354_10295194 | |||
| 958 | Ga0206354_10412236 | |||
| 959 | Ga0206354_10669380 | |||
| 960 | Ga0206353_11387566 | |||
| 961 | Ga0206353_11491132 | |||
| 962 | Ga0206353_11727024 | |||
| 963 | Ga0154015_1029663 | |||
| 964 | Ga0154015_1459760 | |||
| 965 | Ga0213874_10071190 | |||
| 966 | Ga0213876_10177042 | |||
| 967 | Ga0224712_10006171 | |||
| 968 | Ga0224712_10135788 | |||
| 969 | Ga0224712_10175531 | |||
| 970 | Ga0207642_10519908 | |||
| 971 | Ga0207710_10164818 | |||
| 972 | Ga0207710_10168932 | |||
| 973 | Ga0207688_10056833 | |||
| 974 | Ga0207680_10213416 | |||
| 975 | Ga0207647_10291542 | |||
| 976 | Ga0207647_10531479 | |||
| 977 | Ga0207685_10011554 | |||
| 978 | Ga0207685_10155657 | |||
| 979 | Ga0207643_10356051 | |||
| 980 | Ga0207705_10051988 | |||
| 981 | Ga0207684_10004965 | |||
| 982 | Ga0207684_10264467 | |||
| 983 | Ga0207684_10955404 | |||
| 984 | Ga0207654_10116834 | |||
| 985 | Ga0207654_10171698 | |||
| 986 | Ga0207654_10238293 | |||
| 987 | Ga0207654_10383394 | |||
| 988 | Ga0207654_10662506 | |||
| 989 | Ga0207707_10006792 | |||
| 990 | Ga0207707_10008124 | |||
| 991 | Ga0207695_10811588 | |||
| 992 | Ga0207671_10282570 | |||
| 993 | Ga0207671_10414442 | |||
| 994 | Ga0207671_11368290 | |||
| 995 | Ga0207693_10071680 | |||
| 996 | Ga0207663_10066038 | |||
| 997 | Ga0207663_10386863 | |||
| 998 | Ga0207660_10214069 | |||
| 999 | Ga0207660_10381928 | |||
| 1000 | Ga0207657_10004765 | |||
| 1001 | Ga0207657_10016023 | |||
| 1002 | Ga0207657_10196543 | |||
| 1003 | Ga0207649_10021258 | |||
| 1004 | Ga0207649_10081017 | |||
| 1005 | Ga0207649_10218566 | |||
| 1006 | Ga0207652_10027233 | |||
| 1007 | Ga0207652_10100346 | |||
| 1008 | Ga0207652_10442742 | |||
| 1009 | Ga0207652_11156007 | |||
| 1010 | Ga0207646_10042572 | |||
| 1011 | Ga0207646_10182184 | |||
| 1012 | Ga0207646_10347464 | |||
| 1013 | Ga0207646_10519811 | |||
| 1014 | Ga0207694_10022612 | |||
| 1015 | Ga0207694_10255449 | |||
| 1016 | Ga0207687_10033171 | |||
| 1017 | Ga0207687_10087942 | |||
| 1018 | Ga0207687_10238094 | |||
| 1019 | Ga0207687_10456349 | |||
| 1020 | Ga0207687_10620651 | |||
| 1021 | Ga0207664_10510534 | |||
| 1022 | Ga0207644_10802325 | |||
| 1023 | Ga0207690_10098751 | |||
| 1024 | Ga0207690_10113010 | |||
| 1025 | Ga0207690_10375101 | |||
| 1026 | Ga0207706_10266441 | |||
| 1027 | Ga0207686_10027445 | |||
| 1028 | Ga0207686_10047765 | |||
| 1029 | Ga0207686_11763859 | |||
| 1030 | Ga0207709_10017610 | |||
| 1031 | Ga0207709_10167895 | |||
| 1032 | Ga0207709_10712520 | |||
| 1033 | Ga0207709_10991680 | |||
| 1034 | Ga0207669_10040730 | |||
| 1035 | Ga0207704_10202833 | |||
| 1036 | Ga0207704_10230971 | |||
| 1037 | Ga0207704_10331760 | |||
| 1038 | Ga0207665_10138286 | |||
| 1039 | Ga0207711_10142535 | |||
| 1040 | Ga0207661_10372072 | |||
| 1041 | Ga0207661_10966109 | |||
| 1042 | Ga0207661_11537705 | |||
| 1043 | Ga0207661_11693779 | |||
| 1044 | Ga0207679_10234865 | |||
| 1045 | Ga0207667_10205237 | |||
| 1046 | Ga0207667_10310643 | |||
| 1047 | Ga0207667_10344476 | |||
| 1048 | Ga0207667_10962024 | |||
| 1049 | Ga0207651_10781922 | |||
| 1050 | Ga0207651_10988283 | |||
| 1051 | Ga0207712_10926934 | |||
| 1052 | Ga0207640_10038906 | |||
| 1053 | Ga0207640_10705480 | |||
| 1054 | Ga0207640_11349502 | |||
| 1055 | Ga0207640_11636438 | |||
| 1056 | Ga0207658_10105364 | |||
| 1057 | Ga0207658_11822664 | |||
| 1058 | Ga0207677_11279497 | |||
| 1059 | Ga0207703_10264621 | |||
| 1060 | Ga0207703_10411685 | |||
| 1061 | Ga0207639_10159484 | |||
| 1062 | Ga0207639_11992275 | |||
| 1063 | Ga0207639_12289086 | |||
| 1064 | Ga0207678_10097724 | |||
| 1065 | Ga0207678_10261429 | |||
| 1066 | Ga0207678_10523298 | |||
| 1067 | Ga0207708_10004026 | |||
| 1068 | Ga0207708_10687931 | |||
| 1069 | Ga0207702_10107003 | |||
| 1070 | Ga0207702_10279314 | |||
| 1071 | Ga0207702_10373709 | |||
| 1072 | Ga0207702_10763958 | |||
| 1073 | Ga0207648_10129610 | |||
| 1074 | Ga0207648_11997922 | |||
| 1075 | Ga0207676_11131269 | |||
| 1076 | Ga0207674_10034277 | |||
| 1077 | Ga0207674_10446681 | |||
| 1078 | Ga0207683_10000876 | |||
| 1079 | Ga0207698_10036602 | |||
| 1080 | Ga0207698_10402650 | |||
| 1081 | Ga0207698_10656217 | |||
| 1082 | Ga0207698_11419273 | |||
| 1083 | Ga0207698_11754108 | |||
| 1084 | Ga0268266_10080384 | |||
| 1085 | Ga0268266_10223952 | |||
| 1086 | Ga0268264_10050649 | |||
| 1087 | Ga0265319_1028375 | |||
| 1088 | Ga0265319_1054231 | |||
| 1089 | Ga0265334_10285742 | |||
| 1090 | Ga0265318_10173648 | |||
| 1091 | Ga0265338_10327795 | |||
| 1092 | Ga0265338_10881946 | |||
| 1093 | Ga0265320_10009779 | |||
| 1094 | Ga0265320_10016252 | |||
| 1095 | Ga0265327_10057127 | |||
| 1096 | Ga0307416_100415878 | |||
| 1097 | Ga0373944_0024448 | |||
| 1098 | Ga0373944_0126481 | |||
| 1099 | Ga0373936_0016183 | |||
| 1100 | Ga0373945_0003861 | |||
| 1101 | Ga0373943_0008082 | |||
| 1102 | Ga0373943_0544967 | |||
| 1103 | Ga0373943_0799242 | |||
| 1104 | Ga0373946_0529395 | |||
| 1105 | Ga0373931_0381312 | |||
| 1106 | Ga0373935_0094404 | |||
| 1107 | Ga0373935_1281963 | |||
| 1108 | Ga0373927_0223428 | |||
| 1109 | Ga0373947_0000590 | |||
| 1110 | Ga0373947_0326136 | |||
| 1111 | Ga0373925_0025998 | |||
| 1112 | Ga0373925_0446395 | |||
| 1113 | Ga0373925_0498867 | |||
| 1114 | Ga0373925_1403180 | |||
| 1115 | Ga0395899_0055703 | |||
| 1116 | Ga0395899_0180397 | |||
| 1117 | Ga0395899_0299345 | |||
| 1118 | Ga0395899_0368691 | |||
| 1119 | Ga0395899_0921280 | |||
| 1120 | Ga0395900_0015152 | |||
| 1121 | Ga0395900_0406131 | |||
| 1122 | Ga0395900_0468924 | |||
| 1123 | Ga0395900_0474315 | |||
| 1124 | Ga0395900_1823630 | |||
| 1125 | Ga0395898_0038285 | |||
| 1126 | Ga0395898_0077907 | |||
| 1127 | Ga0395898_0211411 | |||
| 1128 | Ga0395898_0616880 | |||
| 1129 | Ga0395898_1071953 | |||
| 1130 | Ga0395898_1854759 | |||
| 1131 | Ga0395905_0444462 | |||
| 1132 | Ga0395905_0741391 | |||
| 1133 | Ga0395905_0845780 | |||
| 1134 | Ga0395905_1331165 | |||
| 1135 | Ga0395901_0079715 | |||
| 1136 | Ga0395901_0126642 | |||
| 1137 | Ga0395901_0128336 | |||
| 1138 | Ga0395901_0735536 | |||
| 1139 | Ga0395901_0897983 | |||
| 1140 | Ga0436365_0489299 | |||
| 1141 | Ga0436365_0894153 | |||
| 1142 | Ga0436365_1695513 | |||
| 1143 | Ga0436365_1738713 | |||
| 1144 | Ga0436363_1518906 | |||
| 1145 | Ga0451839_0323294 | |||
| 1146 | Ga0451853_1552171 | |||
| 1147 | Ga0439448_0044150 | |||
| 1148 | Ga0450920_006037 | |||
| 1149 | Ga0450907_096719 | |||
| 1150 | Ga0439459_0155262 | |||
| 1151 | Ga0450918_032812 | |||
| 1152 | Ga0466972_0283130 | |||
| 1153 | Ga0466972_0290705 | |||
| 1154 | Ga0466965_0407738 | |||
| 1155 | Ga0466966_0002834 | |||
| 1156 | Ga0466966_0108652 | |||
| 1157 | Ga0466966_0280549 | |||
| 1158 | Ga0466961_0011148 | |||
| 1159 | Ga0466961_0040813 | |||
| 1160 | Ga0466961_0142256 | |||
| 1161 | Ga0466961_0904722 | |||
| 1162 | Ga0466963_0000037 | |||
| 1163 | Ga0466963_0012580 | |||
| 1164 | Ga0466963_0019970 | |||
| 1165 | Ga0466963_0025907 | |||
| 1166 | Ga0466963_0039167 | |||
| 1167 | Ga0466963_0107955 | |||
| 1168 | Ga0466963_0434860 | |||
| 1169 | Ga0466964_0016749 | |||
| 1170 | Ga0466964_0025011 | |||
| 1171 | Ga0466964_0148086 | |||
| 1172 | Ga0466964_0175895 | |||
| 1173 | Ga0466964_0186342 | |||
| 1174 | Ga0466964_0835282 | |||
| 1175 | Ga0466971_0150491 | |||
| 1176 | Ga0466971_0356469 | |||
| 1177 | Ga0466971_0474972 | |||
| 1178 | Ga0466968_0015622 | |||
| 1179 | Ga0466968_0653972 | |||
| 1180 | Ga0466970_0189969 | |||
| 1181 | Ga0466970_0223888 | |||
| 1182 | Ga0466957_0106615 | |||
| 1183 | Ga0466957_0340807 | |||
| 1184 | Ga0466957_0487690 | |||
| 1185 | Ga0466957_0562358 | |||
| 1186 | Ga0466960_0756336 | |||
| 1187 | Ga0466959_0009015 | |||
| 1188 | Ga0466959_0101180 | |||
| 1189 | Ga0466959_0199798 | |||
| 1190 | Ga0466959_0286203 | |||
| 1191 | Ga0466959_0722936 | |||
| 1192 | Ga0466958_0062153 | |||
| 1193 | Ga0466958_0179435 | |||
| 1194 | Ga0466958_0650196 | |||
| 1195 | Ga0466967_0005846 | |||
| 1196 | Ga0466967_0006284 | |||
| 1197 | Ga0466967_0018080 | |||
| 1198 | Ga0466967_0048083 | |||
| 1199 | Ga0466967_0075125 | |||
| 1200 | Ga0466967_0088756 | |||
| 1201 | Ga0466967_0112904 | |||
| 1202 | Ga0466967_0114331 | |||
| 1203 | Ga0466967_0114427 | |||
| 1204 | Ga0466967_0178941 | |||
| 1205 | Ga0466967_0215476 | |||
| 1206 | Ga0466967_0387149 | |||
| 1207 | Ga0466967_0490601 | |||
| 1208 | Ga0466967_0529334 | |||
| 1209 | Ga0466967_0558042 | |||
| 1210 | Ga0466967_0610262 | |||
| 1211 | Ga0466967_0625919 | |||
| 1212 | Ga0466967_0631097 | |||
| 1213 | Ga0466967_0733273 | |||
| 1214 | Ga0466967_0790312 | |||
| 1215 | Ga0466967_0849445 | |||
| 1216 | Ga0466967_0947326 | |||
| 1217 | Ga0466967_0974087 | |||
| 1218 | Ga0466967_1128168 | |||
| 1219 | Ga0495603_0097150 | |||
| 1220 | Ga0495603_0187160 | |||
| 1221 | Ga0495603_0189117 | |||
| 1222 | Ga0495641_0024564 | |||
| 1223 | Ga0495641_0114789 | |||
| 1224 | Ga0495641_0118566 | |||
| 1225 | Ga0495653_0223428 | |||
| 1226 | Ga0495580_0201644 | |||
| 1227 | Ga0495582_0042237 | |||
| 1228 | Ga0495582_0125183 | |||
| 1229 | Ga0495582_0170654 | |||
| 1230 | Ga0495582_0237450 | |||
| 1231 | Ga0495639_0244442 | |||
| 1232 | Ga0495639_0421677 | |||
| 1233 | Ga0495584_0646709 | |||
| 1234 | Ga0495594_0153577 | |||
| 1235 | Ga0495608_0216221 | |||
| 1236 | Ga0495630_0143360 | |||
| 1237 | Ga0495630_0160665 | |||
| 1238 | Ga0495630_0202847 | |||
| 1239 | Ga0495630_1081795 | |||
| 1240 | Ga0495640_0256980 | |||
| 1241 | Ga0495586_0006168 | |||
| 1242 | Ga0495586_0121463 | |||
| 1243 | Ga0495587_0110294 | |||
| 1244 | Ga0495587_0216860 | |||
| 1245 | Ga0495667_0376677 | |||
| 1246 | Ga0495656_0673042 | |||
| 1247 | Ga0495634_0117263 | |||
| 1248 | Ga0495634_0489784 | |||
| 1249 | Ga0495588_0066979 | |||
| 1250 | Ga0495646_0507906 | |||
| 1251 | Ga0495647_0075764 | |||
| 1252 | Ga0495658_0030986 | |||
| 1253 | Ga0495658_0273735 | |||
| 1254 | Ga0495670_0836024 | |||
| 1255 | Ga0495649_0423914 | |||
| 1256 | Ga0495581_0751410 | |||
| 1257 | Ga0495604_0774357 | |||
| 1258 | Ga0495674_0126270 | |||
| 1259 | Ga0495674_0237914 | |||
| 1260 | Ga0495674_0359859 | |||
| 1261 | Ga0495676_0154000 | |||
| 1262 | Ga0495676_0329227 | |||
| 1263 | Ga0495676_0700229 | |||
| 1264 | Ga0495680_0864477 | |||
| 1265 | Ga0495593_0072214 | |||
| 1266 | Ga0496100_0017728 | |||
| 1267 | Ga0496100_0028950 | |||
| 1268 | Ga0496100_0030673 | |||
| 1269 | Ga0496100_0566871 | |||
| 1270 | Ga0496100_1020944 | |||
| 1271 | Ga0496101_0000692 | |||
| 1272 | Ga0496101_0049101 | |||
| 1273 | Ga0496101_0140299 | |||
| 1274 | Ga0496101_0152153 | |||
| 1275 | Ga0496101_0746118 | |||
| 1276 | Ga0496102_0005991 | |||
| 1277 | Ga0496102_0053045 | |||
| 1278 | Ga0496102_0335135 | |||
| 1279 | Ga0496102_0960865 | |||
| 1280 | Ga0496103_0011503 | |||
| 1281 | Ga0496103_0196712 | |||
| 1282 | Ga0496103_0199074 | |||
| 1283 | Ga0496103_0449315 | |||
| 1284 | Ga0496104_0002218 | |||
| 1285 | Ga0496104_0011990 | |||
| 1286 | Ga0496104_0038000 | |||
| 1287 | Ga0496104_0303474 | |||
| 1288 | Ga0496104_0447155 | |||
| 1289 | Ga0496104_0813858 | |||
| 1290 | Ga0496105_0002671 | |||
| 1291 | Ga0496105_0014914 | |||
| 1292 | Ga0496105_0025956 | |||
| 1293 | Ga0496106_0003662 | |||
| 1294 | Ga0496106_0003900 | |||
| 1295 | Ga0496106_0026843 | |||
| 1296 | Ga0496106_0047654 | |||
| 1297 | Ga0496106_0372413 | |||
| 1298 | Ga0496107_0016367 | |||
| 1299 | Ga0496107_0102525 | |||
| 1300 | Ga0496107_0222140 | |||
| 1301 | Ga0496107_0263535 | |||
| 1302 | Ga0496107_0343101 | |||
| 1303 | Ga0496107_0358709 | |||
| 1304 | Ga0496107_0950971 | |||
| 1305 | Ga0496108_0006069 | |||
| 1306 | Ga0496108_0057187 | |||
| 1307 | Ga0496108_0180373 | |||
| 1308 | Ga0496108_0275534 | |||
| 1309 | Ga0496108_0451628 | |||
| 1310 | Ga0496108_0640216 | |||
| 1311 | Ga0496108_1472549 | |||
| 1312 | Ga0496109_0002789 | |||
| 1313 | Ga0496109_0022559 | |||
| 1314 | Ga0496109_0024902 | |||
| 1315 | Ga0496109_0165720 | |||
| 1316 | Ga0496109_0264127 | |||
| 1317 | Ga0496109_0997186 | |||
| 1318 | Ga0496110_0004178 | |||
| 1319 | Ga0496110_0066822 | |||
| 1320 | Ga0496111_0010710 | |||
| 1321 | Ga0496111_0033409 | |||
| 1322 | Ga0496111_0150008 | |||
| 1323 | Ga0496111_0179718 | |||
| 1324 | Ga0496111_0284008 | |||
| 1325 | Ga0496111_0921586 | |||
| 1326 | Ga0496112_0198220 | |||
| 1327 | Ga0496112_0298617 | |||
| 1328 | Ga0496112_0329180 | |||
| 1329 | Ga0496112_0446110 | |||
| 1330 | Ga0496112_0584436 | |||
| 1331 | Ga0496112_0818046 | |||
| 1332 | Ga0496112_1102233 | |||
| 1333 | Ga0496112_1638728 | |||
| 1334 | Ga0496112_1692982 | |||
| 1335 | Ga0496113_0026347 | |||
| 1336 | Ga0496113_0071185 | |||
| 1337 | Ga0496113_0324999 | |||
| 1338 | Ga0496113_0359706 | |||
| 1339 | Ga0496114_0002457 | |||
| 1340 | Ga0496114_0008736 | |||
| 1341 | Ga0496114_0229566 | |||
| 1342 | Ga0496114_0258633 | |||
| 1343 | Ga0496114_0282877 | |||
| 1344 | Ga0496114_0618246 | |||
| 1345 | Ga0496114_0685957 | |||
| 1346 | Ga0496115_0005151 | |||
| 1347 | Ga0496115_0108794 | |||
| 1348 | Ga0496115_0224670 | |||
| 1349 | Ga0501031_0344451 | |||
| 1350 | Ga0501032_0242821 | |||
| 1351 | Ga0501033_1052515 | |||
| 1352 | Ga0501034_0321166 | |||
| 1353 | Ga0501036_0356252 | |||
| 1354 | Ga0501036_0547212 | |||
| 1355 | Ga0501036_1398409 | |||
| 1356 | Ga0501039_0941766 | |||
| 1357 | Ga0501039_1042575 | |||
| 1358 | Ga0501039_1249633 | |||
| 1359 | Ga0501040_0131703 | |||
| 1360 | Ga0501041_0214980 | |||
| 1361 | Ga0501041_0562229 | |||
| 1362 | Ga0501046_0848257 | |||
| 1363 | Ga0501047_0061170 | |||
| 1364 | Ga0501047_0219398 | |||
| 1365 | Ga0501047_0696142 | |||
| 1366 | Ga0501048_0242298 | |||
| 1367 | Ga0501048_1066701 | |||
| 1368 | Ga0501048_1373482 | |||
| 1369 | Ga0501067_0000163 | |||
| 1370 | Ga0501067_0080425 | |||
| 1371 | Ga0501068_0082316 | |||
| 1372 | Ga0501069_0003809 | |||
| 1373 | Ga0501069_0129026 | |||
| 1374 | Ga0501069_0325813 | |||
| 1375 | Ga0501069_0647349 | |||
| 1376 | Ga0501070_0003032 | |||
| 1377 | Ga0501070_0067716 | |||
| 1378 | Ga0501070_0310143 | |||
| 1379 | Ga0501070_0323861 | |||
| 1380 | Ga0501070_0396149 | |||
| 1381 | Ga0501070_0883218 | |||
| 1382 | Ga0501071_0128485 | |||
| 1383 | Ga0501071_0268424 | |||
| 1384 | Ga0501072_0307219 | |||
| 1385 | Ga0501072_0391156 | |||
| 1386 | Ga0501073_0739985 | |||
| 1387 | Ga0501073_1126670 | |||
| 1388 | Ga0501074_0012591 | |||
| 1389 | Ga0501074_0200257 | |||
| 1390 | Ga0501075_0179876 | |||
| 1391 | Ga0501075_0185043 | |||
| 1392 | Ga0501075_0190546 | |||
| 1393 | Ga0501075_0595823 | |||
| 1394 | Ga0501075_1475497 | |||
| 1395 | Ga0501076_0636894 | |||
| 1396 | Ga0501076_1797433 | |||
| 1397 | Ga0501077_0057161 | |||
| 1398 | Ga0501077_0261169 | |||
| 1399 | Ga0501077_0373892 | |||
| 1400 | Ga0501257_217013 | |||
| 1401 | Ga0501079_0178201 | |||
| 1402 | Ga0501079_0386254 | |||
| 1403 | Ga0501079_0918928 | |||
| 1404 | Ga0501079_1580998 | |||
| 1405 | Ga0501080_0186373 | |||
| 1406 | Ga0501080_0248406 | |||
| 1407 | Ga0501080_0261699 | |||
| 1408 | Ga0501080_0497086 | |||
| 1409 | Ga0501081_0147649 | |||
| 1410 | Ga0501081_0332671 | |||
| 1411 | Ga0501081_0903815 | |||
| 1412 | Ga0501081_1177611 | |||
| 1413 | Ga0501083_0217934 | |||
| 1414 | Ga0501275_079780 | |||
| 1415 | Ga0501044_0588971 | |||
| 1416 | nmdc:mga05p37_1933563_c1 | |||
| 1417 | nmdc:mga0n895_892_c1 | |||
| 1418 | nmdc:mga0rr50_11460_c1 | |||
| 1419 | nmdc:mga0rr50_1340870_c1 | |||
| 1420 | nmdc:mga0rr50_1766530_c1 | |||
| 1421 | nmdc:mga0rr50_442247_c1 | |||
| 1422 | nmdc:mga08x19_292384_c1 | |||
| 1423 | nmdc:mga08x19_633109_c1 | |||
| 1424 | nmdc:mga08x19_784147_c1 | |||
| 1425 | nmdc:mga0a205_249680_c1 | |||
| 1426 | nmdc:mga0a205_28719_c1 | |||
| 1427 | Ga0495612_0120485 | |||
| 1428 | Ga0495612_0180125 | |||
| 1429 | Ga0495595_0403410 | |||
| 1430 | Ga0501084_0373600 | |||
| 1431 | Ga0501084_0444499 | |||
| 1432 | Ga0501084_0647747 | |||
| 1433 | Ga0587070_168066 | |||
| 1434 | Ga0587073_0203421 | |||
| 1435 | Ga0587083_0217381 | |||
| 1436 | Ga0587083_0244555 | |||
| 1437 | Ga0587115_082845 | |||
| 1438 | Ga0587115_115216 | |||
| 1439 | Ga0587075_003998 | |||
| 1440 | Ga0501082_0116044 | |||
| 1441 | Ga0501082_1798094 | |||
| 1442 | Ga0466962_0014187 | |||
| 1443 | Ga0466962_0023570 | |||
| 1444 | Ga0530510_0314571 | |||
| 1445 | Ga0530510_0952596 | |||
| 1446 | Ga0530510_0970792 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.9327 | 5 | 99 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.9066 | 1 | 97 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.9021 | 2 | 91 |
| 1wcj-assembly1.cif.gz_A | conserved hypothetical protein tm0487 from thermotoga maritima | 0.8892 | 2 | 97 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.8892 | 1 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9722 | 13 | 97 | 3.30.300.130 |
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9403 | 5 | 78 | 3.30.300.130 |
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9295 | 13 | 97 | 3.30.300.130 |
| af_P76080_10_106_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9221 | 2 | 97 | 3.30.300.130 |
| af_Q8II78_18_117_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9204 | 5 | 78 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9JNX4-F1-model_v4 | Metal-sulfur cluster assembly factor | 0.9945 | 1 | 99 |
|
| AF-A0A2E9VW27-F1-model_v4 | Rieske domain-containing protein | 0.9942 | 7 | 97 |
GO:0046872
GO:0051537 |
| AF-A0A7V5A2L2-F1-model_v4 | DUF59 domain-containing protein | 0.9926 | 2 | 97 |
|
| AF-A0A257VM95-F1-model_v4 | Rieske domain-containing protein | 0.9899 | 2 | 99 |
GO:0046872
GO:0051537 |
| AF-A0A7Y5N2I1-F1-model_v4 | DUF59 domain-containing protein | 0.9889 | 1 | 99 |
|