F477475

General Info

Members Datasets Scaffolds Average Seq Length
723 255 1446 252

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100009008|Ga0070675_1000090082
Length 293
Sequence MFSPVEVKLVRSFIYGKGQFRIPVQKERAMSNNLGAAVRVIVTGILIVWAGTGIAQAQWDPYPWKNMPRKADGTVDLTAPTRRTADGKPDLSGFWMPRESVKYLLNLASDMKPADIPFQPWAAELYKERIDNNGKDHPGARCLPSGIPEKNNIPDGLKVVQTPDLLVFLYESRTIYRQVFLDGRSLPMNAQPSWMGYSVGKWEGDTLVIETIGQNGKTWLDMRGLPGTESLKVIERYSRPNIGLINIDVTIDDPKAYTKPWNVKLTWRLVPDTDLIESICEENNKDPAHMVGK

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 17.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100009008 3300005354 Bacteria 7752
2 JGI24746J21847_1003041 3300001977 Bacteria 2635
3 JGI24749J21850_1010117 3300002076 Unclassified 1321
4 JGI24033J26618_1006383 3300002155 Unclassified 1321
5 JGI25406J46586_10002829 3300003203 Bacteria 8169
6 Ga0065712_10068219 3300005290 Bacteria 12808
7 Ga0065712_10119450 3300005290 Bacteria 1691
8 Ga0065712_10138978 3300005290 Bacteria 1469
9 Ga0065712_10281332 3300005290 Unclassified 895
10 Ga0065715_10093423 3300005293 Bacteria 4683
11 Ga0065715_10101812 3300005293 Bacteria 3169
12 Ga0065715_10161659 3300005293 Bacteria 1623
13 Ga0065707_10010359 3300005295 Bacteria 2688
14 Ga0065707_10201496 3300005295 Unclassified 1308
15 Ga0065707_10319167 3300005295 Unclassified 965
16 Ga0070676_10003643 3300005328 Bacteria 8060
17 Ga0070676_10059376 3300005328 Bacteria 2268
18 Ga0070683_100021256 3300005329 Bacteria 5788
19 Ga0070690_100010835 3300005330 Bacteria 5318
20 Ga0070690_100175699 3300005330 Bacteria 1477
21 Ga0070690_100314804 3300005330 Bacteria 1126
22 Ga0070670_100008210 3300005331 Bacteria 8889
23 Ga0070670_100033142 3300005331 Bacteria 4449
24 Ga0070670_100034319 3300005331 Bacteria 4366
25 Ga0070670_100301956 3300005331 Bacteria 1400
26 Ga0070670_100316811 3300005331 Bacteria 1366
27 Ga0070677_10002250 3300005333 Bacteria 6157
28 Ga0070677_10072430 3300005333 Bacteria 1453
29 Ga0070677_10109740 3300005333 Bacteria 1230
30 Ga0070677_10137225 3300005333 Unclassified 1124
31 Ga0068869_100003412 3300005334 Bacteria 9706
32 Ga0068869_100030101 3300005334 Bacteria 3808
33 Ga0068869_100031562 3300005334 Bacteria 3727
34 Ga0068869_100094226 3300005334 Bacteria 2257
35 Ga0068869_100138075 3300005334 Unclassified 1880
36 Ga0068869_100342374 3300005334 Bacteria 1217
37 Ga0070666_10010303 3300005335 Bacteria 5845
38 Ga0070666_10103023 3300005335 Viruses 1969
39 Ga0070666_10105157 3300005335 Bacteria 1949
40 Ga0070666_10322590 3300005335 Bacteria 1102
41 Ga0070680_100067445 3300005336 Bacteria 2935
42 Ga0070680_100369067 3300005336 Bacteria 1221
43 Ga0068868_100032947 3300005338 Bacteria 3990
44 Ga0068868_100574454 3300005338 Unclassified 996
45 Ga0070689_100011313 3300005340 Bacteria 6388
46 Ga0070689_100214499 3300005340 Bacteria 1577
47 Ga0070687_100000834 3300005343 Bacteria 10286
48 Ga0070687_100027280 3300005343 Unclassified 2758
49 Ga0070687_100037161 3300005343 Unclassified 2432
50 Ga0070687_100052559 3300005343 Bacteria 2115
51 Ga0070661_100152059 3300005344 Bacteria 1750
52 Ga0070669_100006460 3300005353 Bacteria 8443
53 Ga0070669_100020606 3300005353 Bacteria 4709
54 Ga0070669_100028219 3300005353 Bacteria 4042
55 Ga0070669_100048158 3300005353 Bacteria 3111
56 Ga0070669_100068373 3300005353 Unclassified 2622
57 Ga0070669_100071807 3300005353 Bacteria 2562
58 Ga0070669_100328444 3300005353 Bacteria 1237
59 Ga0070675_100000066 3300005354 Bacteria 62507
60 Ga0070675_100000155 3300005354 Bacteria 41366
61 Ga0070675_100004832 3300005354 Bacteria 10276
62 Ga0070675_100008815 3300005354 Bacteria 7837
63 Ga0070675_100009046 3300005354 Bacteria 7738
64 Ga0070675_100010990 3300005354 Bacteria 7088
65 Ga0070675_100095407 3300005354 Unclassified 2497
66 Ga0070675_100203327 3300005354 Bacteria 1719
67 Ga0070675_100248686 3300005354 Bacteria 1555
68 Ga0070671_100002428 3300005355 Bacteria 14404
69 Ga0070671_100002569 3300005355 Bacteria 14072
70 Ga0070671_100108886 3300005355 Unclassified 2326
71 Ga0070671_100211769 3300005355 Bacteria 1644
72 Ga0070674_100000172 3300005356 Bacteria 30047
73 Ga0070674_100003025 3300005356 Bacteria 9350
74 Ga0070674_100006145 3300005356 Bacteria 6980
75 Ga0070674_100025946 3300005356 Bacteria 3821
76 Ga0070674_100042986 3300005356 Bacteria 3072
77 Ga0070673_100030613 3300005364 Bacteria 4031
78 Ga0070673_100039246 3300005364 Bacteria 3622
79 Ga0070673_100051131 3300005364 Bacteria 3234
80 Ga0070673_100060995 3300005364 Bacteria 2991
81 Ga0070673_100191229 3300005364 Bacteria 1758
82 Ga0070673_100224675 3300005364 Viruses 1627
83 Ga0070688_100014845 3300005365 Bacteria 4421
84 Ga0070688_100044054 3300005365 Bacteria 2752
85 Ga0070688_100074775 3300005365 Unclassified 2176
86 Ga0070688_100130407 3300005365 Bacteria 1695
87 Ga0070688_100228890 3300005365 Bacteria 1314
88 Ga0070659_100199038 3300005366 Unclassified 1648
89 Ga0070667_100004578 3300005367 Bacteria 11618
90 Ga0070667_100039854 3300005367 Bacteria 3938
91 Ga0070667_100311263 3300005367 Bacteria 1419
92 Ga0070713_100455785 3300005436 Bacteria 1202
93 Ga0070701_10052948 3300005438 Bacteria 2111
94 Ga0070701_10146938 3300005438 Bacteria 1354
95 Ga0070701_10231446 3300005438 Unclassified 1107
96 Ga0070701_10386811 3300005438 Unclassified 883
97 Ga0070700_100008907 3300005441 Bacteria 5488
98 Ga0070700_100041636 3300005441 Bacteria 2817
99 Ga0070694_100383129 3300005444 Unclassified 1097
100 Ga0070708_100529045 3300005445 Unclassified 1112
101 Ga0070678_100037797 3300005456 Bacteria 3393
102 Ga0070678_100064911 3300005456 Bacteria 2708
103 Ga0070678_100220176 3300005456 Bacteria 1577
104 Ga0070678_100589723 3300005456 Unclassified 991
105 Ga0070662_100141379 3300005457 Bacteria 1866
106 Ga0070662_100163212 3300005457 Unclassified 1744
107 Ga0070662_100318232 3300005457 Unclassified 1268
108 Ga0070681_10022694 3300005458 Bacteria 6305
109 Ga0068867_100002606 3300005459 Bacteria 12715
110 Ga0068867_100019691 3300005459 Bacteria 4808
111 Ga0068867_100053038 3300005459 Bacteria 2994
112 Ga0068867_100308415 3300005459 Bacteria 1307
113 Ga0068867_100308879 3300005459 Bacteria 1306
114 Ga0068867_100477412 3300005459 Bacteria 1067
115 Ga0070685_10008987 3300005466 Bacteria 5153
116 Ga0070685_10016899 3300005466 Unclassified 3894
117 Ga0070685_10044698 3300005466 Bacteria 2536
118 Ga0070685_10128524 3300005466 Bacteria 1582
119 Ga0070685_10135883 3300005466 Viruses 1542
120 Ga0070707_100010941 3300005468 Bacteria 8450
121 Ga0070698_100125610 3300005471 Bacteria 2523
122 Ga0070699_100004802 3300005518 Bacteria 11943
123 Ga0070699_100325603 3300005518 Bacteria 1382
124 Ga0070679_100176264 3300005530 Bacteria 2110
125 Ga0070684_100000798 3300005535 Bacteria 21897
126 Ga0070684_100012537 3300005535 Bacteria 6800
127 Ga0070684_100053687 3300005535 Bacteria 3509
128 Ga0070684_100135386 3300005535 Unclassified 2225
129 Ga0070697_100128449 3300005536 Bacteria 2124
130 Ga0068853_100017293 3300005539 Bacteria 5953
131 Ga0070672_100010082 3300005543 Bacteria 6542
132 Ga0070672_100015084 3300005543 Bacteria 5493
133 Ga0070672_100071989 3300005543 Bacteria 2751
134 Ga0070672_100124145 3300005543 Unclassified 2116
135 Ga0070672_100128187 3300005543 Bacteria 2083
136 Ga0070672_100146296 3300005543 Bacteria 1953
137 Ga0070672_100279634 3300005543 Unclassified 1411
138 Ga0070686_100005717 3300005544 Bacteria 6891
139 Ga0070686_100177627 3300005544 Bacteria 1511
140 Ga0070686_100268585 3300005544 Bacteria 1253
141 Ga0070695_100105289 3300005545 Bacteria 1906
142 Ga0070695_100543253 3300005545 Bacteria 905
143 Ga0070696_100156390 3300005546 Bacteria 1677
144 Ga0070665_100025743 3300005548 Bacteria 5926
145 Ga0070665_100064704 3300005548 Bacteria 3667
146 Ga0070665_100205870 3300005548 Bacteria 1968
147 Ga0070665_100317829 3300005548 Bacteria 1561
148 Ga0070704_100156050 3300005549 Bacteria 1800
149 Ga0068855_100032629 3300005563 Bacteria 6217
150 Ga0068855_100207404 3300005563 Bacteria 2204
151 Ga0070664_100003099 3300005564 Bacteria 13446
152 Ga0070664_100013129 3300005564 Bacteria 6743
153 Ga0070664_100057806 3300005564 Unclassified 3297
154 Ga0070664_100391513 3300005564 Unclassified 1270
155 Ga0070664_100480967 3300005564 Bacteria 1143
156 Ga0068857_100002143 3300005577 Bacteria 16043
157 Ga0068857_100026278 3300005577 Bacteria 5129
158 Ga0068857_100098397 3300005577 Bacteria 2624
159 Ga0068857_100251175 3300005577 Unclassified 1621
160 Ga0068854_100123610 3300005578 Bacteria 1968
161 Ga0068854_100372690 3300005578 Unclassified 1174
162 Ga0068856_100002863 3300005614 Bacteria 17656
163 Ga0068856_100121405 3300005614 Bacteria 2615
164 Ga0070702_100319398 3300005615 Bacteria 1081
165 Ga0068852_100016955 3300005616 Bacteria 5699
166 Ga0068852_100373790 3300005616 Bacteria 1397
167 Ga0068859_100001415 3300005617 Bacteria 24339
168 Ga0068859_100110705 3300005617 Unclassified 2808
169 Ga0068859_100212160 3300005617 Bacteria 2023
170 Ga0068859_100230575 3300005617 Bacteria 1940
171 Ga0068859_100267113 3300005617 Bacteria 1803
172 Ga0068859_100268430 3300005617 Bacteria 1798
173 Ga0068864_100069793 3300005618 Bacteria 3056
174 Ga0068864_100204367 3300005618 Archaea 1816
175 Ga0068864_100272841 3300005618 Unclassified 1576
176 Ga0068864_100350403 3300005618 Unclassified 1393
177 Ga0068864_100497222 3300005618 Bacteria 1173
178 Ga0068866_10207732 3300005718 Bacteria 1174
179 Ga0068861_100011696 3300005719 Bacteria 6106
180 Ga0068861_100020154 3300005719 Bacteria 4770
181 Ga0068861_100185015 3300005719 Unclassified 1737
182 Ga0068870_10002516 3300005840 Bacteria 7652
183 Ga0068870_10018648 3300005840 Unclassified 3353
184 Ga0068870_10027979 3300005840 Bacteria 2826
185 Ga0068870_10057518 3300005840 Bacteria 2079
186 Ga0068863_100001188 3300005841 Bacteria 25985
187 Ga0068863_100032695 3300005841 Bacteria 4957
188 Ga0068863_100072220 3300005841 Unclassified 3265
189 Ga0068863_100093630 3300005841 Bacteria 2851
190 Ga0068863_100367031 3300005841 Bacteria 1404
191 Ga0068863_100377684 3300005841 Bacteria 1384
192 Ga0068858_100008085 3300005842 Bacteria 10127
193 Ga0068858_100020179 3300005842 Bacteria 6231
194 Ga0068858_100023088 3300005842 Bacteria 5802
195 Ga0068858_100048483 3300005842 Bacteria 3935
196 Ga0068858_100052894 3300005842 Bacteria 3758
197 Ga0068858_100069926 3300005842 Bacteria 3254
198 Ga0068858_100169812 3300005842 Bacteria 2056
199 Ga0068858_100253503 3300005842 Bacteria 1672
200 Ga0068858_100318677 3300005842 Bacteria 1485
201 Ga0068858_100541618 3300005842 Unclassified 1127
202 Ga0068858_100554123 3300005842 Bacteria 1113
203 Ga0068860_100002345 3300005843 Bacteria 19884
204 Ga0068860_100015037 3300005843 Bacteria 7563
205 Ga0068860_100024768 3300005843 Bacteria 5796
206 Ga0068860_100368917 3300005843 Bacteria 1415
207 Ga0068862_100024799 3300005844 Bacteria 5032
208 Ga0068862_100271192 3300005844 Bacteria 1552
209 Ga0068862_100311014 3300005844 Bacteria 1452
210 Ga0081539_10002513 3300005985 Bacteria 25633
211 Ga0081539_10020136 3300005985 Bacteria 4528
212 Ga0081539_10034411 3300005985 Bacteria 3064
213 Ga0097621_100028102 3300006237 Bacteria 4431
214 Ga0097621_100070814 3300006237 Bacteria 2880
215 Ga0097621_100084805 3300006237 Bacteria 2642
216 Ga0097621_100085617 3300006237 Bacteria 2629
217 Ga0097621_100120983 3300006237 Bacteria 2220
218 Ga0097621_100172598 3300006237 Unclassified 1864
219 Ga0097621_100235443 3300006237 Bacteria 1599
220 Ga0097621_100286463 3300006237 Bacteria 1451
221 Ga0097621_100593215 3300006237 Unclassified 1012
222 Ga0068871_100002113 3300006358 Bacteria 13450
223 Ga0068871_100030601 3300006358 Bacteria 4240
224 Ga0068871_100048251 3300006358 Bacteria 3437
225 Ga0068871_100049107 3300006358 Bacteria 3409
226 Ga0068871_100114203 3300006358 Bacteria 2275
227 Ga0068871_100293316 3300006358 Bacteria 1426
228 Ga0075428_100000897 3300006844 Bacteria 31396
229 Ga0075428_100030030 3300006844 Bacteria 6013
230 Ga0075428_100061510 3300006844 Bacteria 4112
231 Ga0075428_100081261 3300006844 Unclassified 3537
232 Ga0075428_100314873 3300006844 Bacteria 1682
233 Ga0075428_100484736 3300006844 Bacteria 1323
234 Ga0075430_100000547 3300006846 Bacteria 28547
235 Ga0075430_100037455 3300006846 Bacteria 4110
236 Ga0075430_100300462 3300006846 Unclassified 1328
237 Ga0075430_100302809 3300006846 Bacteria 1322
238 Ga0075430_100394464 3300006846 Bacteria 1142
239 Ga0075431_100000660 3300006847 Bacteria 29345
240 Ga0075431_100150928 3300006847 Bacteria 2392
241 Ga0075433_10007269 3300006852 Bacteria 8775
242 Ga0075434_100031338 3300006871 Bacteria 5242
243 Ga0075434_100041566 3300006871 Bacteria 4555
244 Ga0075429_100004739 3300006880 Bacteria 11709
245 Ga0075429_100047112 3300006880 Bacteria 3750
246 Ga0075429_100086823 3300006880 Bacteria 2726
247 Ga0075429_100116333 3300006880 Bacteria 2337
248 Ga0075429_100193735 3300006880 Bacteria 1780
249 Ga0075429_100278325 3300006880 Unclassified 1465
250 Ga0068865_100001500 3300006881 Bacteria 13615
251 Ga0068865_100037985 3300006881 Bacteria 3256
252 Ga0068865_100091396 3300006881 Bacteria 2209
253 Ga0068865_100107209 3300006881 Bacteria 2055
254 Ga0068865_100516119 3300006881 Bacteria 999
255 Ga0097620_100001415 3300006931 Bacteria 24339
256 Ga0097620_100110703 3300006931 Unclassified 2808
257 Ga0097620_100212162 3300006931 Bacteria 2023
258 Ga0097620_100230583 3300006931 Bacteria 1940
259 Ga0097620_100267093 3300006931 Bacteria 1803
260 Ga0097620_100268420 3300006931 Bacteria 1798
261 Ga0075435_100069017 3300007076 Bacteria 2881
262 Ga0075435_100087562 3300007076 Unclassified 2566
263 Ga0099794_10141908 3300007265 Unclassified 1217
264 Ga0105240_10007212 3300009093 Bacteria 16187
265 Ga0111539_10001040 3300009094 Bacteria 36436
266 Ga0111539_10001085 3300009094 Bacteria 35942
267 Ga0111539_10002033 3300009094 Bacteria 27033
268 Ga0111539_10006175 3300009094 Bacteria 15466
269 Ga0111539_10012907 3300009094 Bacteria 10452
270 Ga0111539_10019462 3300009094 Bacteria 8377
271 Ga0111539_10021542 3300009094 Bacteria 7930
272 Ga0111539_10076061 3300009094 Bacteria 3953
273 Ga0111539_10077105 3300009094 Bacteria 3923
274 Ga0111539_10652790 3300009094 Unclassified 1225
275 Ga0111539_10756255 3300009094 Unclassified 1131
276 Ga0105245_10002817 3300009098 Bacteria 15634
277 Ga0105245_10005874 3300009098 Bacteria 10781
278 Ga0105245_10007330 3300009098 Bacteria 9659
279 Ga0105245_10067011 3300009098 Bacteria 3251
280 Ga0105245_10336608 3300009098 Bacteria 1491
281 Ga0105247_10041806 3300009101 Bacteria 2805
282 Ga0105247_10052246 3300009101 Unclassified 2519
283 Ga0114129_10007495 3300009147 Bacteria 15539
284 Ga0114129_10010268 3300009147 Bacteria 13361
285 Ga0114129_10013157 3300009147 Bacteria 11791
286 Ga0114129_10185431 3300009147 Bacteria 2828
287 Ga0114129_10188652 3300009147 Bacteria 2801
288 Ga0114129_10614181 3300009147 Bacteria 1407
289 Ga0105243_10004789 3300009148 Bacteria 10635
290 Ga0105243_10307700 3300009148 Bacteria 1439
291 Ga0105243_10756030 3300009148 Unclassified 953
292 Ga0105242_10004165 3300009176 Bacteria 11260
293 Ga0105242_10007800 3300009176 Bacteria 8239
294 Ga0105242_10052482 3300009176 Unclassified 3327
295 Ga0105242_10238118 3300009176 Bacteria 1635
296 Ga0105242_10422004 3300009176 Bacteria 1250
297 Ga0105242_10456405 3300009176 Unclassified 1206
298 Ga0105248_10000989 3300009177 Bacteria 31486
299 Ga0105248_10003674 3300009177 Bacteria 16994
300 Ga0105248_10007529 3300009177 Bacteria 11952
301 Ga0105248_10024391 3300009177 Bacteria 6725
302 Ga0105248_10058803 3300009177 Bacteria 4317
303 Ga0105248_10080704 3300009177 Bacteria 3656
304 Ga0105248_10116032 3300009177 Bacteria 3020
305 Ga0105248_10464384 3300009177 Bacteria 1427
306 Ga0105248_10859858 3300009177 Bacteria 1024
307 Ga0105237_10011847 3300009545 Bacteria 9224
308 Ga0105237_10256798 3300009545 Bacteria 1750
309 Ga0105238_10007030 3300009551 Bacteria 11253
310 Ga0105238_10012072 3300009551 Bacteria 8705
311 Ga0105238_10343073 3300009551 Bacteria 1482
312 Ga0105249_10003457 3300009553 Bacteria 13680
313 Ga0105249_10087702 3300009553 Unclassified 2904
314 Ga0105249_10208460 3300009553 Unclassified 1916
315 Ga0105249_10596756 3300009553 Bacteria 1159
316 Ga0105239_10002878 3300010375 Bacteria 21530
317 Ga0105239_10018706 3300010375 Bacteria 7653
318 Ga0105246_10007910 3300011119 Bacteria 6523
319 Ga0105246_10089645 3300011119 Unclassified 2213
320 Ga0105246_10233430 3300011119 Unclassified 1450
321 Ga0105246_10642068 3300011119 Unclassified 923
322 Ga0157371_10217551 3300013102 Bacteria 1372
323 Ga0157370_10132055 3300013104 Bacteria 2329
324 Ga0157370_10927912 3300013104 Unclassified 789
325 Ga0157369_10001536 3300013105 Bacteria 28280
326 Ga0157369_10009823 3300013105 Bacteria 10941
327 Ga0157369_10076967 3300013105 Bacteria 3576
328 Ga0157374_10070426 3300013296 Bacteria 3295
329 Ga0157374_10138705 3300013296 Unclassified 2359
330 Ga0157374_10393755 3300013296 Bacteria 1381
331 Ga0157374_10407273 3300013296 Bacteria 1357
332 Ga0157378_10002948 3300013297 Bacteria 15135
333 Ga0157378_10232341 3300013297 Bacteria 1758
334 Ga0163162_10002310 3300013306 Bacteria 17883
335 Ga0163162_10041319 3300013306 Bacteria 4614
336 Ga0163162_10425153 3300013306 Bacteria 1461
337 Ga0163162_10426687 3300013306 Bacteria 1458
338 Ga0157372_10152542 3300013307 Unclassified 2667
339 Ga0157372_10245347 3300013307 Bacteria 2078
340 Ga0157375_10015156 3300013308 Bacteria 6895
341 Ga0157375_10044149 3300013308 Bacteria 4327
342 Ga0157375_10087044 3300013308 Bacteria 3176
343 Ga0157375_10240159 3300013308 Bacteria 1971
344 Ga0157375_10244678 3300013308 Viruses 1954
345 Ga0157375_10365082 3300013308 Bacteria 1610
346 Ga0157375_10730181 3300013308 Unclassified 1143
347 Ga0157375_10818357 3300013308 Bacteria 1079
348 Ga0157375_11152432 3300013308 Bacteria 908
349 Ga0163163_10009886 3300014325 Bacteria 8549
350 Ga0163163_10029807 3300014325 Bacteria 5251
351 Ga0163163_10029818 3300014325 Bacteria 5249
352 Ga0163163_10056169 3300014325 Bacteria 3891
353 Ga0163163_10061147 3300014325 Bacteria 3731
354 Ga0163163_10134169 3300014325 Unclassified 2516
355 Ga0163163_10184915 3300014325 Bacteria 2131
356 Ga0163163_10188737 3300014325 Bacteria 2109
357 Ga0163163_10225328 3300014325 Bacteria 1924
358 Ga0163163_10592041 3300014325 Bacteria 1172
359 Ga0157380_10002319 3300014326 Bacteria 12787
360 Ga0157380_10002618 3300014326 Bacteria 12175
361 Ga0157380_10009913 3300014326 Bacteria 6839
362 Ga0157380_10013591 3300014326 Bacteria 5940
363 Ga0157380_10122641 3300014326 Bacteria 2204
364 Ga0157380_10227399 3300014326 Bacteria 1673
365 Ga0157380_10415858 3300014326 Bacteria 1281
366 Ga0157377_10002327 3300014745 Bacteria 8365
367 Ga0157377_10409122 3300014745 Unclassified 926
368 Ga0157379_10000256 3300014968 Bacteria 41760
369 Ga0157379_10007215 3300014968 Bacteria 9615
370 Ga0157379_10065849 3300014968 Bacteria 3239
371 Ga0157379_10229981 3300014968 Bacteria 1680
372 Ga0157376_10028361 3300014969 Unclassified 4449
373 Ga0157376_10038733 3300014969 Bacteria 3881
374 Ga0157376_10136068 3300014969 Bacteria 2199
375 Ga0157376_10306551 3300014969 Bacteria 1505
376 Ga0163161_10029222 3300017792 Bacteria 3918
377 Ga0163161_10083935 3300017792 Bacteria 2348
378 Ga0163161_10086847 3300017792 Bacteria 2309
379 Ga0213873_10019436 3300021358 Unclassified 1576
380 Ga0207673_1002423 3300025290 Bacteria 2126
381 Ga0207697_10004431 3300025315 Bacteria 6711
382 Ga0207682_10000132 3300025893 Bacteria 33775
383 Ga0207682_10018543 3300025893 Unclassified 2722
384 Ga0207682_10018769 3300025893 Bacteria 2705
385 Ga0207682_10020639 3300025893 Bacteria 2587
386 Ga0207642_10030457 3300025899 Unclassified 2248
387 Ga0207688_10002329 3300025901 Bacteria 10214
388 Ga0207680_10136774 3300025903 Bacteria 1620
389 Ga0207680_10223651 3300025903 Bacteria 1291
390 Ga0207680_10468795 3300025903 Bacteria 895
391 Ga0207645_10001705 3300025907 Bacteria 17835
392 Ga0207645_10005242 3300025907 Bacteria 9441
393 Ga0207645_10158309 3300025907 Bacteria 1481
394 Ga0207643_10000158 3300025908 Bacteria 46661
395 Ga0207643_10031596 3300025908 Bacteria 2952
396 Ga0207643_10076355 3300025908 Bacteria 1935
397 Ga0207684_10416185 3300025910 Bacteria 1155
398 Ga0207654_10006658 3300025911 Bacteria 5815
399 Ga0207707_10007487 3300025912 Bacteria 9514
400 Ga0207707_10015835 3300025912 Bacteria 6575
401 Ga0207695_10011185 3300025913 Bacteria 10889
402 Ga0207671_10194365 3300025914 Bacteria 1583
403 Ga0207671_10476517 3300025914 Bacteria 995
404 Ga0207663_10561058 3300025916 Unclassified 894
405 Ga0207660_10022201 3300025917 Bacteria 4275
406 Ga0207660_10133668 3300025917 Unclassified 1891
407 Ga0207662_10010142 3300025918 Bacteria 5193
408 Ga0207662_10042933 3300025918 Bacteria 2666
409 Ga0207662_10059245 3300025918 Bacteria 2294
410 Ga0207657_10050489 3300025919 Bacteria 3621
411 Ga0207649_10172975 3300025920 Bacteria 1506
412 Ga0207652_10528201 3300025921 Unclassified 1061
413 Ga0207646_10015473 3300025922 Bacteria 7204
414 Ga0207681_10016940 3300025923 Bacteria 4569
415 Ga0207681_10025158 3300025923 Unclassified 3827
416 Ga0207681_10092958 3300025923 Bacteria 2158
417 Ga0207681_10110149 3300025923 Bacteria 2001
418 Ga0207694_10007538 3300025924 Bacteria 8247
419 Ga0207694_10113697 3300025924 Bacteria 2155
420 Ga0207694_10291034 3300025924 Bacteria 1343
421 Ga0207650_10003579 3300025925 Bacteria 10657
422 Ga0207650_10025025 3300025925 Bacteria 4250
423 Ga0207650_10104995 3300025925 Unclassified 2180
424 Ga0207650_10267781 3300025925 Bacteria 1388
425 Ga0207659_10002580 3300025926 Bacteria 10791
426 Ga0207659_10005096 3300025926 Bacteria 7963
427 Ga0207659_10006574 3300025926 Bacteria 7135
428 Ga0207659_10007438 3300025926 Bacteria 6734
429 Ga0207659_10008819 3300025926 Bacteria 6283
430 Ga0207659_10015743 3300025926 Unclassified 4910
431 Ga0207659_10214898 3300025926 Bacteria 1543
432 Ga0207659_10231746 3300025926 Bacteria 1490
433 Ga0207659_10272806 3300025926 Unclassified 1380
434 Ga0207687_10001517 3300025927 Bacteria 15910
435 Ga0207687_10002706 3300025927 Bacteria 11994
436 Ga0207687_10011603 3300025927 Bacteria 5759
437 Ga0207687_10267011 3300025927 Unclassified 1366
438 Ga0207687_10295133 3300025927 Bacteria 1304
439 Ga0207700_10040780 3300025928 Bacteria 3391
440 Ga0207644_10003374 3300025931 Bacteria 10311
441 Ga0207644_10430779 3300025931 Bacteria 1082
442 Ga0207706_10005507 3300025933 Bacteria 11806
443 Ga0207706_10102416 3300025933 Bacteria 2519
444 Ga0207706_10121615 3300025933 Unclassified 2295
445 Ga0207706_10136016 3300025933 Bacteria 2162
446 Ga0207706_10138426 3300025933 Unclassified 2141
447 Ga0207706_10379408 3300025933 Unclassified 1227
448 Ga0207686_10021020 3300025934 Bacteria 3738
449 Ga0207686_10025183 3300025934 Unclassified 3457
450 Ga0207686_10063613 3300025934 Bacteria 2347
451 Ga0207686_10114203 3300025934 Bacteria 1827
452 Ga0207686_10173109 3300025934 Bacteria 1524
453 Ga0207686_10220221 3300025934 Unclassified 1370
454 Ga0207686_10411719 3300025934 Bacteria 1032
455 Ga0207709_10007905 3300025935 Bacteria 5896
456 Ga0207670_10053311 3300025936 Bacteria 2724
457 Ga0207670_10084116 3300025936 Bacteria 2233
458 Ga0207670_10108595 3300025936 Bacteria 1995
459 Ga0207670_10230801 3300025936 Bacteria 1421
460 Ga0207670_10397261 3300025936 Bacteria 1101
461 Ga0207669_10001536 3300025937 Bacteria 9841
462 Ga0207669_10032312 3300025937 Unclassified 2938
463 Ga0207669_10341420 3300025937 Unclassified 1153
464 Ga0207704_10002318 3300025938 Bacteria 8551
465 Ga0207704_10279118 3300025938 Unclassified 1269
466 Ga0207704_10324876 3300025938 Unclassified 1188
467 Ga0207665_10294567 3300025939 Bacteria 1211
468 Ga0207691_10015339 3300025940 Bacteria 7289
469 Ga0207691_10031696 3300025940 Unclassified 4932
470 Ga0207691_10032386 3300025940 Bacteria 4873
471 Ga0207691_10063782 3300025940 Bacteria 3340
472 Ga0207691_10066898 3300025940 Bacteria 3250
473 Ga0207691_10076163 3300025940 Bacteria 3024
474 Ga0207691_10079666 3300025940 Bacteria 2947
475 Ga0207691_10148327 3300025940 Bacteria 2063
476 Ga0207691_10214002 3300025940 Bacteria 1673
477 Ga0207711_10001075 3300025941 Bacteria 26081
478 Ga0207711_10002291 3300025941 Bacteria 17168
479 Ga0207711_10038468 3300025941 Bacteria 4068
480 Ga0207711_10134533 3300025941 Bacteria 2219
481 Ga0207711_10142454 3300025941 Bacteria 2158
482 Ga0207711_10146079 3300025941 Bacteria 2131
483 Ga0207711_10238375 3300025941 Bacteria 1668
484 Ga0207711_10321255 3300025941 Bacteria 1431
485 Ga0207689_10001215 3300025942 Bacteria 24788
486 Ga0207689_10012592 3300025942 Bacteria 7225
487 Ga0207689_10024081 3300025942 Bacteria 5107
488 Ga0207689_10032890 3300025942 Bacteria 4310
489 Ga0207689_10034442 3300025942 Bacteria 4206
490 Ga0207689_10141739 3300025942 Bacteria 1980
491 Ga0207661_10005480 3300025944 Bacteria 8951
492 Ga0207661_10010465 3300025944 Bacteria 6676
493 Ga0207661_10061861 3300025944 Bacteria 3026
494 Ga0207679_10008760 3300025945 Bacteria 6455
495 Ga0207679_10390892 3300025945 Bacteria 1221
496 Ga0207667_10001679 3300025949 Bacteria 27883
497 Ga0207667_10053777 3300025949 Bacteria 4236
498 Ga0207651_10013181 3300025960 Bacteria 4718
499 Ga0207651_10089986 3300025960 Bacteria 2242
500 Ga0207651_10107349 3300025960 Bacteria 2086
501 Ga0207651_10242299 3300025960 Bacteria 1470
502 Ga0207651_10244160 3300025960 Viruses 1465
503 Ga0207651_10254409 3300025960 Bacteria 1439
504 Ga0207651_10495268 3300025960 Bacteria 1055
505 Ga0207712_10048304 3300025961 Bacteria 2960
506 Ga0207712_10199672 3300025961 Bacteria 1585
507 Ga0207668_10116074 3300025972 Unclassified 2018
508 Ga0207668_10248383 3300025972 Unclassified 1444
509 Ga0207640_10029029 3300025981 Bacteria 3390
510 Ga0207640_10200333 3300025981 Bacteria 1512
511 Ga0207658_10050629 3300025986 Bacteria 3057
512 Ga0207658_10283772 3300025986 Bacteria 1420
513 Ga0207658_10292528 3300025986 Bacteria 1400
514 Ga0207677_10046357 3300026023 Unclassified 2910
515 Ga0207677_10059310 3300026023 Bacteria 2639
516 Ga0207677_10063055 3300026023 Bacteria 2574
517 Ga0207677_10248534 3300026023 Unclassified 1443
518 Ga0207677_10414264 3300026023 Bacteria 1146
519 Ga0207703_10010038 3300026035 Bacteria 7423
520 Ga0207703_10016879 3300026035 Bacteria 5695
521 Ga0207703_10024413 3300026035 Bacteria 4757
522 Ga0207703_10028274 3300026035 Bacteria 4418
523 Ga0207703_10036764 3300026035 Bacteria 3899
524 Ga0207703_10121624 3300026035 Bacteria 2241
525 Ga0207703_10142339 3300026035 Bacteria 2083
526 Ga0207703_10291369 3300026035 Bacteria 1485
527 Ga0207703_10340088 3300026035 Bacteria 1379
528 Ga0207639_10012230 3300026041 Bacteria 5973
529 Ga0207678_10330961 3300026067 Bacteria 1311
530 Ga0207708_10069628 3300026075 Bacteria 2694
531 Ga0207708_10159099 3300026075 Unclassified 1783
532 Ga0207708_10463528 3300026075 Bacteria 1057
533 Ga0207641_10001252 3300026088 Bacteria 25305
534 Ga0207641_10017052 3300026088 Bacteria 5943
535 Ga0207641_10060241 3300026088 Bacteria 3235
536 Ga0207641_10078963 3300026088 Bacteria 2852
537 Ga0207641_10113303 3300026088 Bacteria 2408
538 Ga0207641_10426281 3300026088 Unclassified 1278
539 Ga0207648_10000749 3300026089 Bacteria 36501
540 Ga0207648_10030992 3300026089 Bacteria 4730
541 Ga0207676_10026888 3300026095 Unclassified 4280
542 Ga0207676_10114079 3300026095 Bacteria 2266
543 Ga0207676_10199685 3300026095 Bacteria 1766
544 Ga0207676_10225342 3300026095 Bacteria 1672
545 Ga0207674_10034924 3300026116 Bacteria 5251
546 Ga0207674_10094743 3300026116 Bacteria 2972
547 Ga0207674_10274440 3300026116 Bacteria 1634
548 Ga0207675_100018321 3300026118 Bacteria 6529
549 Ga0207675_100019597 3300026118 Bacteria 6314
550 Ga0207675_100065809 3300026118 Bacteria 3387
551 Ga0207675_100207439 3300026118 Bacteria 1883
552 Ga0207675_100304965 3300026118 Bacteria 1552
553 Ga0207675_100370160 3300026118 Bacteria 1407
554 Ga0207675_100656028 3300026118 Bacteria 1056
555 Ga0207683_10014432 3300026121 Bacteria 6726
556 Ga0207683_10033857 3300026121 Bacteria 4439
557 Ga0207683_10090359 3300026121 Bacteria 2727
558 Ga0207683_10090571 3300026121 Bacteria 2724
559 Ga0207683_10144820 3300026121 Bacteria 2142
560 Ga0207683_10480445 3300026121 Bacteria 1147
561 Ga0207683_10556041 3300026121 Bacteria 1061
562 Ga0207698_10007422 3300026142 Bacteria 6868
563 Ga0209974_10022140 3300027876 Bacteria 2104
564 Ga0207428_10000145 3300027907 Bacteria 96603
565 Ga0207428_10001182 3300027907 Bacteria 28099
566 Ga0207428_10015799 3300027907 Bacteria 6515
567 Ga0207428_10019771 3300027907 Bacteria 5736
568 Ga0268266_10248451 3300028379 Bacteria 1645
569 Ga0268266_10650535 3300028379 Bacteria 1014
570 Ga0268265_10119101 3300028380 Bacteria 2172
571 Ga0268265_10137535 3300028380 Bacteria 2040
572 Ga0268265_10173115 3300028380 Bacteria 1847
573 Ga0268265_10203570 3300028380 Unclassified 1719
574 Ga0268264_10023645 3300028381 Bacteria 5012
575 Ga0268264_10025488 3300028381 Bacteria 4831
576 Ga0268264_10043243 3300028381 Bacteria 3732
577 Ga0268264_10296991 3300028381 Bacteria 1519
578 Ga0268264_10335205 3300028381 Bacteria 1435
579 Ga0268264_10657078 3300028381 Bacteria 1038
580 Ga0265338_10101724 3300028800 Unclassified 2339
581 Ga0307410_10073211 3300031852 Bacteria 2382
582 Ga0373958_0028440 3300034819 Unclassified 1082
583 Ga0373959_0042393 3300034820 Unclassified 959
584 Ga0373940_0082005 3300035088 Unclassified 955
585 Ga0373939_0027909 3300035114 Unclassified 1603
586 Ga0373954_0009692 3300035118 Bacteria 4240
587 Ga0373943_0251607 3300035170 Bacteria 992
588 Ga0373946_0109340 3300035171 Bacteria 1249
589 Ga0373955_0009555 3300035172 Bacteria 4549
590 Ga0373955_0037801 3300035172 Bacteria 2568
591 Ga0373931_0072356 3300035691 Unclassified 1885
592 Ga0373935_0012782 3300035692 Bacteria 5055
593 Ga0373927_0096927 3300035695 Bacteria 1917
594 Ga0373933_0128669 3300035724 Bacteria 1591
595 Ga0373933_0374210 3300035724 Bacteria 927
596 Ga0373947_0047192 3300035725 Bacteria 2580
597 Ga0373937_0002230 3300036401 Bacteria 16188
598 Ga0373937_0143938 3300036401 Bacteria 2231
599 Ga0373937_0262805 3300036401 Bacteria 1628
600 Ga0373925_0264666 3300037068 Unclassified 1382
601 Ga0436364_0777519 3300037853 Bacteria 2131
602 Ga0436364_1230958 3300037853 Bacteria 11165
603 Ga0436365_1125834 3300039437 Bacteria 1221
604 Ga0436365_1846503 3300039437 Bacteria 2312
605 Ga0436360_1193993 3300039438 Unclassified 1367
606 Ga0436363_1105696 3300039450 Unclassified 1462
607 Ga0436362_0610419 3300039453 Unclassified 2031
608 Ga0436362_0989467 3300039453 Unclassified 1082
609 Ga0451853_1153435 3300041512 Bacteria 1797
610 Ga0439450_003678 3300042008 Bacteria 2559
611 Ga0439435_0003036 3300042436 Bacteria 3433
612 Ga0439464_0040216 3300042439 Bacteria 1331
613 Ga0439440_0004974 3300042993 Bacteria 2624
614 Ga0439440_0018773 3300042993 Bacteria 1535
615 Ga0451576_0142469 3300045051 Bacteria 2499
616 Ga0495592_0186986 3300046454 Bacteria 1406
617 Ga0495603_0075413 3300046455 Bacteria 1980
618 Ga0495580_0011788 3300046472 Bacteria 6747
619 Ga0495580_0046901 3300046472 Bacteria 3064
620 Ga0495580_0080252 3300046472 Bacteria 2275
621 Ga0495580_0101334 3300046472 Unclassified 2003
622 Ga0495580_0208339 3300046472 Bacteria 1346
623 Ga0495628_0305786 3300046516 Bacteria 1176
624 Ga0495630_0269156 3300046517 Bacteria 1302
625 Ga0495586_0034757 3300046535 Unclassified 2708
626 Ga0495586_0088376 3300046535 Bacteria 1709
627 Ga0495586_0164317 3300046535 Bacteria 1252
628 Ga0495586_0305974 3300046535 Bacteria 911
629 Ga0495621_0028418 3300046539 Bacteria 1901
630 Ga0495656_0032715 3300046615 Bacteria 2118
631 Ga0495656_0344712 3300046615 Unclassified 771
632 Ga0495659_0033791 3300046664 Bacteria 1796
633 Ga0495658_0050030 3300046683 Bacteria 2363
634 Ga0495669_0007142 3300046684 Bacteria 4678
635 Ga0495613_0001205 3300046689 Bacteria 19765
636 Ga0495613_0337307 3300046689 Unclassified 1038
637 Ga0495600_0044957 3300046809 Bacteria 2881
638 Ga0495581_0245015 3300047315 Bacteria 1048
639 Ga0495604_0023400 3300047317 Bacteria 4928
640 Ga0495636_0008034 3300047318 Bacteria 4160
641 Ga0495674_0064003 3300047319 Unclassified 3198
642 Ga0495672_0226228 3300047320 Unclassified 921
643 Ga0495684_0003136 3300047471 Bacteria 12958
644 Ga0495684_0146827 3300047471 Bacteria 1766
645 Ga0495684_0184333 3300047471 Bacteria 1546
646 Ga0496100_0045040 3300048903 Bacteria 2829
647 Ga0496101_0001528 3300048904 Bacteria 13862
648 Ga0496102_0239015 3300048905 Bacteria 1713
649 Ga0496104_0005154 3300048907 Bacteria 11417
650 Ga0496104_0509988 3300048907 Unclassified 1114
651 Ga0496105_0054545 3300048908 Bacteria 3300
652 Ga0496106_0037942 3300048909 Unclassified 3605
653 Ga0496107_0042790 3300048910 Bacteria 3253
654 Ga0496109_0038944 3300048912 Bacteria 4301
655 Ga0496110_0267244 3300048913 Unclassified 1557
656 Ga0496113_0028341 3300048916 Bacteria 4027
657 Ga0496114_0000958 3300048917 Bacteria 21594
658 Ga0501036_0232004 3300049572 Bacteria 1549
659 Ga0501039_0047979 3300049575 Bacteria 3301
660 Ga0501039_0336206 3300049575 Unclassified 1187
661 Ga0501041_0041733 3300049577 Bacteria 2787
662 Ga0501042_0019896 3300049578 Unclassified 4667
663 Ga0501046_0139439 3300049580 Bacteria 1836
664 Ga0501072_0043680 3300049588 Bacteria 3523
665 Ga0501074_0212983 3300049590 Bacteria 1376
666 Ga0501075_0036043 3300049591 Bacteria 3691
667 Ga0501076_0282575 3300049592 Unclassified 1360
668 Ga0501077_0282309 3300049593 Bacteria 1057
669 Ga0501217_046345 3300049661 Bacteria 1123
670 Ga0501246_009274 3300049676 Unclassified 883
671 Ga0501079_0051025 3300049741 Bacteria 3193
672 Ga0501080_0045299 3300049742 Bacteria 4095
673 Ga0501081_0009862 3300049743 Bacteria 6221
674 Ga0501081_0469609 3300049743 Unclassified 936
675 Ga0501083_0405794 3300049744 Unclassified 887
676 nmdc:mga05p37_126650_c1 3300050507 Bacteria 3136
677 nmdc:mga05p37_165413_c1 3300050507 Bacteria 2700
678 nmdc:mga05p37_8735_c2 3300050507 Bacteria 11666
679 nmdc:mga09592_105757_c1 3300050508 Unclassified 2413
680 nmdc:mga09592_120972_c1 3300050508 Bacteria 2249
681 nmdc:mga09592_125413_c1 3300050508 Bacteria 2207
682 nmdc:mga09592_181466_c1 3300050508 Bacteria 1821
683 nmdc:mga09592_1845_c1 3300050508 Bacteria 17042
684 nmdc:mga09592_61762_c1 3300050508 Bacteria 3169
685 nmdc:mga09592_87640_c1 3300050508 Bacteria 2657
686 nmdc:mga09592_89040_c1 3300050508 Bacteria 2636
687 nmdc:mga0qj67_11086_c1 3300050509 Bacteria 6750
688 nmdc:mga0qj67_141467_c1 3300050509 Bacteria 1951
689 nmdc:mga0qj67_163_c1 3300050509 Bacteria 44837
690 nmdc:mga0qj67_274528_c1 3300050509 Unclassified 1367
691 nmdc:mga0qj67_355886_c1 3300050509 Bacteria 1183
692 nmdc:mga06r32_208356_c1 3300050510 Bacteria 1943
693 nmdc:mga06r32_235691_c1 3300050510 Bacteria 1818
694 nmdc:mga06r32_253377_c1 3300050510 Unclassified 1748
695 nmdc:mga06r32_445733_c1 3300050510 Bacteria 1274
696 nmdc:mga06r32_4898_c1 3300050510 Bacteria 12059
697 nmdc:mga06r32_60648_c1 3300050510 Bacteria 3641
698 nmdc:mga06r32_71389_c1 3300050510 Bacteria 3359
699 nmdc:mga08y16_16673_c1 3300050511 Bacteria 7729
700 nmdc:mga08y16_21264_c1 3300050511 Bacteria 6851
701 nmdc:mga08y16_235430_c1 3300050511 Bacteria 1894
702 nmdc:mga08y16_316353_c1 3300050511 Unclassified 1607
703 nmdc:mga08y16_3813_c1 3300050511 Bacteria 15682
704 nmdc:mga08y16_38525_c1 3300050511 Bacteria 5020
705 nmdc:mga08y16_522324_c1 3300050511 Unclassified 1204
706 nmdc:mga08y16_617682_c1 3300050511 Viruses 1091
707 nmdc:mga08y16_6321_c1 3300050511 Bacteria 12425
708 nmdc:mga08y16_80847_c1 3300050511 Bacteria 3388
709 nmdc:mga08y16_823606_c1 3300050511 Unclassified 919
710 nmdc:mga0n895_121954_c1 3300050512 Bacteria 2628
711 nmdc:mga0n895_27903_c1 3300050512 Bacteria 5364
712 nmdc:mga0n895_347299_c1 3300050512 Bacteria 1503
713 nmdc:mga0n895_399946_c1 3300050512 Unclassified 1389
714 nmdc:mga0n895_96692_c1 3300050512 Bacteria 2958
715 nmdc:mga0rr50_58928_c1 3300050513 Bacteria 2880
716 nmdc:mga0a205_13640_c1 3300050515 Bacteria 7570
717 nmdc:mga0a205_1426_c1 3300050515 Bacteria 20333
718 nmdc:mga0a205_205031_c1 3300050515 Bacteria 1861
719 nmdc:mga0a205_636_c1 3300050515 Bacteria 27881
720 Ga0495601_0006471 3300053077 Bacteria 6849
721 Ga0495619_0000807 3300053085 Bacteria 20478
722 Ga0501084_0035787 3300054114 Bacteria 4150
723 Ga0501082_0210333 3300060353 Bacteria 1692
724 Ga0070675_100009008
725 JGI24746J21847_1003041
726 JGI24749J21850_1010117
727 JGI24033J26618_1006383
728 JGI25406J46586_10002829
729 Ga0065712_10068219
730 Ga0065712_10119450
731 Ga0065712_10138978
732 Ga0065712_10281332
733 Ga0065715_10093423
734 Ga0065715_10101812
735 Ga0065715_10161659
736 Ga0065707_10010359
737 Ga0065707_10201496
738 Ga0065707_10319167
739 Ga0070676_10003643
740 Ga0070676_10059376
741 Ga0070683_100021256
742 Ga0070690_100010835
743 Ga0070690_100175699
744 Ga0070690_100314804
745 Ga0070670_100008210
746 Ga0070670_100033142
747 Ga0070670_100034319
748 Ga0070670_100301956
749 Ga0070670_100316811
750 Ga0070677_10002250
751 Ga0070677_10072430
752 Ga0070677_10109740
753 Ga0070677_10137225
754 Ga0068869_100003412
755 Ga0068869_100030101
756 Ga0068869_100031562
757 Ga0068869_100094226
758 Ga0068869_100138075
759 Ga0068869_100342374
760 Ga0070666_10010303
761 Ga0070666_10103023
762 Ga0070666_10105157
763 Ga0070666_10322590
764 Ga0070680_100067445
765 Ga0070680_100369067
766 Ga0068868_100032947
767 Ga0068868_100574454
768 Ga0070689_100011313
769 Ga0070689_100214499
770 Ga0070687_100000834
771 Ga0070687_100027280
772 Ga0070687_100037161
773 Ga0070687_100052559
774 Ga0070661_100152059
775 Ga0070669_100006460
776 Ga0070669_100020606
777 Ga0070669_100028219
778 Ga0070669_100048158
779 Ga0070669_100068373
780 Ga0070669_100071807
781 Ga0070669_100328444
782 Ga0070675_100000066
783 Ga0070675_100000155
784 Ga0070675_100004832
785 Ga0070675_100008815
786 Ga0070675_100009046
787 Ga0070675_100010990
788 Ga0070675_100095407
789 Ga0070675_100203327
790 Ga0070675_100248686
791 Ga0070671_100002428
792 Ga0070671_100002569
793 Ga0070671_100108886
794 Ga0070671_100211769
795 Ga0070674_100000172
796 Ga0070674_100003025
797 Ga0070674_100006145
798 Ga0070674_100025946
799 Ga0070674_100042986
800 Ga0070673_100030613
801 Ga0070673_100039246
802 Ga0070673_100051131
803 Ga0070673_100060995
804 Ga0070673_100191229
805 Ga0070673_100224675
806 Ga0070688_100014845
807 Ga0070688_100044054
808 Ga0070688_100074775
809 Ga0070688_100130407
810 Ga0070688_100228890
811 Ga0070659_100199038
812 Ga0070667_100004578
813 Ga0070667_100039854
814 Ga0070667_100311263
815 Ga0070713_100455785
816 Ga0070701_10052948
817 Ga0070701_10146938
818 Ga0070701_10231446
819 Ga0070701_10386811
820 Ga0070700_100008907
821 Ga0070700_100041636
822 Ga0070694_100383129
823 Ga0070708_100529045
824 Ga0070678_100037797
825 Ga0070678_100064911
826 Ga0070678_100220176
827 Ga0070678_100589723
828 Ga0070662_100141379
829 Ga0070662_100163212
830 Ga0070662_100318232
831 Ga0070681_10022694
832 Ga0068867_100002606
833 Ga0068867_100019691
834 Ga0068867_100053038
835 Ga0068867_100308415
836 Ga0068867_100308879
837 Ga0068867_100477412
838 Ga0070685_10008987
839 Ga0070685_10016899
840 Ga0070685_10044698
841 Ga0070685_10128524
842 Ga0070685_10135883
843 Ga0070707_100010941
844 Ga0070698_100125610
845 Ga0070699_100004802
846 Ga0070699_100325603
847 Ga0070679_100176264
848 Ga0070684_100000798
849 Ga0070684_100012537
850 Ga0070684_100053687
851 Ga0070684_100135386
852 Ga0070697_100128449
853 Ga0068853_100017293
854 Ga0070672_100010082
855 Ga0070672_100015084
856 Ga0070672_100071989
857 Ga0070672_100124145
858 Ga0070672_100128187
859 Ga0070672_100146296
860 Ga0070672_100279634
861 Ga0070686_100005717
862 Ga0070686_100177627
863 Ga0070686_100268585
864 Ga0070695_100105289
865 Ga0070695_100543253
866 Ga0070696_100156390
867 Ga0070665_100025743
868 Ga0070665_100064704
869 Ga0070665_100205870
870 Ga0070665_100317829
871 Ga0070704_100156050
872 Ga0068855_100032629
873 Ga0068855_100207404
874 Ga0070664_100003099
875 Ga0070664_100013129
876 Ga0070664_100057806
877 Ga0070664_100391513
878 Ga0070664_100480967
879 Ga0068857_100002143
880 Ga0068857_100026278
881 Ga0068857_100098397
882 Ga0068857_100251175
883 Ga0068854_100123610
884 Ga0068854_100372690
885 Ga0068856_100002863
886 Ga0068856_100121405
887 Ga0070702_100319398
888 Ga0068852_100016955
889 Ga0068852_100373790
890 Ga0068859_100001415
891 Ga0068859_100110705
892 Ga0068859_100212160
893 Ga0068859_100230575
894 Ga0068859_100267113
895 Ga0068859_100268430
896 Ga0068864_100069793
897 Ga0068864_100204367
898 Ga0068864_100272841
899 Ga0068864_100350403
900 Ga0068864_100497222
901 Ga0068866_10207732
902 Ga0068861_100011696
903 Ga0068861_100020154
904 Ga0068861_100185015
905 Ga0068870_10002516
906 Ga0068870_10018648
907 Ga0068870_10027979
908 Ga0068870_10057518
909 Ga0068863_100001188
910 Ga0068863_100032695
911 Ga0068863_100072220
912 Ga0068863_100093630
913 Ga0068863_100367031
914 Ga0068863_100377684
915 Ga0068858_100008085
916 Ga0068858_100020179
917 Ga0068858_100023088
918 Ga0068858_100048483
919 Ga0068858_100052894
920 Ga0068858_100069926
921 Ga0068858_100169812
922 Ga0068858_100253503
923 Ga0068858_100318677
924 Ga0068858_100541618
925 Ga0068858_100554123
926 Ga0068860_100002345
927 Ga0068860_100015037
928 Ga0068860_100024768
929 Ga0068860_100368917
930 Ga0068862_100024799
931 Ga0068862_100271192
932 Ga0068862_100311014
933 Ga0081539_10002513
934 Ga0081539_10020136
935 Ga0081539_10034411
936 Ga0097621_100028102
937 Ga0097621_100070814
938 Ga0097621_100084805
939 Ga0097621_100085617
940 Ga0097621_100120983
941 Ga0097621_100172598
942 Ga0097621_100235443
943 Ga0097621_100286463
944 Ga0097621_100593215
945 Ga0068871_100002113
946 Ga0068871_100030601
947 Ga0068871_100048251
948 Ga0068871_100049107
949 Ga0068871_100114203
950 Ga0068871_100293316
951 Ga0075428_100000897
952 Ga0075428_100030030
953 Ga0075428_100061510
954 Ga0075428_100081261
955 Ga0075428_100314873
956 Ga0075428_100484736
957 Ga0075430_100000547
958 Ga0075430_100037455
959 Ga0075430_100300462
960 Ga0075430_100302809
961 Ga0075430_100394464
962 Ga0075431_100000660
963 Ga0075431_100150928
964 Ga0075433_10007269
965 Ga0075434_100031338
966 Ga0075434_100041566
967 Ga0075429_100004739
968 Ga0075429_100047112
969 Ga0075429_100086823
970 Ga0075429_100116333
971 Ga0075429_100193735
972 Ga0075429_100278325
973 Ga0068865_100001500
974 Ga0068865_100037985
975 Ga0068865_100091396
976 Ga0068865_100107209
977 Ga0068865_100516119
978 Ga0097620_100001415
979 Ga0097620_100110703
980 Ga0097620_100212162
981 Ga0097620_100230583
982 Ga0097620_100267093
983 Ga0097620_100268420
984 Ga0075435_100069017
985 Ga0075435_100087562
986 Ga0099794_10141908
987 Ga0105240_10007212
988 Ga0111539_10001040
989 Ga0111539_10001085
990 Ga0111539_10002033
991 Ga0111539_10006175
992 Ga0111539_10012907
993 Ga0111539_10019462
994 Ga0111539_10021542
995 Ga0111539_10076061
996 Ga0111539_10077105
997 Ga0111539_10652790
998 Ga0111539_10756255
999 Ga0105245_10002817
1000 Ga0105245_10005874
1001 Ga0105245_10007330
1002 Ga0105245_10067011
1003 Ga0105245_10336608
1004 Ga0105247_10041806
1005 Ga0105247_10052246
1006 Ga0114129_10007495
1007 Ga0114129_10010268
1008 Ga0114129_10013157
1009 Ga0114129_10185431
1010 Ga0114129_10188652
1011 Ga0114129_10614181
1012 Ga0105243_10004789
1013 Ga0105243_10307700
1014 Ga0105243_10756030
1015 Ga0105242_10004165
1016 Ga0105242_10007800
1017 Ga0105242_10052482
1018 Ga0105242_10238118
1019 Ga0105242_10422004
1020 Ga0105242_10456405
1021 Ga0105248_10000989
1022 Ga0105248_10003674
1023 Ga0105248_10007529
1024 Ga0105248_10024391
1025 Ga0105248_10058803
1026 Ga0105248_10080704
1027 Ga0105248_10116032
1028 Ga0105248_10464384
1029 Ga0105248_10859858
1030 Ga0105237_10011847
1031 Ga0105237_10256798
1032 Ga0105238_10007030
1033 Ga0105238_10012072
1034 Ga0105238_10343073
1035 Ga0105249_10003457
1036 Ga0105249_10087702
1037 Ga0105249_10208460
1038 Ga0105249_10596756
1039 Ga0105239_10002878
1040 Ga0105239_10018706
1041 Ga0105246_10007910
1042 Ga0105246_10089645
1043 Ga0105246_10233430
1044 Ga0105246_10642068
1045 Ga0157371_10217551
1046 Ga0157370_10132055
1047 Ga0157370_10927912
1048 Ga0157369_10001536
1049 Ga0157369_10009823
1050 Ga0157369_10076967
1051 Ga0157374_10070426
1052 Ga0157374_10138705
1053 Ga0157374_10393755
1054 Ga0157374_10407273
1055 Ga0157378_10002948
1056 Ga0157378_10232341
1057 Ga0163162_10002310
1058 Ga0163162_10041319
1059 Ga0163162_10425153
1060 Ga0163162_10426687
1061 Ga0157372_10152542
1062 Ga0157372_10245347
1063 Ga0157375_10015156
1064 Ga0157375_10044149
1065 Ga0157375_10087044
1066 Ga0157375_10240159
1067 Ga0157375_10244678
1068 Ga0157375_10365082
1069 Ga0157375_10730181
1070 Ga0157375_10818357
1071 Ga0157375_11152432
1072 Ga0163163_10009886
1073 Ga0163163_10029807
1074 Ga0163163_10029818
1075 Ga0163163_10056169
1076 Ga0163163_10061147
1077 Ga0163163_10134169
1078 Ga0163163_10184915
1079 Ga0163163_10188737
1080 Ga0163163_10225328
1081 Ga0163163_10592041
1082 Ga0157380_10002319
1083 Ga0157380_10002618
1084 Ga0157380_10009913
1085 Ga0157380_10013591
1086 Ga0157380_10122641
1087 Ga0157380_10227399
1088 Ga0157380_10415858
1089 Ga0157377_10002327
1090 Ga0157377_10409122
1091 Ga0157379_10000256
1092 Ga0157379_10007215
1093 Ga0157379_10065849
1094 Ga0157379_10229981
1095 Ga0157376_10028361
1096 Ga0157376_10038733
1097 Ga0157376_10136068
1098 Ga0157376_10306551
1099 Ga0163161_10029222
1100 Ga0163161_10083935
1101 Ga0163161_10086847
1102 Ga0213873_10019436
1103 Ga0207673_1002423
1104 Ga0207697_10004431
1105 Ga0207682_10000132
1106 Ga0207682_10018543
1107 Ga0207682_10018769
1108 Ga0207682_10020639
1109 Ga0207642_10030457
1110 Ga0207688_10002329
1111 Ga0207680_10136774
1112 Ga0207680_10223651
1113 Ga0207680_10468795
1114 Ga0207645_10001705
1115 Ga0207645_10005242
1116 Ga0207645_10158309
1117 Ga0207643_10000158
1118 Ga0207643_10031596
1119 Ga0207643_10076355
1120 Ga0207684_10416185
1121 Ga0207654_10006658
1122 Ga0207707_10007487
1123 Ga0207707_10015835
1124 Ga0207695_10011185
1125 Ga0207671_10194365
1126 Ga0207671_10476517
1127 Ga0207663_10561058
1128 Ga0207660_10022201
1129 Ga0207660_10133668
1130 Ga0207662_10010142
1131 Ga0207662_10042933
1132 Ga0207662_10059245
1133 Ga0207657_10050489
1134 Ga0207649_10172975
1135 Ga0207652_10528201
1136 Ga0207646_10015473
1137 Ga0207681_10016940
1138 Ga0207681_10025158
1139 Ga0207681_10092958
1140 Ga0207681_10110149
1141 Ga0207694_10007538
1142 Ga0207694_10113697
1143 Ga0207694_10291034
1144 Ga0207650_10003579
1145 Ga0207650_10025025
1146 Ga0207650_10104995
1147 Ga0207650_10267781
1148 Ga0207659_10002580
1149 Ga0207659_10005096
1150 Ga0207659_10006574
1151 Ga0207659_10007438
1152 Ga0207659_10008819
1153 Ga0207659_10015743
1154 Ga0207659_10214898
1155 Ga0207659_10231746
1156 Ga0207659_10272806
1157 Ga0207687_10001517
1158 Ga0207687_10002706
1159 Ga0207687_10011603
1160 Ga0207687_10267011
1161 Ga0207687_10295133
1162 Ga0207700_10040780
1163 Ga0207644_10003374
1164 Ga0207644_10430779
1165 Ga0207706_10005507
1166 Ga0207706_10102416
1167 Ga0207706_10121615
1168 Ga0207706_10136016
1169 Ga0207706_10138426
1170 Ga0207706_10379408
1171 Ga0207686_10021020
1172 Ga0207686_10025183
1173 Ga0207686_10063613
1174 Ga0207686_10114203
1175 Ga0207686_10173109
1176 Ga0207686_10220221
1177 Ga0207686_10411719
1178 Ga0207709_10007905
1179 Ga0207670_10053311
1180 Ga0207670_10084116
1181 Ga0207670_10108595
1182 Ga0207670_10230801
1183 Ga0207670_10397261
1184 Ga0207669_10001536
1185 Ga0207669_10032312
1186 Ga0207669_10341420
1187 Ga0207704_10002318
1188 Ga0207704_10279118
1189 Ga0207704_10324876
1190 Ga0207665_10294567
1191 Ga0207691_10015339
1192 Ga0207691_10031696
1193 Ga0207691_10032386
1194 Ga0207691_10063782
1195 Ga0207691_10066898
1196 Ga0207691_10076163
1197 Ga0207691_10079666
1198 Ga0207691_10148327
1199 Ga0207691_10214002
1200 Ga0207711_10001075
1201 Ga0207711_10002291
1202 Ga0207711_10038468
1203 Ga0207711_10134533
1204 Ga0207711_10142454
1205 Ga0207711_10146079
1206 Ga0207711_10238375
1207 Ga0207711_10321255
1208 Ga0207689_10001215
1209 Ga0207689_10012592
1210 Ga0207689_10024081
1211 Ga0207689_10032890
1212 Ga0207689_10034442
1213 Ga0207689_10141739
1214 Ga0207661_10005480
1215 Ga0207661_10010465
1216 Ga0207661_10061861
1217 Ga0207679_10008760
1218 Ga0207679_10390892
1219 Ga0207667_10001679
1220 Ga0207667_10053777
1221 Ga0207651_10013181
1222 Ga0207651_10089986
1223 Ga0207651_10107349
1224 Ga0207651_10242299
1225 Ga0207651_10244160
1226 Ga0207651_10254409
1227 Ga0207651_10495268
1228 Ga0207712_10048304
1229 Ga0207712_10199672
1230 Ga0207668_10116074
1231 Ga0207668_10248383
1232 Ga0207640_10029029
1233 Ga0207640_10200333
1234 Ga0207658_10050629
1235 Ga0207658_10283772
1236 Ga0207658_10292528
1237 Ga0207677_10046357
1238 Ga0207677_10059310
1239 Ga0207677_10063055
1240 Ga0207677_10248534
1241 Ga0207677_10414264
1242 Ga0207703_10010038
1243 Ga0207703_10016879
1244 Ga0207703_10024413
1245 Ga0207703_10028274
1246 Ga0207703_10036764
1247 Ga0207703_10121624
1248 Ga0207703_10142339
1249 Ga0207703_10291369
1250 Ga0207703_10340088
1251 Ga0207639_10012230
1252 Ga0207678_10330961
1253 Ga0207708_10069628
1254 Ga0207708_10159099
1255 Ga0207708_10463528
1256 Ga0207641_10001252
1257 Ga0207641_10017052
1258 Ga0207641_10060241
1259 Ga0207641_10078963
1260 Ga0207641_10113303
1261 Ga0207641_10426281
1262 Ga0207648_10000749
1263 Ga0207648_10030992
1264 Ga0207676_10026888
1265 Ga0207676_10114079
1266 Ga0207676_10199685
1267 Ga0207676_10225342
1268 Ga0207674_10034924
1269 Ga0207674_10094743
1270 Ga0207674_10274440
1271 Ga0207675_100018321
1272 Ga0207675_100019597
1273 Ga0207675_100065809
1274 Ga0207675_100207439
1275 Ga0207675_100304965
1276 Ga0207675_100370160
1277 Ga0207675_100656028
1278 Ga0207683_10014432
1279 Ga0207683_10033857
1280 Ga0207683_10090359
1281 Ga0207683_10090571
1282 Ga0207683_10144820
1283 Ga0207683_10480445
1284 Ga0207683_10556041
1285 Ga0207698_10007422
1286 Ga0209974_10022140
1287 Ga0207428_10000145
1288 Ga0207428_10001182
1289 Ga0207428_10015799
1290 Ga0207428_10019771
1291 Ga0268266_10248451
1292 Ga0268266_10650535
1293 Ga0268265_10119101
1294 Ga0268265_10137535
1295 Ga0268265_10173115
1296 Ga0268265_10203570
1297 Ga0268264_10023645
1298 Ga0268264_10025488
1299 Ga0268264_10043243
1300 Ga0268264_10296991
1301 Ga0268264_10335205
1302 Ga0268264_10657078
1303 Ga0265338_10101724
1304 Ga0307410_10073211
1305 Ga0373958_0028440
1306 Ga0373959_0042393
1307 Ga0373940_0082005
1308 Ga0373939_0027909
1309 Ga0373954_0009692
1310 Ga0373943_0251607
1311 Ga0373946_0109340
1312 Ga0373955_0009555
1313 Ga0373955_0037801
1314 Ga0373931_0072356
1315 Ga0373935_0012782
1316 Ga0373927_0096927
1317 Ga0373933_0128669
1318 Ga0373933_0374210
1319 Ga0373947_0047192
1320 Ga0373937_0002230
1321 Ga0373937_0143938
1322 Ga0373937_0262805
1323 Ga0373925_0264666
1324 Ga0436364_0777519
1325 Ga0436364_1230958
1326 Ga0436365_1125834
1327 Ga0436365_1846503
1328 Ga0436360_1193993
1329 Ga0436363_1105696
1330 Ga0436362_0610419
1331 Ga0436362_0989467
1332 Ga0451853_1153435
1333 Ga0439450_003678
1334 Ga0439435_0003036
1335 Ga0439464_0040216
1336 Ga0439440_0004974
1337 Ga0439440_0018773
1338 Ga0451576_0142469
1339 Ga0495592_0186986
1340 Ga0495603_0075413
1341 Ga0495580_0011788
1342 Ga0495580_0046901
1343 Ga0495580_0080252
1344 Ga0495580_0101334
1345 Ga0495580_0208339
1346 Ga0495628_0305786
1347 Ga0495630_0269156
1348 Ga0495586_0034757
1349 Ga0495586_0088376
1350 Ga0495586_0164317
1351 Ga0495586_0305974
1352 Ga0495621_0028418
1353 Ga0495656_0032715
1354 Ga0495656_0344712
1355 Ga0495659_0033791
1356 Ga0495658_0050030
1357 Ga0495669_0007142
1358 Ga0495613_0001205
1359 Ga0495613_0337307
1360 Ga0495600_0044957
1361 Ga0495581_0245015
1362 Ga0495604_0023400
1363 Ga0495636_0008034
1364 Ga0495674_0064003
1365 Ga0495672_0226228
1366 Ga0495684_0003136
1367 Ga0495684_0146827
1368 Ga0495684_0184333
1369 Ga0496100_0045040
1370 Ga0496101_0001528
1371 Ga0496102_0239015
1372 Ga0496104_0005154
1373 Ga0496104_0509988
1374 Ga0496105_0054545
1375 Ga0496106_0037942
1376 Ga0496107_0042790
1377 Ga0496109_0038944
1378 Ga0496110_0267244
1379 Ga0496113_0028341
1380 Ga0496114_0000958
1381 Ga0501036_0232004
1382 Ga0501039_0047979
1383 Ga0501039_0336206
1384 Ga0501041_0041733
1385 Ga0501042_0019896
1386 Ga0501046_0139439
1387 Ga0501072_0043680
1388 Ga0501074_0212983
1389 Ga0501075_0036043
1390 Ga0501076_0282575
1391 Ga0501077_0282309
1392 Ga0501217_046345
1393 Ga0501246_009274
1394 Ga0501079_0051025
1395 Ga0501080_0045299
1396 Ga0501081_0009862
1397 Ga0501081_0469609
1398 Ga0501083_0405794
1399 nmdc:mga05p37_126650_c1
1400 nmdc:mga05p37_165413_c1
1401 nmdc:mga05p37_8735_c2
1402 nmdc:mga09592_105757_c1
1403 nmdc:mga09592_120972_c1
1404 nmdc:mga09592_125413_c1
1405 nmdc:mga09592_181466_c1
1406 nmdc:mga09592_1845_c1
1407 nmdc:mga09592_61762_c1
1408 nmdc:mga09592_87640_c1
1409 nmdc:mga09592_89040_c1
1410 nmdc:mga0qj67_11086_c1
1411 nmdc:mga0qj67_141467_c1
1412 nmdc:mga0qj67_163_c1
1413 nmdc:mga0qj67_274528_c1
1414 nmdc:mga0qj67_355886_c1
1415 nmdc:mga06r32_208356_c1
1416 nmdc:mga06r32_235691_c1
1417 nmdc:mga06r32_253377_c1
1418 nmdc:mga06r32_445733_c1
1419 nmdc:mga06r32_4898_c1
1420 nmdc:mga06r32_60648_c1
1421 nmdc:mga06r32_71389_c1
1422 nmdc:mga08y16_16673_c1
1423 nmdc:mga08y16_21264_c1
1424 nmdc:mga08y16_235430_c1
1425 nmdc:mga08y16_316353_c1
1426 nmdc:mga08y16_3813_c1
1427 nmdc:mga08y16_38525_c1
1428 nmdc:mga08y16_522324_c1
1429 nmdc:mga08y16_617682_c1
1430 nmdc:mga08y16_6321_c1
1431 nmdc:mga08y16_80847_c1
1432 nmdc:mga08y16_823606_c1
1433 nmdc:mga0n895_121954_c1
1434 nmdc:mga0n895_27903_c1
1435 nmdc:mga0n895_347299_c1
1436 nmdc:mga0n895_399946_c1
1437 nmdc:mga0n895_96692_c1
1438 nmdc:mga0rr50_58928_c1
1439 nmdc:mga0a205_13640_c1
1440 nmdc:mga0a205_1426_c1
1441 nmdc:mga0a205_205031_c1
1442 nmdc:mga0a205_636_c1
1443 Ga0495601_0006471
1444 Ga0495619_0000807
1445 Ga0501084_0035787
1446 Ga0501082_0210333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fp6-assembly11.cif.gz_V complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7491 186 208
3lwg-assembly1.cif.gz_A crystal structure of hp0420-homologue c46a from helicobacter felis 0.731 186 225
3lw3-assembly1.cif.gz_A crystal structure of hp0420-homologue from helicobacter felis 0.7253 186 225
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.6723 182 237
3kg6-assembly3.cif.gz_A dehydratase domain from curf module of curacin polyketide synthase 0.6611 186 226
ID Description Score Start End Superfamily
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7529 184 225 2.40.128.20
3lwgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.731 186 225 3.10.129.10
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7304 182 207 2.60.40.200
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7089 186 225 3.10.129.10
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.68 181 225 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V8EJY4-F1-model_v4 Uncharacterized protein 0.9667 69 225
AF-A0A2V8GSQ7-F1-model_v4 Uncharacterized protein 0.9646 92 229
AF-A0A2D8P1M8-F1-model_v4 deleted 0.9568 71 217
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9543 115 232
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.9542 112 229

Map