F477413

General Info

Members Datasets Scaffolds Average Seq Length
722 300 656 302

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10000235|Ga0075366_1000023516
Length 323
Sequence LQKNLRLFIINNNYFSNVTSTKLYRIKTISEFHQLRGLPKPEHPLISVVDYGSIRHTPEFNVTSWTLDFYSISLKRNSAAKMKYGQQDYDFDEGIMFFMAPGQVFSVEINNSLPSIHSGWILLIHPDFLWSTSLAKTIKKYEYFDYSVNEALFLSEKEESTINNIIQNIQLEYHANIDKFSQDIIISQIETLFNYAERFYHRQFITRKKANHQILDRLEVILASYFNSDILTLKGLPTVAYIAGELNVSPNYLSSLLKALTGQSTQQHIHDKLIERAKQKLSTTNLSVSEIAYQLGFEHPQSFSKLFKTKTQVSPLEFRQAFN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
9 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
10 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
11 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
14 2818991444 Filimonas endophytica 3197 Isolate Unclassified
15 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
16 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
17 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
18 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
19 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
20 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
21 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
22 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
23 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
24 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
25 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
26 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
27 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
28 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
29 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
30 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
31 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
32 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
33 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
34 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
35 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
36 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
37 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
38 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
39 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
197 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
198 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
199 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
200 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
264 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
269 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
284 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
288 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
300 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 0
Isolates 8.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.45
Nodule 0
Rhizoplane 0.14
Rhizosphere 68.01
Stem 0
Stem Tuber 0
Unclassified 14.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 SwRhRL2b_contig_3054839 2162886007 Bacteria 3365
3 JGI24740J21852_10002617 3300001979 Bacteria 8105
4 JGI24740J21852_10004228 3300001979 Bacteria 6200
5 JGI24740J21852_10011221 3300001979 Bacteria 3418
6 JGI24739J22299_10010833 3300001989 Bacteria 3376
7 JGI24739J22299_10035090 3300001989 Bacteria 1703
8 JGI25162J39368_1000008 3300002737 Bacteria 397212
9 JGI25162J39368_1000650 3300002737 Bacteria 24576
10 JGI25162J39368_1004624 3300002737 Bacteria 3102
11 JGI25154J39366_1000016 3300002738 Bacteria 255057
12 JGI25154J39366_1000021 3300002738 Bacteria 221559
13 JGI25154J39366_1000028 3300002738 Bacteria 195818
14 JGI25154J39366_1000073 3300002738 Bacteria 92928
15 JGI25154J39366_1007707 3300002738 Unclassified 1447
16 JGI25158J39367_1009303 3300002739 Bacteria 1348
17 JGI25157J39369_1002336 3300002741 Bacteria 4917
18 JGI25157J39369_1006944 3300002741 Bacteria 1676
19 JGI25164J39214_1002804 3300002772 Bacteria 2457
20 JGI25165J46597_1001427 3300003214 Bacteria 12848
21 JGI25165J46597_1001861 3300003214 Bacteria 8710
22 JGI25153J46596_10000412 3300003215 Bacteria 28300
23 JGI25153J46596_10003899 3300003215 Bacteria 8194
24 JGI25153J46596_10003991 3300003215 Bacteria 8066
25 JGI25153J46596_10016074 3300003215 Bacteria 3018
26 rootH1_10049637 3300003316 Bacteria 9342
27 rootH1_10136412 3300003316 Bacteria 2510
28 rootH1_10179979 3300003316 Unclassified 1433
29 rootH2_10006586 3300003320 Bacteria 35799
30 rootH2_10011844 3300003320 Bacteria 47214
31 rootH2_10017356 3300003320 Bacteria 25318
32 rootH2_10017519 3300003320 Bacteria 5939
33 rootH2_10039495 3300003320 Bacteria 12680
34 rootH2_10053271 3300003320 Bacteria 29083
35 rootH2_10059195 3300003320 Bacteria 13284
36 rootL2_10035699 3300003322 Bacteria 8944
37 rootL2_10050185 3300003322 Bacteria 8281
38 rootL2_10051367 3300003322 Bacteria 8904
39 rootL2_10054129 3300003322 Bacteria 16526
40 rootL2_10082053 3300003322 Bacteria 4212
41 rootL2_10198918 3300003322 Bacteria 1208
42 rootL2_10221287 3300003322 Bacteria 3335
43 rootL2_10235423 3300003322 Bacteria 4480
44 rootH1_10007228 3300003316 Bacteria 1529
45 rootH1_10007228 3300003323 Bacteria 16763
46 rootH1_10009799 3300003323 Bacteria 7505
47 rootH1_10012561 3300003323 Bacteria 12653
48 rootH1_10012978 3300003323 Bacteria 27481
49 rootH1_10028162 3300003323 Bacteria 9421
50 rootH1_10029695 3300003323 Bacteria 13788
51 rootH1_10053844 3300003323 Unclassified 3070
52 rootH1_10063994 3300003323 Bacteria 5975
53 rootH1_10073247 3300003323 Bacteria 2152
54 rootH1_10085833 3300003323 Bacteria 12771
55 rootH1_10088871 3300003323 Bacteria 7577
56 rootH1_10107342 3300003323 Bacteria 5548
57 rootH1_10192656 3300003323 Bacteria 3809
58 JGI25160J50197_1004139 3300003354 Bacteria 6322
59 JGI25160J50197_1005252 3300003354 Bacteria 5421
60 JGI25160J50197_1010685 3300003354 Bacteria 3302
61 JGI25160J50197_1015296 3300003354 Bacteria 2525
62 Ga0055526_1001833 3300003771 Bacteria 14701
63 Ga0055526_1005671 3300003771 Bacteria 7087
64 Ga0055528_1000072 3300003790 Bacteria 77661
65 Ga0055528_1000400 3300003790 Bacteria 35185
66 Ga0055530_10000052 3300003791 Bacteria 104501
67 Ga0055531_10000030 3300003794 Bacteria 157459
68 Ga0055531_10000063 3300003794 Bacteria 119938
69 Ga0055531_10000324 3300003794 Bacteria 47052
70 Ga0065165_1000038 3300005262 Bacteria 211664
71 Ga0065165_1000052 3300005262 Bacteria 192010
72 Ga0065165_1000104 3300005262 Bacteria 140410
73 Ga0065165_1002831 3300005262 Bacteria 13547
74 Ga0065165_1008355 3300005262 Bacteria 4864
75 Ga0065165_1009648 3300005262 Bacteria 4292
76 Ga0065165_1061846 3300005262 Bacteria 1023
77 Ga0065714_10004857 3300005288 Bacteria 5363
78 Ga0065714_10064427 3300005288 Bacteria 167245
79 Ga0065714_10064627 3300005288 Bacteria 27603
80 Ga0065714_10065152 3300005288 Bacteria 12474
81 Ga0065714_10065174 3300005288 Bacteria 12226
82 Ga0065714_10072760 3300005288 Bacteria 3306
83 Ga0065714_10073661 3300005288 Bacteria 3151
84 Ga0065704_10070140 3300005289 Bacteria 482257
85 Ga0065704_10071425 3300005289 Bacteria 11233
86 Ga0065704_10071791 3300005289 Bacteria 9938
87 Ga0065704_10074739 3300005289 Bacteria 6030
88 Ga0065715_10116786 3300005293 Bacteria 2369
89 Ga0070676_10000259 3300005328 Bacteria 23074
90 Ga0070683_100123265 3300005329 Bacteria 2449
91 Ga0070670_100215176 3300005331 Bacteria 1671
92 Ga0068869_100119585 3300005334 Bacteria 2013
93 Ga0070666_10000041 3300005335 Bacteria 112410
94 Ga0068868_100021703 3300005338 Bacteria 4838
95 Ga0068868_100046305 3300005338 Bacteria 3404
96 Ga0068868_100061094 3300005338 Bacteria 2985
97 Ga0068868_100062299 3300005338 Bacteria 2956
98 Ga0070668_100301027 3300005347 Bacteria 1345
99 Ga0070668_100440224 3300005347 Bacteria 1119
100 Ga0070669_100016646 3300005353 Bacteria 5248
101 Ga0070669_100059425 3300005353 Bacteria 2807
102 Ga0070671_100097921 3300005355 Bacteria 2460
103 Ga0070671_100236417 3300005355 Bacteria 1551
104 Ga0070673_100370828 3300005364 Bacteria 1274
105 Ga0070659_100176570 3300005366 Bacteria 1751
106 Ga0070667_100027616 3300005367 Bacteria 4722
107 Ga0070667_100037449 3300005367 Bacteria 4066
108 Ga0070678_100258702 3300005456 Bacteria 1463
109 Ga0070662_100000449 3300005457 Bacteria 24260
110 Ga0070662_100168923 3300005457 Bacteria 1716
111 Ga0070681_10291296 3300005458 Bacteria 1542
112 Ga0068867_100173810 3300005459 Bacteria 1708
113 Ga0070698_100027821 3300005471 Bacteria 5875
114 Ga0070698_100183280 3300005471 Bacteria 2032
115 Ga0070699_100046903 3300005518 Bacteria 3739
116 Ga0070684_100092912 3300005535 Bacteria 2685
117 Ga0070697_100328973 3300005536 Bacteria 1317
118 Ga0068853_100021248 3300005539 Bacteria 5408
119 Ga0068853_100061766 3300005539 Bacteria 3241
120 Ga0068853_100067715 3300005539 Bacteria 3102
121 Ga0068853_100095697 3300005539 Bacteria 2619
122 Ga0068853_100112138 3300005539 Bacteria 2424
123 Ga0068853_100155890 3300005539 Bacteria 2058
124 Ga0068853_100169231 3300005539 Bacteria 1976
125 Ga0070665_100000008 3300005548 Bacteria 606341
126 Ga0070665_100000125 3300005548 Bacteria 146809
127 Ga0070665_100000205 3300005548 Bacteria 103515
128 Ga0070704_100152645 3300005549 Bacteria 1818
129 Ga0068855_100011059 3300005563 Bacteria 10888
130 Ga0068855_100025193 3300005563 Bacteria 7122
131 Ga0068855_100246644 3300005563 Bacteria 1993
132 Ga0068855_100360068 3300005563 Bacteria 1601
133 Ga0068857_100031624 3300005577 Bacteria 4677
134 Ga0068857_100044420 3300005577 Bacteria 3941
135 Ga0068857_100046935 3300005577 Bacteria 3834
136 Ga0068857_100268592 3300005577 Bacteria 1567
137 Ga0068854_100035592 3300005578 Bacteria 3486
138 Ga0068856_100002280 3300005614 Bacteria 19791
139 Ga0068856_100016440 3300005614 Bacteria 7160
140 Ga0068856_100164100 3300005614 Bacteria 2232
141 Ga0068852_100009844 3300005616 Bacteria 7111
142 Ga0068852_100041753 3300005616 Bacteria 3878
143 Ga0068852_100091236 3300005616 Bacteria 2726
144 Ga0068852_100643462 3300005616 Bacteria 1067
145 Ga0068859_100000083 3300005617 Bacteria 87079
146 Ga0068859_100007759 3300005617 Bacteria 10897
147 Ga0068864_100208169 3300005618 Bacteria 1800
148 Ga0068864_100237753 3300005618 Bacteria 1687
149 Ga0068851_10012190 3300005834 Bacteria 4049
150 Ga0068851_10064575 3300005834 Bacteria 1882
151 Ga0068863_100121661 3300005841 Bacteria 2489
152 Ga0068863_100216998 3300005841 Bacteria 1842
153 Ga0068858_100050970 3300005842 Bacteria 3830
154 Ga0068860_100018491 3300005843 Bacteria 6777
155 Ga0068860_100018710 3300005843 Bacteria 6734
156 Ga0068860_100043649 3300005843 Bacteria 4276
157 Ga0081539_10001245 3300005985 Bacteria 45262
158 Ga0075366_10000235 3300006195 Bacteria 24550
159 Ga0075366_10078244 3300006195 Bacteria 1974
160 Ga0097621_100000288 3300006237 Bacteria 33839
161 Ga0097621_100012310 3300006237 Bacteria 6334
162 Ga0097621_100098442 3300006237 Bacteria 2457
163 Ga0097621_100240654 3300006237 Bacteria 1582
164 Ga0068871_100000592 3300006358 Bacteria 24903
165 Ga0068871_100144233 3300006358 Bacteria 2026
166 Ga0068871_100206970 3300006358 Bacteria 1696
167 Ga0075430_100146602 3300006846 Bacteria 1966
168 Ga0075433_10173523 3300006852 Bacteria 1918
169 Ga0068865_100000029 3300006881 Bacteria 91199
170 Ga0097620_100000083 3300006931 Bacteria 87079
171 Ga0097620_100007759 3300006931 Bacteria 10897
172 Ga0105244_10016568 3300009036 Bacteria 4195
173 Ga0105240_10000020 3300009093 Bacteria 399699
174 Ga0105240_10000117 3300009093 Bacteria 165286
175 Ga0105240_10001228 3300009093 Bacteria 44551
176 Ga0105240_10005598 3300009093 Bacteria 18660
177 Ga0105240_10078938 3300009093 Bacteria 4052
178 Ga0105240_10085605 3300009093 Bacteria 3862
179 Ga0105240_10125427 3300009093 Bacteria 3086
180 Ga0105240_10295014 3300009093 Bacteria 1857
181 Ga0105240_10325225 3300009093 Bacteria 1751
182 Ga0105245_10182363 3300009098 Bacteria 2006
183 Ga0105247_10005474 3300009101 Bacteria 8001
184 Ga0114129_10005726 3300009147 Bacteria 17605
185 Ga0105243_10065078 3300009148 Bacteria 2927
186 Ga0105241_10000217 3300009174 Bacteria 43160
187 Ga0105241_10001084 3300009174 Bacteria 20714
188 Ga0105241_10001790 3300009174 Bacteria 16323
189 Ga0105241_10009176 3300009174 Bacteria 7280
190 Ga0105241_10036543 3300009174 Bacteria 3697
191 Ga0105241_10134387 3300009174 Bacteria 2006
192 Ga0105241_10252989 3300009174 Bacteria 1494
193 Ga0105241_10491639 3300009174 Bacteria 1092
194 Ga0105242_10014823 3300009176 Bacteria 6038
195 Ga0105237_10000087 3300009545 Bacteria 124934
196 Ga0105237_10003016 3300009545 Bacteria 20311
197 Ga0105237_10007928 3300009545 Bacteria 11574
198 Ga0105237_10009739 3300009545 Bacteria 10280
199 Ga0105237_10016009 3300009545 Bacteria 7797
200 Ga0105237_10022897 3300009545 Bacteria 6407
201 Ga0105237_10042402 3300009545 Bacteria 4588
202 Ga0105237_10345398 3300009545 Bacteria 1492
203 Ga0105238_10003134 3300009551 Bacteria 16503
204 Ga0105238_10171917 3300009551 Bacteria 2143
205 Ga0105239_10000068 3300010375 Bacteria 144666
206 Ga0105239_10000456 3300010375 Bacteria 59689
207 Ga0105239_10000786 3300010375 Bacteria 45039
208 Ga0105239_10001610 3300010375 Bacteria 29834
209 Ga0105239_10013703 3300010375 Bacteria 9004
210 Ga0105239_10028344 3300010375 Bacteria 6160
211 Ga0105239_10034714 3300010375 Bacteria 5540
212 Ga0105239_10049416 3300010375 Bacteria 4612
213 Ga0105239_10050627 3300010375 Bacteria 4555
214 Ga0105239_10138372 3300010375 Bacteria 2712
215 Ga0105239_10144075 3300010375 Bacteria 2656
216 Ga0105239_10150850 3300010375 Bacteria 2594
217 Ga0105239_10188654 3300010375 Bacteria 2308
218 Ga0105239_10251180 3300010375 Bacteria 1986
219 Ga0105239_10423948 3300010375 Bacteria 1507
220 Ga0105246_10012789 3300011119 Bacteria 5247
221 Ga0105246_10037939 3300011119 Bacteria 3236
222 Ga0105246_10046798 3300011119 Bacteria 2952
223 Ga0105246_10107279 3300011119 Bacteria 2045
224 Ga0157373_10000299 3300013100 Bacteria 40111
225 Ga0157373_10006608 3300013100 Bacteria 8650
226 Ga0157373_10012068 3300013100 Bacteria 6350
227 Ga0157373_10028139 3300013100 Bacteria 4055
228 Ga0157373_10096414 3300013100 Bacteria 2082
229 Ga0157371_10023632 3300013102 Bacteria 4496
230 Ga0157371_10062619 3300013102 Bacteria 2637
231 Ga0157371_10070727 3300013102 Bacteria 2470
232 Ga0157371_10075852 3300013102 Bacteria 2381
233 Ga0157371_10111021 3300013102 Bacteria 1946
234 Ga0157370_10000022 3300013104 Bacteria 163793
235 Ga0157370_10007911 3300013104 Bacteria 11516
236 Ga0157370_10064592 3300013104 Bacteria 3465
237 Ga0157370_10147948 3300013104 Bacteria 2187
238 Ga0157370_10161040 3300013104 Bacteria 2088
239 Ga0157370_10466359 3300013104 Bacteria 1161
240 Ga0157369_10000050 3300013105 Bacteria 167294
241 Ga0157369_10001327 3300013105 Bacteria 30659
242 Ga0157369_10010087 3300013105 Bacteria 10786
243 Ga0157374_10000887 3300013296 Bacteria 26128
244 Ga0157378_10001954 3300013297 Bacteria 18489
245 Ga0157378_10013014 3300013297 Bacteria 7276
246 Ga0157378_10014463 3300013297 Bacteria 6908
247 Ga0157378_10181795 3300013297 Bacteria 1979
248 Ga0163162_10000005 3300013306 Bacteria 447195
249 Ga0163162_10000208 3300013306 Bacteria 54338
250 Ga0163162_10000993 3300013306 Bacteria 26422
251 Ga0163162_10004686 3300013306 Bacteria 13188
252 Ga0163162_10414304 3300013306 Bacteria 1480
253 Ga0157372_10001659 3300013307 Bacteria 24131
254 Ga0157372_10017207 3300013307 Bacteria 7761
255 Ga0157372_10038047 3300013307 Bacteria 5309
256 Ga0157372_10081439 3300013307 Bacteria 3664
257 Ga0157372_10104752 3300013307 Bacteria 3234
258 Ga0157372_10137568 3300013307 Bacteria 2814
259 Ga0157372_10501543 3300013307 Bacteria 1415
260 Ga0157375_10000052 3300013308 Bacteria 130032
261 Ga0157375_10015943 3300013308 Bacteria 6740
262 Ga0157375_10055343 3300013308 Bacteria 3911
263 Ga0163163_10084736 3300014325 Bacteria 3176
264 Ga0182008_10000290 3300014497 Bacteria 39578
265 Ga0157379_10128544 3300014968 Bacteria 2280
266 Ga0157376_10034329 3300014969 Bacteria 4095
267 Ga0157376_10353530 3300014969 Bacteria 1407
268 Ga0182006_1001457 3300015261 Bacteria 14254
269 Ga0182006_1004000 3300015261 Bacteria 7365
270 Ga0182006_1006515 3300015261 Bacteria 5418
271 Ga0182007_10000008 3300015262 Bacteria 332953
272 Ga0182005_1000120 3300015265 Bacteria 57067
273 Ga0182005_1000200 3300015265 Bacteria 40796
274 Ga0183373_1001 3300015682 Bacteria 1410374
275 Ga0163161_10000994 3300017792 Bacteria 21662
276 Ga0163161_10007329 3300017792 Bacteria 7613
277 Ga0163161_10007893 3300017792 Bacteria 7362
278 Ga0163161_10102073 3300017792 Bacteria 2136
279 Ga0163161_10168882 3300017792 Bacteria 1671
280 Ga0209436_100514 3300025208 Bacteria 16873
281 Ga0209436_102577 3300025208 Bacteria 5331
282 Ga0209563_104145 3300025230 Bacteria 2824
283 Ga0207427_100152 3300025231 Bacteria 78389
284 Ga0209437_100030 3300025233 Bacteria 532466
285 Ga0209437_100043 3300025233 Bacteria 440454
286 Ga0209437_100164 3300025233 Bacteria 145317
287 Ga0209258_103672 3300025242 Bacteria 3202
288 Ga0209646_1000003 3300025246 Bacteria 1160860
289 Ga0209646_1000006 3300025246 Bacteria 694084
290 Ga0209646_1000050 3300025246 Bacteria 296599
291 Ga0209646_1000158 3300025246 Bacteria 92980
292 Ga0209646_1002384 3300025246 Bacteria 4205
293 Ga0209646_1003925 3300025246 Bacteria 2814
294 Ga0209026_1000168 3300025250 Bacteria 100138
295 Ga0209026_1000185 3300025250 Bacteria 91252
296 Ga0209026_1000202 3300025250 Bacteria 82517
297 Ga0209026_1000240 3300025250 Bacteria 71671
298 Ga0209148_1000230 3300025254 Bacteria 91940
299 Ga0209233_1000038 3300025261 Bacteria 548972
300 Ga0209673_1000130 3300025273 Bacteria 163870
301 Ga0209673_1000226 3300025273 Bacteria 111427
302 Ga0209130_1013317 3300025284 Bacteria 2111
303 Ga0209676_1000310 3300025292 Bacteria 95646
304 Ga0209564_1001138 3300025295 Bacteria 31243
305 Ga0209564_1001327 3300025295 Bacteria 26438
306 Ga0209564_1001627 3300025295 Bacteria 21791
307 Ga0209564_1006788 3300025295 Bacteria 6057
308 Ga0209758_1001017 3300025297 Bacteria 37093
309 Ga0209758_1001281 3300025297 Bacteria 31000
310 Ga0209758_1002179 3300025297 Bacteria 20536
311 Ga0209758_1004653 3300025297 Bacteria 11240
312 Ga0209758_1013871 3300025297 Bacteria 4345
313 Ga0209050_1000125 3300025298 Bacteria 189641
314 Ga0209050_1000530 3300025298 Bacteria 63406
315 Ga0209050_1008683 3300025298 Bacteria 5363
316 Ga0207426_1000135 3300025302 Bacteria 202216
317 Ga0207426_1000175 3300025302 Bacteria 160332
318 Ga0207426_1000293 3300025302 Bacteria 98805
319 Ga0207426_1000452 3300025302 Bacteria 65182
320 Ga0207426_1000546 3300025302 Bacteria 52783
321 Ga0207426_1000882 3300025302 Bacteria 30999
322 Ga0207426_1001549 3300025302 Bacteria 18689
323 Ga0207426_1009511 3300025302 Bacteria 3841
324 Ga0207426_1012466 3300025302 Bacteria 3191
325 Ga0207426_1017237 3300025302 Bacteria 2572
326 Ga0209051_1007944 3300025303 Bacteria 5710
327 Ga0209257_1000008 3300025304 Bacteria 1294570
328 Ga0209257_1000013 3300025304 Bacteria 1047305
329 Ga0209257_1000023 3300025304 Bacteria 753019
330 Ga0209257_1002919 3300025304 Bacteria 15767
331 Ga0209257_1004595 3300025304 Bacteria 10517
332 Ga0207710_10003963 3300025900 Bacteria 6527
333 Ga0207680_10000634 3300025903 Bacteria 16562
334 Ga0207680_10004822 3300025903 Bacteria 6415
335 Ga0207647_10000117 3300025904 Bacteria 61849
336 Ga0207647_10002941 3300025904 Bacteria 12819
337 Ga0207647_10093199 3300025904 Bacteria 1795
338 Ga0207647_10154860 3300025904 Bacteria 1338
339 Ga0207645_10001758 3300025907 Bacteria 17574
340 Ga0207705_10031606 3300025909 Bacteria 3780
341 Ga0207654_10000501 3300025911 Bacteria 22385
342 Ga0207654_10002034 3300025911 Bacteria 10375
343 Ga0207654_10007288 3300025911 Bacteria 5574
344 Ga0207654_10008332 3300025911 Bacteria 5236
345 Ga0207654_10039789 3300025911 Bacteria 2647
346 Ga0207654_10259016 3300025911 Bacteria 1169
347 Ga0207695_10000020 3300025913 Bacteria 723025
348 Ga0207695_10000077 3300025913 Bacteria 307107
349 Ga0207695_10001743 3300025913 Bacteria 34552
350 Ga0207695_10005927 3300025913 Bacteria 16016
351 Ga0207695_10019624 3300025913 Bacteria 7777
352 Ga0207695_10059122 3300025913 Bacteria 3977
353 Ga0207695_10223985 3300025913 Bacteria 1787
354 Ga0207695_10278830 3300025913 Bacteria 1566
355 Ga0207671_10000096 3300025914 Bacteria 135750
356 Ga0207671_10001505 3300025914 Bacteria 26868
357 Ga0207671_10001628 3300025914 Bacteria 25558
358 Ga0207671_10008266 3300025914 Bacteria 8852
359 Ga0207671_10015560 3300025914 Bacteria 5950
360 Ga0207671_10022112 3300025914 Bacteria 4813
361 Ga0207671_10237629 3300025914 Bacteria 1431
362 Ga0207660_10162444 3300025917 Bacteria 1724
363 Ga0207657_10004524 3300025919 Bacteria 14691
364 Ga0207657_10012983 3300025919 Bacteria 8187
365 Ga0207657_10117206 3300025919 Bacteria 2193
366 Ga0207652_10000180 3300025921 Bacteria 66974
367 Ga0207652_10071695 3300025921 Bacteria 3011
368 Ga0207681_10129380 3300025923 Bacteria 1864
369 Ga0207681_10161117 3300025923 Bacteria 1691
370 Ga0207694_10175254 3300025924 Bacteria 1738
371 Ga0207694_10213769 3300025924 Bacteria 1571
372 Ga0207644_10074788 3300025931 Bacteria 2487
373 Ga0207690_10040839 3300025932 Bacteria 3036
374 Ga0207706_10000044 3300025933 Bacteria 123576
375 Ga0207706_10207900 3300025933 Bacteria 1716
376 Ga0207686_10063662 3300025934 Bacteria 2346
377 Ga0207709_10060206 3300025935 Bacteria 2366
378 Ga0207704_10000144 3300025938 Bacteria 38148
379 Ga0207691_10058089 3300025940 Bacteria 3519
380 Ga0207691_10249200 3300025940 Bacteria 1534
381 Ga0207689_10000746 3300025942 Bacteria 31196
382 Ga0207661_10158549 3300025944 Bacteria 1962
383 Ga0207667_10003555 3300025949 Bacteria 19273
384 Ga0207667_10005479 3300025949 Bacteria 15471
385 Ga0207667_10006819 3300025949 Bacteria 13800
386 Ga0207667_10015804 3300025949 Bacteria 8554
387 Ga0207667_10073213 3300025949 Bacteria 3560
388 Ga0207667_10319701 3300025949 Bacteria 1585
389 Ga0207651_10020505 3300025960 Bacteria 3991
390 Ga0207651_10368491 3300025960 Bacteria 1214
391 Ga0207712_10014860 3300025961 Bacteria 5013
392 Ga0207668_10151722 3300025972 Bacteria 1795
393 Ga0207668_10354876 3300025972 Bacteria 1227
394 Ga0207658_10011346 3300025986 Bacteria 6063
395 Ga0207677_10010714 3300026023 Bacteria 5196
396 Ga0207677_10046737 3300026023 Bacteria 2901
397 Ga0207677_10061359 3300026023 Bacteria 2603
398 Ga0207703_10004577 3300026035 Bacteria 11335
399 Ga0207639_10010820 3300026041 Bacteria 6326
400 Ga0207639_10024535 3300026041 Bacteria 4365
401 Ga0207639_10109045 3300026041 Bacteria 2252
402 Ga0207639_10137008 3300026041 Bacteria 2035
403 Ga0207639_10149689 3300026041 Bacteria 1954
404 Ga0207702_10040257 3300026078 Bacteria 3918
405 Ga0207702_10103048 3300026078 Bacteria 2523
406 Ga0207702_10501010 3300026078 Bacteria 1184
407 Ga0207641_10001993 3300026088 Bacteria 19491
408 Ga0207648_10024015 3300026089 Bacteria 5449
409 Ga0207676_10219125 3300026095 Bacteria 1693
410 Ga0207674_10045323 3300026116 Bacteria 4524
411 Ga0207674_10087632 3300026116 Bacteria 3106
412 Ga0207674_10098720 3300026116 Bacteria 2903
413 Ga0207674_10176237 3300026116 Bacteria 2090
414 Ga0207674_10330946 3300026116 Bacteria 1473
415 Ga0207683_10012346 3300026121 Bacteria 7288
416 Ga0207698_10140892 3300026142 Bacteria 2077
417 Ga0207698_10163885 3300026142 Bacteria 1948
418 Ga0207698_10170501 3300026142 Bacteria 1915
419 Ga0268266_10000016 3300028379 Bacteria 629101
420 Ga0268266_10000132 3300028379 Bacteria 145563
421 Ga0268266_10000333 3300028379 Bacteria 74168
422 Ga0268264_10006483 3300028381 Bacteria 9853
423 Ga0268264_10009773 3300028381 Bacteria 7941
424 Ga0268264_10121368 3300028381 Bacteria 2303
425 Ga0265334_10019771 3300028573 Bacteria 2765
426 Ga0265334_10021766 3300028573 Unclassified 2617
427 Ga0307515_10000299 3300028794 Bacteria 122087
428 Ga0307515_10013796 3300028794 Bacteria 15058
429 Ga0307515_10102161 3300028794 Bacteria 3452
430 Ga0265338_10028957 3300028800 Bacteria 5507
431 Ga0265338_10135871 3300028800 Bacteria 1933
432 Ga0265338_10280726 3300028800 Bacteria 1217
433 Ga0265338_10303418 3300028800 Bacteria 1160
434 Ga0265324_10071972 3300029957 Unclassified 1178
435 Ga0307511_10000046 3300030521 Bacteria 100284
436 Ga0307511_10000139 3300030521 Bacteria 67385
437 Ga0316177_1055781 3300030731 Bacteria 4311
438 Ga0316177_1062757 3300030731 Bacteria 5195
439 Ga0316177_1203066 3300030731 Bacteria 10306
440 Ga0316176_1023444 3300030732 Bacteria 24481
441 Ga0316176_1070747 3300030732 Bacteria 28508
442 Ga0316176_1114001 3300030732 Bacteria 10292
443 Ga0316179_1094714 3300030734 Bacteria 3658
444 Ga0316183_1073918 3300030742 Bacteria 38322
445 Ga0316183_1079365 3300030742 Bacteria 35752
446 Ga0316183_1211687 3300030742 Bacteria 37631
447 Ga0316181_1015635 3300030744 Bacteria 11896
448 Ga0316181_1220040 3300030744 Bacteria 23387
449 Ga0316181_1258294 3300030744 Bacteria 2228
450 Ga0265330_10039211 3300031235 Unclassified 2105
451 Ga0265331_10011097 3300031250 Bacteria 4943
452 Ga0265327_10000306 3300031251 Bacteria 95199
453 Ga0265327_10104704 3300031251 Bacteria 1360
454 Ga0265316_10057982 3300031344 Unclassified 3018
455 Ga0307509_10048470 3300031507 Bacteria 4562
456 Ga0307509_10053420 3300031507 Bacteria 4309
457 Ga0307408_100005638 3300031548 Bacteria 8368
458 Ga0307408_100066292 3300031548 Bacteria 2651
459 Ga0307408_100124191 3300031548 Bacteria 2004
460 Ga0307405_10000002 3300031731 Bacteria 575196
461 Ga0307405_10091577 3300031731 Bacteria 2015
462 Ga0307413_10000188 3300031824 Bacteria 17709
463 Ga0307410_10000018 3300031852 Bacteria 69156
464 Ga0307410_10006559 3300031852 Bacteria 6291
465 Ga0307406_10000243 3300031901 Bacteria 32852
466 Ga0307406_10000422 3300031901 Bacteria 24633
467 Ga0307406_10013865 3300031901 Bacteria 4627
468 Ga0307406_10291095 3300031901 Bacteria 1250
469 Ga0307407_10000808 3300031903 Bacteria 10373
470 Ga0307407_10070377 3300031903 Bacteria 2079
471 Ga0307412_10000179 3300031911 Bacteria 44961
472 Ga0307414_10000002 3300032004 Bacteria 623006
473 Ga0307414_10000008 3300032004 Bacteria 375832
474 Ga0307414_10000024 3300032004 Bacteria 205727
475 Ga0307414_10002617 3300032004 Bacteria 9467
476 Ga0307414_10008772 3300032004 Bacteria 5765
477 Ga0307414_10024385 3300032004 Bacteria 3857
478 Ga0307411_10000008 3300032005 Bacteria 321575
479 Ga0307411_10001132 3300032005 Bacteria 10430
480 Ga0307411_10001224 3300032005 Bacteria 10202
481 Ga0316583_10049290 3300032133 Bacteria 1483
482 Ga0307510_10010171 3300033180 Bacteria 11185
483 Ga0307510_10015549 3300033180 Bacteria 9002
484 Ga0436361_0292109 3300039447 Bacteria 16952
485 Ga0439447_000827 3300041407 Bacteria 11348
486 Ga0439466_0000400 3300041411 Bacteria 16601
487 Ga0439466_0001202 3300041411 Bacteria 10062
488 Ga0451800_1401227 3300041459 Bacteria 1108
489 Ga0439431_0001837 3300041997 Bacteria 4705
490 Ga0439431_0054950 3300041997 Unclassified 1039
491 Ga0439445_0000048 3300042004 Bacteria 17050
492 Ga0466969_0000282 3300044656 Bacteria 27814
493 Ga0466969_0001133 3300044656 Bacteria 14335
494 Ga0466972_0000077 3300044658 Bacteria 91574
495 Ga0466972_0000235 3300044658 Bacteria 38259
496 Ga0466972_0005859 3300044658 Bacteria 6161
497 Ga0466972_0008131 3300044658 Bacteria 5259
498 Ga0466965_0037929 3300044683 Unclassified 2366
499 Ga0466965_0120426 3300044683 Bacteria 1355
500 Ga0466965_0121953 3300044683 Bacteria 1347
501 Ga0466966_0000014 3300044684 Bacteria 127891
502 Ga0466966_0000147 3300044684 Bacteria 44993
503 Ga0466966_0015812 3300044684 Bacteria 4986
504 Ga0466961_0096155 3300044693 Bacteria 1868
505 Ga0466961_0142401 3300044693 Bacteria 1500
506 Ga0466961_0196348 3300044693 Bacteria 1249
507 Ga0466964_0012685 3300044706 Bacteria 3190
508 Ga0466964_0012905 3300044706 Bacteria 3165
509 Ga0466964_0047540 3300044706 Bacteria 1752
510 Ga0466968_0009531 3300044735 Bacteria 3736
511 Ga0466968_0023808 3300044735 Bacteria 2498
512 Ga0466970_0002985 3300044765 Bacteria 8200
513 Ga0466970_0028608 3300044765 Bacteria 2930
514 Ga0466970_0089820 3300044765 Unclassified 1667
515 Ga0466957_0000474 3300044842 Bacteria 19959
516 Ga0466957_0001027 3300044842 Bacteria 14399
517 Ga0466957_0020301 3300044842 Bacteria 3909
518 Ga0466960_0009625 3300044901 Bacteria 3990
519 Ga0466959_0000003 3300045049 Bacteria 285164
520 Ga0466959_0000011 3300045049 Bacteria 173387
521 Ga0466959_0000013 3300045049 Bacteria 157000
522 Ga0466959_0033002 3300045049 Bacteria 3831
523 Ga0466959_0055694 3300045049 Bacteria 2886
524 Ga0466959_0081890 3300045049 Bacteria 2326
525 Ga0495627_002044 3300046453 Bacteria 10345
526 Ga0495627_010661 3300046453 Bacteria 3331
527 Ga0495638_0000003 3300046460 Bacteria 888792
528 Ga0495638_0000050 3300046460 Bacteria 206131
529 Ga0495638_0033930 3300046460 Bacteria 3260
530 Ga0495638_0042600 3300046460 Bacteria 2867
531 Ga0495650_0010640 3300046471 Bacteria 5116
532 Ga0495585_0000902 3300046492 Bacteria 25158
533 Ga0495606_0000142 3300046507 Bacteria 123277
534 Ga0495606_0003060 3300046507 Bacteria 18234
535 Ga0495606_0007133 3300046507 Bacteria 10100
536 Ga0495606_0012300 3300046507 Bacteria 6882
537 Ga0495606_0013090 3300046507 Bacteria 6589
538 Ga0495610_0000747 3300046512 Bacteria 30695
539 Ga0495610_0022799 3300046512 Bacteria 3415
540 Ga0495616_0010696 3300046513 Bacteria 5298
541 Ga0495632_0008332 3300046519 Bacteria 6374
542 Ga0495648_0012417 3300046524 Bacteria 6356
543 Ga0495648_0017408 3300046524 Bacteria 5136
544 Ga0495609_0000480 3300046538 Bacteria 32078
545 Ga0495609_0103927 3300046538 Bacteria 1229
546 Ga0495633_0000159 3300046558 Bacteria 88400
547 Ga0495633_0000263 3300046558 Bacteria 62381
548 Ga0495633_0001455 3300046558 Bacteria 18369
549 Ga0495633_0003178 3300046558 Bacteria 11099
550 Ga0495668_0000003 3300046616 Bacteria 695023
551 Ga0495611_0001790 3300046648 Bacteria 10332
552 Ga0495611_0043233 3300046648 Bacteria 2014
553 Ga0495625_0000663 3300046660 Bacteria 49012
554 Ga0495625_0001290 3300046660 Bacteria 31476
555 Ga0495625_0003418 3300046660 Bacteria 15856
556 Ga0495625_0011872 3300046660 Bacteria 7074
557 Ga0495625_0013086 3300046660 Bacteria 6684
558 Ga0495625_0030083 3300046660 Bacteria 4055
559 Ga0495625_0043716 3300046660 Bacteria 3248
560 Ga0495625_0046382 3300046660 Bacteria 3136
561 Ga0495661_0024459 3300046665 Bacteria 3909
562 Ga0495658_0047518 3300046683 Bacteria 2417
563 Ga0495649_0037185 3300046694 Bacteria 2673
564 Ga0495660_0009167 3300046810 Bacteria 5780
565 Ga0495672_0088216 3300047320 Bacteria 1710
566 Ga0495672_0128183 3300047320 Bacteria 1338
567 Ga0495687_002423 3300047443 Bacteria 15009
568 Ga0495687_018255 3300047443 Bacteria 3470
569 Ga0495686_0000040 3300047472 Bacteria 301210
570 Ga0495686_0000079 3300047472 Bacteria 202668
571 Ga0495686_0000355 3300047472 Bacteria 74939
572 Ga0495686_0000524 3300047472 Bacteria 55256
573 Ga0495686_0000607 3300047472 Bacteria 49581
574 Ga0495686_0022398 3300047472 Unclassified 4181
575 Ga0495686_0043016 3300047472 Bacteria 2868
576 Ga0495686_0198909 3300047472 Bacteria 1151
577 Ga0496121_0000008 3300048924 Bacteria 843593
578 Ga0496122_0001254 3300048925 Bacteria 42541
579 Ga0496123_0002075 3300048926 Bacteria 25802
580 Ga0496125_0008240 3300048928 Bacteria 10951
581 Ga0496125_0011846 3300048928 Bacteria 8688
582 Ga0496126_0014030 3300048929 Bacteria 8121
583 Ga0496126_0018056 3300048929 Bacteria 7008
584 Ga0496126_0026178 3300048929 Bacteria 5597
585 Ga0496126_0367928 3300048929 Bacteria 1173
586 Ga0495678_016614 3300049459 Bacteria 3360
587 Ga0495678_040446 3300049459 Bacteria 1874
588 Ga0501034_0213057 3300049571 Bacteria 1886
589 Ga0501070_0063907 3300049586 Bacteria 3049
590 Ga0501070_0242689 3300049586 Unclassified 1474
591 Ga0501070_0402726 3300049586 Bacteria 1106
592 Ga0501236_001334 3300049670 Bacteria 2802
593 Ga0501238_000293 3300049671 Bacteria 6584
594 Ga0501238_000427 3300049671 Bacteria 5002
595 Ga0501225_0000389 3300049705 Bacteria 13834
596 Ga0501225_0014746 3300049705 Bacteria 2180
597 Ga0501080_0281275 3300049742 Bacteria 1512
598 Ga0501083_0092236 3300049744 Bacteria 1999
599 Ga0501241_001093 3300049758 Bacteria 5707
600 Ga0501241_005584 3300049758 Bacteria 2342
601 Ga0501241_010875 3300049758 Bacteria 1653
602 Ga0501264_000679 3300049761 Bacteria 4668
603 Ga0501044_0072765 3300049823 Bacteria 3495
604 Ga0501044_0293412 3300049823 Bacteria 1557
605 nmdc:mga0k408_22188_c2 3300050493 Bacteria 1646
606 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
607 nmdc:mga05p37_29731_c1 3300050507 Bacteria 6667
608 Ga0500578_0000003 3300053086 Bacteria 266033
609 Ga0500578_0000312 3300053086 Bacteria 59640
610 Ga0500578_0001042 3300053086 Bacteria 30296
611 Ga0500578_0180556 3300053086 Bacteria 1301
612 Ga0500578_0292207 3300053086 Bacteria 969
613 Ga0500644_0000415 3300053088 Bacteria 20101
614 Ga0500583_0001157 3300053092 Bacteria 7520
615 Ga0500583_0005578 3300053092 Unclassified 4235
616 Ga0500583_0027619 3300053092 Unclassified 2452
617 Ga0500651_0000303 3300053093 Bacteria 28480
618 Ga0500562_000066 3300053108 Bacteria 51218
619 Ga0500592_001839 3300053116 Bacteria 3420
620 Ga0500594_0007676 3300053118 Bacteria 2446
621 Ga0500608_027912 3300053122 Bacteria 2661
622 Ga0500618_000026 3300053125 Bacteria 148672
623 Ga0500642_0090282 3300053130 Bacteria 1415
624 Ga0500652_012834 3300053131 Bacteria 2953
625 Ga0500652_030618 3300053131 Bacteria 2105
626 Ga0500655_011923 3300053133 Bacteria 1579
627 Ga0500658_0000002 3300053134 Bacteria 548440
628 Ga0500568_0038214 3300053139 Bacteria 1943
629 Ga0500568_0072145 3300053139 Bacteria 1321
630 Ga0500588_0000391 3300053146 Bacteria 6835
631 Ga0500589_038312 3300053147 Unclassified 2238
632 Ga0500604_0010616 3300053151 Bacteria 2465
633 Ga0500616_0013208 3300053153 Bacteria 4806
634 Ga0500616_0048643 3300053153 Bacteria 2247
635 Ga0500616_0060369 3300053153 Bacteria 1966
636 Ga0500616_0090181 3300053153 Bacteria 1520
637 Ga0500622_0000034 3300053156 Bacteria 187647
638 Ga0500622_0000051 3300053156 Bacteria 145514
639 Ga0500622_0000213 3300053156 Bacteria 61430
640 Ga0500622_0001051 3300053156 Bacteria 23014
641 Ga0500622_0001201 3300053156 Bacteria 21308
642 Ga0500622_0001368 3300053156 Bacteria 19678
643 Ga0500622_0001589 3300053156 Bacteria 17882
644 Ga0500622_0027948 3300053156 Bacteria 2972
645 Ga0500622_0034172 3300053156 Bacteria 2664
646 Ga0500633_0000454 3300053160 Bacteria 6464
647 Ga0500633_0002778 3300053160 Unclassified 3680
648 Ga0500636_0014649 3300053177 Bacteria 4611
649 Ga0500637_0154862 3300053178 Bacteria 1323
650 Ga0500645_010433 3300053730 Bacteria 3075
651 Ga0501084_0028092 3300054114 Bacteria 4701
652 Ga0500661_005951 3300055283 Bacteria 2273
653 Ga0500661_009524 3300055283 Bacteria 1776
654 Ga0500661_031200 3300055283 Unclassified 940
655 Ga0466962_0024349 3300061719 Bacteria 2908
656 Ga0466962_0100937 3300061719 Bacteria 1386

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0242689 Ga0501070_0242689_663_1463 248
2 3300009036 Ga0105244_10016568 Ga0105244_100165681 254
3 3300053156 Ga0500622_0000213 Ga0500622_0000213_45194_46048 255
4 3300025972 Ga0207668_10151722 Ga0207668_101517221 256
5 3300053156 Ga0500622_0001201 Ga0500622_0001201_20005_20913 257
6 3300003322 rootL2_10050185 rootL2_100501852 262
7 3300055283 Ga0500661_005951 Ga0500661_005951_273_1130 265
8 3300046660 Ga0495625_0011872 Ga0495625_0011872_3825_4631 267
9 3300005262 Ga0065165_1009648 Ga0065165_10096482 268
10 3300025208 Ga0209436_102577 Ga0209436_1025773 268
11 3300025302 Ga0207426_1012466 Ga0207426_10124663 268
12 3300010375 Ga0105239_10144075 Ga0105239_101440753 269
13 3300032004 Ga0307414_10002617 Ga0307414_100026178 270
14 3300041997 Ga0439431_0001837 Ga0439431_0001837_3395_4249 271
15 3300046507 Ga0495606_0007133 Ga0495606_0007133_9250_10068 271
16 3300053086 Ga0500578_0292207 Ga0500578_0292207_112_933 271
17 3300005288 Ga0065714_10064427 Ga0065714_1006442745 272
18 3300030731 Ga0316177_1203066 Ga0316177_12030665 272
19 3300030732 Ga0316176_1070747 Ga0316176_10707479 272
20 3300055283 Ga0500661_031200 Ga0500661_031200_40_864 273
21 3300013104 Ga0157370_10466359 Ga0157370_104663591 274
22 3300041459 Ga0451800_1401227 Ga0451800_1401227_269_1093 274
23 3300001989 JGI24739J22299_10035090 JGI24739J22299_100350902 275
24 3300009174 Ga0105241_10252989 Ga0105241_102529892 275
25 3300015682 Ga0183373_1001 Ga0183373_100151 275
26 3300025242 Ga0209258_103672 Ga0209258_1036724 275
27 3300032004 Ga0307414_10000024 Ga0307414_1000002494 275
28 3300046524 Ga0495648_0012417 Ga0495648_0012417_5475_6305 275
29 3300053130 Ga0500642_0090282 Ga0500642_0090282_33_863 275
30 3300005353 Ga0070669_100016646 Ga0070669_1000166461 276
31 3300025923 Ga0207681_10161117 Ga0207681_101611172 276
32 3300030742 Ga0316183_1073918 Ga0316183_107391817 276
33 3300030744 Ga0316181_1015635 Ga0316181_10156359 276
34 3300003323 rootH1_10053844 rootH1_100538442 278
35 3300005289 Ga0065704_10071425 Ga0065704_100714259 279
36 3300015265 Ga0182005_1000120 Ga0182005_100012040 279
37 3300005289 Ga0065704_10074739 Ga0065704_100747394 280
38 2162886007 SwRhRL2b_contig_3054839 SwRhRL2b_0180.00006100 281
39 3300009545 Ga0105237_10000087 Ga0105237_1000008768 281
40 3300010375 Ga0105239_10000068 Ga0105239_1000006833 281
41 3300011119 Ga0105246_10037939 Ga0105246_100379391 281
42 3300013100 Ga0157373_10006608 Ga0157373_100066088 281
43 3300013105 Ga0157369_10000050 Ga0157369_10000050119 281
44 3300015262 Ga0182007_10000008 Ga0182007_10000008291 281
45 3300041997 Ga0439431_0054950 Ga0439431_0054950_137_991 281
46 3300046519 Ga0495632_0008332 Ga0495632_0008332_5128_5982 281
47 3300046558 Ga0495633_0003178 Ga0495633_0003178_4769_5623 281
48 3300046660 Ga0495625_0003418 Ga0495625_0003418_6416_7270 281
49 3300053092 Ga0500583_0005578 Ga0500583_0005578_961_1815 281
50 3300053131 Ga0500652_012834 Ga0500652_012834_64_918 281
51 3300053133 Ga0500655_011923 Ga0500655_011923_678_1532 281
52 3300053139 Ga0500568_0038214 Ga0500568_0038214_986_1840 281
53 3300047472 Ga0495686_0022398 Ga0495686_0022398_630_1538 282
54 3300053156 Ga0500622_0001368 Ga0500622_0001368_6207_7115 282
55 3300049586 Ga0501070_0402726 Ga0501070_0402726_80_988 284
56 3300049742 Ga0501080_0281275 Ga0501080_0281275_486_1394 284
57 3300049744 Ga0501083_0092236 Ga0501083_0092236_119_1027 284
58 3300049823 Ga0501044_0072765 Ga0501044_0072765_1214_2122 284
59 3300054114 Ga0501084_0028092 Ga0501084_0028092_3359_4267 284
60 3300044656 Ga0466969_0000282 Ga0466969_0000282_14833_15693 285
61 3300044684 Ga0466966_0000147 Ga0466966_0000147_3965_4825 285
62 3300044693 Ga0466961_0096155 Ga0466961_0096155_657_1517 285
63 3300045049 Ga0466959_0000003 Ga0466959_0000003_188741_189601 285
64 3300005563 Ga0068855_100360068 Ga0068855_1003600682 286
65 3300005577 Ga0068857_100031624 Ga0068857_1000316245 286
66 3300005614 Ga0068856_100016440 Ga0068856_1000164407 286
67 3300026116 Ga0207674_10098720 Ga0207674_100987202 286
68 3300048929 Ga0496126_0014030 Ga0496126_0014030_1777_2643 286
69 iso_pu_bacteria 2513020052 2513236155 286
70 3300009545 Ga0105237_10003016 Ga0105237_100030164 287
71 3300046660 Ga0495625_0030083 Ga0495625_0030083_905_1771 287
72 3300005347 Ga0070668_100301027 Ga0070668_1003010272 288
73 3300028800 Ga0265338_10280726 Ga0265338_102807261 288
74 3300032005 Ga0307411_10001224 Ga0307411_100012246 288
75 3300049758 Ga0501241_010875 Ga0501241_010875_579_1445 288
76 3300053122 Ga0500608_027912 Ga0500608_027912_376_1245 288
77 3300001979 JGI24740J21852_10002617 JGI24740J21852_100026177 289
78 3300010375 Ga0105239_10423948 Ga0105239_104239482 289
79 3300028794 Ga0307515_10013796 Ga0307515_1001379617 289
80 3300049705 Ga0501225_0014746 Ga0501225_0014746_672_1544 289
81 3300053093 Ga0500651_0000303 Ga0500651_0000303_24161_25084 289
82 iso_pu_bacteria 2821136567 2821138588 289
83 iso_pu_bacteria 2904467357 2904469381 289
84 3300003323 rootH1_10029695 rootH1_1002969510 290
85 3300005535 Ga0070684_100092912 Ga0070684_1000929122 292
86 3300013100 Ga0157373_10000299 Ga0157373_1000029917 292
87 3300013307 Ga0157372_10001659 Ga0157372_100016599 292
88 3300026078 Ga0207702_10501010 Ga0207702_105010101 292
89 3300031548 Ga0307408_100005638 Ga0307408_1000056388 292
90 3300031901 Ga0307406_10000243 Ga0307406_1000024326 292
91 iso_pu_bacteria 2739367663 2739646797 293
92 3300046460 Ga0495638_0000003 Ga0495638_0000003_660772_661692 294
93 iso_pu_bacteria 2522125168 2522553082 295
94 iso_pu_bacteria 2585428187 2588234198 295
95 iso_pu_bacteria 2818991437 2819546926 295
96 iso_pu_bacteria 2818991442 2819573017 295
97 iso_pu_bacteria 2818991442 2819577871 295
98 iso_pu_bacteria 2818991444 2819587290 295
99 iso_pu_bacteria 2842903701 2842907522 295
100 iso_pu_bacteria 2842903701 2842908991 295
101 iso_pu_bacteria 2911138879 2911140513 295
102 iso_pu_bacteria 2919692658 2919696881 295
103 iso_pu_bacteria 2929239360 2929245098 295
104 iso_pu_bacteria 2958512119 2958513936 295
105 iso_pu_bacteria 2965320100 2965323110 295
106 iso_pu_bacteria 3003233435 3003237284 295
107 iso_pu_bacteria 8003151029 8003156562 295
108 3300017792 Ga0163161_10007329 Ga0163161_100073296 296
109 3300017792 Ga0163161_10102073 Ga0163161_101020731 296
110 3300053153 Ga0500616_0048643 Ga0500616_0048643_354_1253 296
111 iso_pu_bacteria 2821136567 2821142963 296
112 iso_pu_bacteria 2904467357 2904470690 296
113 iso_pu_bacteria 2929177148 2929182553 296
114 3300001979 JGI24740J21852_10004228 JGI24740J21852_100042284 297
115 3300002738 JGI25154J39366_1000016 JGI25154J39366_100001678 297
116 3300003215 JGI25153J46596_10003991 JGI25153J46596_100039913 297
117 3300003320 rootH2_10039495 rootH2_100394957 297
118 3300003323 rootH1_10088871 rootH1_100888712 297
119 3300005288 Ga0065714_10064627 Ga0065714_1006462715 297
120 3300013308 Ga0157375_10000052 Ga0157375_1000005231 297
121 3300025246 Ga0209646_1000003 Ga0209646_100000378 297
122 3300025250 Ga0209026_1000202 Ga0209026_100020219 297
123 3300025297 Ga0209758_1013871 Ga0209758_10138712 297
124 3300025302 Ga0207426_1001549 Ga0207426_100154911 297
125 3300048928 Ga0496125_0011846 Ga0496125_0011846_5992_6897 297
126 3300003322 rootL2_10221287 rootL2_102212873 298
127 3300003323 rootH1_10012561 rootH1_100125614 298
128 3300005262 Ga0065165_1002831 Ga0065165_10028315 298
129 3300044656 Ga0466969_0001133 Ga0466969_0001133_10251_11177 298
130 3300044765 Ga0466970_0089820 Ga0466970_0089820_203_1153 298
131 3300044842 Ga0466957_0000474 Ga0466957_0000474_14791_15717 298
132 3300045049 Ga0466959_0000013 Ga0466959_0000013_81291_82241 298
133 3300046810 Ga0495660_0009167 Ga0495660_0009167_2116_3015 298
134 3300053116 Ga0500592_001839 Ga0500592_001839_2388_3293 298
135 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008263 299
136 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008313 299
137 3300002738 JGI25154J39366_1000073 JGI25154J39366_100007324 299
138 3300003215 JGI25153J46596_10016074 JGI25153J46596_100160743 299
139 3300003316 rootH1_10179979 rootH1_101799792 299
140 3300003320 rootH2_10017356 rootH2_100173563 299
141 3300003320 rootH2_10053271 rootH2_1005327110 299
142 3300003322 rootL2_10051367 rootL2_100513674 299
143 3300003322 rootL2_10198918 rootL2_101989182 299
144 3300003323 rootH1_10107342 rootH1_101073424 299
145 3300003354 JGI25160J50197_1005252 JGI25160J50197_10052526 299
146 3300003354 JGI25160J50197_1010685 JGI25160J50197_10106853 299
147 3300003771 Ga0055526_1005671 Ga0055526_10056713 299
148 3300003790 Ga0055528_1000400 Ga0055528_100040033 299
149 3300003791 Ga0055530_10000052 Ga0055530_100000529 299
150 3300003794 Ga0055531_10000063 Ga0055531_1000006324 299
151 3300005262 Ga0065165_1000052 Ga0065165_1000052141 299
152 3300005262 Ga0065165_1000104 Ga0065165_100010434 299
153 3300005288 Ga0065714_10065152 Ga0065714_100651525 299
154 3300005289 Ga0065704_10071791 Ga0065704_1007179110 299
155 3300005331 Ga0070670_100215176 Ga0070670_1002151762 299
156 3300005338 Ga0068868_100046305 Ga0068868_1000463051 299
157 3300013104 Ga0157370_10064592 Ga0157370_100645922 299
158 3300013104 Ga0157370_10161040 Ga0157370_101610402 299
159 3300017792 Ga0163161_10168882 Ga0163161_101688823 299
160 3300025233 Ga0209437_100030 Ga0209437_100030133 299
161 3300025233 Ga0209437_100043 Ga0209437_100043237 299
162 3300025246 Ga0209646_1000158 Ga0209646_100015860 299
163 3300025250 Ga0209026_1000168 Ga0209026_100016831 299
164 3300025273 Ga0209673_1000226 Ga0209673_100022656 299
165 3300025292 Ga0209676_1000310 Ga0209676_100031065 299
166 3300025295 Ga0209564_1001627 Ga0209564_100162726 299
167 3300025297 Ga0209758_1004653 Ga0209758_10046536 299
168 3300025298 Ga0209050_1000125 Ga0209050_1000125139 299
169 3300025302 Ga0207426_1000175 Ga0207426_100017595 299
170 3300025302 Ga0207426_1000882 Ga0207426_100088226 299
171 3300025302 Ga0207426_1017237 Ga0207426_10172372 299
172 3300025304 Ga0209257_1000008 Ga0209257_1000008810 299
173 3300025304 Ga0209257_1002919 Ga0209257_100291911 299
174 3300025914 Ga0207671_10000096 Ga0207671_1000009673 299
175 3300026116 Ga0207674_10176237 Ga0207674_101762372 299
176 3300031731 Ga0307405_10000002 Ga0307405_10000002205 299
177 3300031901 Ga0307406_10013865 Ga0307406_100138656 299
178 3300031901 Ga0307406_10291095 Ga0307406_102910952 299
179 3300032004 Ga0307414_10008772 Ga0307414_100087725 299
180 3300032005 Ga0307411_10001132 Ga0307411_100011323 299
181 3300046460 Ga0495638_0000050 Ga0495638_0000050_84855_85763 299
182 3300046538 Ga0495609_0000480 Ga0495609_0000480_19426_20334 299
183 3300048929 Ga0496126_0018056 Ga0496126_0018056_156_1064 299
184 3300048929 Ga0496126_0026178 Ga0496126_0026178_1192_2100 299
185 3300049705 Ga0501225_0000389 Ga0501225_0000389_4394_5302 299
186 3300053086 Ga0500578_0000003 Ga0500578_0000003_254957_255865 299
187 iso_pu_bacteria 2585428187 2588233058 299
188 iso_pu_bacteria 2738541278 2738730180 299
189 iso_pu_bacteria 2739367857 2740002204 299
190 iso_pu_bacteria 2739367858 2740007020 299
191 iso_pu_bacteria 2802428842 2802652585 299
192 iso_pu_bacteria 2816332280 2817417172 299
193 iso_pu_bacteria 2857613821 2857616065 299
194 iso_pu_bacteria 2889290771 2889291722 299
195 iso_pu_bacteria 2904555929 2904558884 299
196 iso_pu_bacteria 2945924605 2945926134 299
197 iso_pu_bacteria 2945977869 2945978478 299
198 iso_pu_bacteria 2946013367 2946015660 299
199 iso_pu_bacteria 2977268062 2977271319 299
200 iso_pu_bacteria 8055419101 8055422776 299
201 3300003320 rootH2_10017519 rootH2_100175192 300
202 3300003794 Ga0055531_10000324 Ga0055531_1000032429 300
203 3300005355 Ga0070671_100236417 Ga0070671_1002364172 300
204 3300005618 Ga0068864_100208169 Ga0068864_1002081692 300
205 3300005834 Ga0068851_10064575 Ga0068851_100645753 300
206 3300005841 Ga0068863_100121661 Ga0068863_1001216612 300
207 3300006237 Ga0097621_100098442 Ga0097621_1000984423 300
208 3300006358 Ga0068871_100206970 Ga0068871_1002069702 300
209 3300013297 Ga0157378_10013014 Ga0157378_100130143 300
210 3300025304 Ga0209257_1000023 Ga0209257_1000023533 300
211 3300025960 Ga0207651_10368491 Ga0207651_103684912 300
212 3300026023 Ga0207677_10061359 Ga0207677_100613593 300
213 3300046660 Ga0495625_0013086 Ga0495625_0013086_576_1481 300
214 iso_pu_bacteria 2739367656 2739614094 300
215 iso_pu_bacteria 2818991442 2819577660 300
216 iso_pu_bacteria 2818991460 2819677488 300
217 iso_pu_bacteria 2857613821 2857617340 300
218 iso_pu_bacteria 2904419702 2904420750 300
219 iso_pu_bacteria 2929177148 2929179571 300
220 iso_pu_bacteria 2929177148 2929180643 300
221 iso_pu_bacteria 2945977869 2945981985 300
222 iso_pu_bacteria 2945977869 2945983042 300
223 iso_pu_bacteria 2946013367 2946017563 300
224 iso_pu_bacteria 2946013367 2946018618 300
225 iso_pu_bacteria 2818991444 2819590150 301
226 iso_pu_bacteria 2842903701 2842904667 301
227 iso_pu_bacteria 2842903701 2842907478 301
228 iso_pu_bacteria 2857618242 2857619626 301
229 iso_pu_bacteria 2884791551 2884792342 301
230 iso_pu_bacteria 2904419702 2904422255 301
231 iso_pu_bacteria 2904780799 2904784686 301
232 iso_pu_bacteria 2919437846 2919437856 301
233 iso_pu_bacteria 2929239360 2929239568 301
234 iso_pu_bacteria 2929239360 2929242493 301
235 iso_pu_bacteria 2929921140 2929926183 301
236 iso_pu_bacteria 2977243572 2977245496 301
237 iso_pu_bacteria 8003151029 8003156029 301
238 3300003316 rootH1_10136412 rootH1_101364122 302
239 3300005539 Ga0068853_100169231 Ga0068853_1001692313 302
240 3300009093 Ga0105240_10325225 Ga0105240_103252252 302
241 3300010375 Ga0105239_10001610 Ga0105239_1000161013 302
242 3300015261 Ga0182006_1006515 Ga0182006_10065153 302
243 3300025903 Ga0207680_10004822 Ga0207680_100048226 302
244 3300025913 Ga0207695_10223985 Ga0207695_102239852 302
245 3300033180 Ga0307510_10015549 Ga0307510_100155496 302
246 3300047320 Ga0495672_0088216 Ga0495672_0088216_89_1000 302
247 3300049758 Ga0501241_001093 Ga0501241_001093_95_1009 302
248 3300053118 Ga0500594_0007676 Ga0500594_0007676_508_1428 302
249 3300002738 JGI25154J39366_1007707 JGI25154J39366_10077071 303
250 3300003316 rootH1_10049637 rootH1_100496376 303
251 3300003320 rootH2_10011844 rootH2_1001184446 303
252 3300003322 rootL2_10035699 rootL2_100356993 303
253 3300003322 rootL2_10082053 rootL2_100820533 303
254 3300003323 rootH1_10009799 rootH1_100097992 303
255 3300003323 rootH1_10192656 rootH1_101926564 303
256 3300005367 Ga0070667_100037449 Ga0070667_1000374493 303
257 3300005577 Ga0068857_100046935 Ga0068857_1000469352 303
258 3300005614 Ga0068856_100164100 Ga0068856_1001641002 303
259 3300005617 Ga0068859_100007759 Ga0068859_1000077597 303
260 3300005843 Ga0068860_100043649 Ga0068860_1000436493 303
261 3300005985 Ga0081539_10001245 Ga0081539_100012459 303
262 3300006931 Ga0097620_100007759 Ga0097620_1000077597 303
263 3300009147 Ga0114129_10005726 Ga0114129_100057263 303
264 3300009551 Ga0105238_10171917 Ga0105238_101719172 303
265 3300013104 Ga0157370_10007911 Ga0157370_1000791110 303
266 3300013297 Ga0157378_10001954 Ga0157378_100019549 303
267 3300013306 Ga0163162_10414304 Ga0163162_104143042 303
268 3300015261 Ga0182006_1001457 Ga0182006_100145713 303
269 3300025246 Ga0209646_1002384 Ga0209646_10023843 303
270 3300025924 Ga0207694_10175254 Ga0207694_101752542 303
271 3300025986 Ga0207658_10011346 Ga0207658_100113462 303
272 3300026078 Ga0207702_10103048 Ga0207702_101030482 303
273 3300026116 Ga0207674_10045323 Ga0207674_100453234 303
274 3300028381 Ga0268264_10006483 Ga0268264_1000648310 303
275 3300031548 Ga0307408_100124191 Ga0307408_1001241912 303
276 3300031731 Ga0307405_10091577 Ga0307405_100915772 303
277 3300031824 Ga0307413_10000188 Ga0307413_1000018811 303
278 3300031852 Ga0307410_10000018 Ga0307410_1000001858 303
279 3300031901 Ga0307406_10000422 Ga0307406_100004226 303
280 3300031903 Ga0307407_10000808 Ga0307407_100008083 303
281 3300031911 Ga0307412_10000179 Ga0307412_1000017934 303
282 3300032004 Ga0307414_10000008 Ga0307414_10000008244 303
283 3300032005 Ga0307411_10000008 Ga0307411_10000008248 303
284 3300041407 Ga0439447_000827 Ga0439447_000827_9481_10395 303
285 3300041411 Ga0439466_0001202 Ga0439466_0001202_7888_8802 303
286 3300042004 Ga0439445_0000048 Ga0439445_0000048_2278_3198 303
287 3300044658 Ga0466972_0000235 Ga0466972_0000235_34728_35642 303
288 3300044658 Ga0466972_0005859 Ga0466972_0005859_4186_5100 303
289 3300044683 Ga0466965_0037929 Ga0466965_0037929_1065_1979 303
290 3300044684 Ga0466966_0000014 Ga0466966_0000014_20207_21121 303
291 3300044684 Ga0466966_0015812 Ga0466966_0015812_2839_3753 303
292 3300044706 Ga0466964_0012685 Ga0466964_0012685_934_1848 303
293 3300044706 Ga0466964_0012905 Ga0466964_0012905_403_1317 303
294 3300044735 Ga0466968_0009531 Ga0466968_0009531_1854_2768 303
295 3300044735 Ga0466968_0023808 Ga0466968_0023808_806_1720 303
296 3300044765 Ga0466970_0028608 Ga0466970_0028608_808_1722 303
297 3300044842 Ga0466957_0001027 Ga0466957_0001027_10676_11590 303
298 3300044901 Ga0466960_0009625 Ga0466960_0009625_2699_3613 303
299 3300045049 Ga0466959_0000011 Ga0466959_0000011_132207_133121 303
300 3300045049 Ga0466959_0055694 Ga0466959_0055694_1175_2089 303
301 3300046453 Ga0495627_002044 Ga0495627_002044_2671_3591 303
302 3300046512 Ga0495610_0000747 Ga0495610_0000747_1967_2881 303
303 3300046512 Ga0495610_0022799 Ga0495610_0022799_2319_3233 303
304 3300046558 Ga0495633_0001455 Ga0495633_0001455_15657_16577 303
305 3300046660 Ga0495625_0001290 Ga0495625_0001290_10599_11519 303
306 3300047472 Ga0495686_0000079 Ga0495686_0000079_196242_197162 303
307 3300047472 Ga0495686_0000524 Ga0495686_0000524_33241_34155 303
308 3300048924 Ga0496121_0000008 Ga0496121_0000008_313466_314383 303
309 3300048928 Ga0496125_0008240 Ga0496125_0008240_5098_6018 303
310 3300049671 Ga0501238_000427 Ga0501238_000427_3822_4736 303
311 3300050507 nmdc:mga05p37_29731_c1 nmdc:mga05p37_29731_c1_5049_5963 303
312 3300053086 Ga0500578_0000312 Ga0500578_0000312_36230_37150 303
313 3300053108 Ga0500562_000066 Ga0500562_000066_2255_3169 303
314 3300053156 Ga0500622_0001051 Ga0500622_0001051_8011_8925 303
315 3300053730 Ga0500645_010433 Ga0500645_010433_1191_2105 303
316 3300055283 Ga0500661_009524 Ga0500661_009524_498_1412 303
317 3300061719 Ga0466962_0024349 Ga0466962_0024349_1733_2647 303
318 3300002737 JGI25162J39368_1004624 JGI25162J39368_10046243 304
319 3300002739 JGI25158J39367_1009303 JGI25158J39367_10093031 304
320 3300003214 JGI25165J46597_1001861 JGI25165J46597_10018613 304
321 3300003322 rootL2_10054129 rootL2_1005412911 304
322 3300003322 rootL2_10235423 rootL2_102354233 304
323 3300003794 Ga0055531_10000030 Ga0055531_1000003077 304
324 3300005288 Ga0065714_10004857 Ga0065714_100048572 304
325 3300005288 Ga0065714_10065174 Ga0065714_100651745 304
326 3300005288 Ga0065714_10072760 Ga0065714_100727602 304
327 3300005334 Ga0068869_100119585 Ga0068869_1001195851 304
328 3300005335 Ga0070666_10000041 Ga0070666_1000004174 304
329 3300005338 Ga0068868_100021703 Ga0068868_1000217033 304
330 3300005347 Ga0070668_100440224 Ga0070668_1004402241 304
331 3300005367 Ga0070667_100027616 Ga0070667_1000276162 304
332 3300005616 Ga0068852_100041753 Ga0068852_1000417534 304
333 3300005617 Ga0068859_100000083 Ga0068859_10000008375 304
334 3300005618 Ga0068864_100237753 Ga0068864_1002377532 304
335 3300005834 Ga0068851_10012190 Ga0068851_100121902 304
336 3300005841 Ga0068863_100216998 Ga0068863_1002169981 304
337 3300005842 Ga0068858_100050970 Ga0068858_1000509702 304
338 3300005843 Ga0068860_100018710 Ga0068860_1000187104 304
339 3300006237 Ga0097621_100240654 Ga0097621_1002406542 304
340 3300006931 Ga0097620_100000083 Ga0097620_10000008375 304
341 3300009101 Ga0105247_10005474 Ga0105247_100054746 304
342 3300009174 Ga0105241_10001084 Ga0105241_1000108414 304
343 3300009545 Ga0105237_10016009 Ga0105237_100160093 304
344 3300009545 Ga0105237_10022897 Ga0105237_100228977 304
345 3300010375 Ga0105239_10251180 Ga0105239_102511802 304
346 3300011119 Ga0105246_10012789 Ga0105246_100127894 304
347 3300011119 Ga0105246_10046798 Ga0105246_100467982 304
348 3300013105 Ga0157369_10001327 Ga0157369_1000132716 304
349 3300013297 Ga0157378_10181795 Ga0157378_101817952 304
350 3300013306 Ga0163162_10004686 Ga0163162_100046862 304
351 3300013307 Ga0157372_10104752 Ga0157372_101047524 304
352 3300013307 Ga0157372_10501543 Ga0157372_105015432 304
353 3300013308 Ga0157375_10055343 Ga0157375_100553432 304
354 3300014968 Ga0157379_10128544 Ga0157379_101285444 304
355 3300015265 Ga0182005_1000200 Ga0182005_100020032 304
356 3300017792 Ga0163161_10007893 Ga0163161_100078932 304
357 3300025208 Ga0209436_100514 Ga0209436_1005146 304
358 3300025231 Ga0207427_100152 Ga0207427_10015256 304
359 3300025233 Ga0209437_100164 Ga0209437_100164114 304
360 3300025261 Ga0209233_1000038 Ga0209233_1000038488 304
361 3300025284 Ga0209130_1013317 Ga0209130_10133173 304
362 3300025302 Ga0207426_1000135 Ga0207426_100013547 304
363 3300025304 Ga0209257_1000013 Ga0209257_1000013386 304
364 3300025900 Ga0207710_10003963 Ga0207710_100039634 304
365 3300025903 Ga0207680_10000634 Ga0207680_1000063413 304
366 3300025904 Ga0207647_10154860 Ga0207647_101548601 304
367 3300025909 Ga0207705_10031606 Ga0207705_100316062 304
368 3300025911 Ga0207654_10000501 Ga0207654_1000050120 304
369 3300025911 Ga0207654_10039789 Ga0207654_100397894 304
370 3300025914 Ga0207671_10001628 Ga0207671_100016283 304
371 3300025914 Ga0207671_10022112 Ga0207671_100221127 304
372 3300025919 Ga0207657_10012983 Ga0207657_100129832 304
373 3300025921 Ga0207652_10000180 Ga0207652_1000018021 304
374 3300025940 Ga0207691_10249200 Ga0207691_102492002 304
375 3300025942 Ga0207689_10000746 Ga0207689_1000074622 304
376 3300025949 Ga0207667_10003555 Ga0207667_100035557 304
377 3300025949 Ga0207667_10073213 Ga0207667_100732134 304
378 3300025961 Ga0207712_10014860 Ga0207712_100148603 304
379 3300025972 Ga0207668_10354876 Ga0207668_103548762 304
380 3300026035 Ga0207703_10004577 Ga0207703_100045776 304
381 3300026088 Ga0207641_10001993 Ga0207641_100019932 304
382 3300026095 Ga0207676_10219125 Ga0207676_102191252 304
383 3300026142 Ga0207698_10140892 Ga0207698_101408922 304
384 3300028381 Ga0268264_10009773 Ga0268264_100097732 304
385 3300028794 Ga0307515_10000299 Ga0307515_1000029920 304
386 3300028794 Ga0307515_10102161 Ga0307515_101021613 304
387 3300030734 Ga0316179_1094714 Ga0316179_10947142 304
388 3300031852 Ga0307410_10006559 Ga0307410_100065596 304
389 3300031903 Ga0307407_10070377 Ga0307407_100703772 304
390 3300032004 Ga0307414_10000002 Ga0307414_10000002141 304
391 3300032133 Ga0316583_10049290 Ga0316583_100492901 304
392 3300041411 Ga0439466_0000400 Ga0439466_0000400_4438_5355 304
393 3300044684 Ga0466966_0000147 Ga0466966_0000147_35729_36649 304
394 3300044842 Ga0466957_0020301 Ga0466957_0020301_1004_1924 304
395 3300045049 Ga0466959_0000003 Ga0466959_0000003_218949_219869 304
396 3300046460 Ga0495638_0042600 Ga0495638_0042600_498_1418 304
397 3300046471 Ga0495650_0010640 Ga0495650_0010640_3619_4539 304
398 3300046507 Ga0495606_0003060 Ga0495606_0003060_526_1446 304
399 3300046507 Ga0495606_0013090 Ga0495606_0013090_1026_1943 304
400 3300046513 Ga0495616_0010696 Ga0495616_0010696_4326_5243 304
401 3300046558 Ga0495633_0000263 Ga0495633_0000263_46283_47200 304
402 3300046660 Ga0495625_0043716 Ga0495625_0043716_1077_1994 304
403 3300047472 Ga0495686_0000355 Ga0495686_0000355_33098_34018 304
404 3300047472 Ga0495686_0000607 Ga0495686_0000607_32908_33828 304
405 3300048929 Ga0496126_0367928 Ga0496126_0367928_81_998 304
406 3300049459 Ga0495678_016614 Ga0495678_016614_2020_2937 304
407 3300049671 Ga0501238_000293 Ga0501238_000293_70_987 304
408 3300049758 Ga0501241_005584 Ga0501241_005584_921_1838 304
409 3300049823 Ga0501044_0293412 Ga0501044_0293412_21_941 304
410 3300053086 Ga0500578_0001042 Ga0500578_0001042_8012_8932 304
411 3300053134 Ga0500658_0000002 Ga0500658_0000002_94678_95592 304
412 3300053153 Ga0500616_0060369 Ga0500616_0060369_1037_1954 304
413 3300053156 Ga0500622_0000051 Ga0500622_0000051_23558_24475 304
414 3300053156 Ga0500622_0001589 Ga0500622_0001589_16821_17738 304
415 3300053156 Ga0500622_0027948 Ga0500622_0027948_474_1391 304
416 3300053160 Ga0500633_0002778 Ga0500633_0002778_459_1376 304
417 3300061719 Ga0466962_0100937 Ga0466962_0100937_367_1290 304
418 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00005350 305
419 3300001979 JGI24740J21852_10011221 JGI24740J21852_100112213 305
420 3300001989 JGI24739J22299_10010833 JGI24739J22299_100108332 305
421 3300002737 JGI25162J39368_1000650 JGI25162J39368_100065030 305
422 3300002738 JGI25154J39366_1000021 JGI25154J39366_100002129 305
423 3300002738 JGI25154J39366_1000028 JGI25154J39366_1000028116 305
424 3300002741 JGI25157J39369_1002336 JGI25157J39369_10023363 305
425 3300002741 JGI25157J39369_1006944 JGI25157J39369_10069442 305
426 3300002772 JGI25164J39214_1002804 JGI25164J39214_10028042 305
427 3300003214 JGI25165J46597_1001427 JGI25165J46597_100142716 305
428 3300003215 JGI25153J46596_10000412 JGI25153J46596_1000041229 305
429 3300003215 JGI25153J46596_10003899 JGI25153J46596_100038998 305
430 3300003320 rootH2_10006586 rootH2_1000658628 305
431 3300003320 rootH2_10059195 rootH2_100591952 305
432 3300003323 rootH1_10007228 rootH1_100072285 305
433 3300003323 rootH1_10012978 rootH1_1001297815 305
434 3300003323 rootH1_10028162 rootH1_100281629 305
435 3300003323 rootH1_10063994 rootH1_100639947 305
436 3300003323 rootH1_10073247 rootH1_100732472 305
437 3300003323 rootH1_10085833 rootH1_100858337 305
438 3300003354 JGI25160J50197_1004139 JGI25160J50197_10041393 305
439 3300003354 JGI25160J50197_1015296 JGI25160J50197_10152962 305
440 3300003771 Ga0055526_1001833 Ga0055526_100183313 305
441 3300003790 Ga0055528_1000072 Ga0055528_10000729 305
442 3300005262 Ga0065165_1000038 Ga0065165_100003870 305
443 3300005262 Ga0065165_1008355 Ga0065165_10083552 305
444 3300005262 Ga0065165_1061846 Ga0065165_10618461 305
445 3300005288 Ga0065714_10073661 Ga0065714_100736613 305
446 3300005289 Ga0065704_10070140 Ga0065704_10070140411 305
447 3300005293 Ga0065715_10116786 Ga0065715_101167862 305
448 3300005328 Ga0070676_10000259 Ga0070676_1000025918 305
449 3300005329 Ga0070683_100123265 Ga0070683_1001232653 305
450 3300005338 Ga0068868_100061094 Ga0068868_1000610943 305
451 3300005338 Ga0068868_100062299 Ga0068868_1000622993 305
452 3300005353 Ga0070669_100059425 Ga0070669_1000594252 305
453 3300005355 Ga0070671_100097921 Ga0070671_1000979212 305
454 3300005364 Ga0070673_100370828 Ga0070673_1003708281 305
455 3300005366 Ga0070659_100176570 Ga0070659_1001765701 305
456 3300005456 Ga0070678_100258702 Ga0070678_1002587022 305
457 3300005457 Ga0070662_100000449 Ga0070662_1000004496 305
458 3300005457 Ga0070662_100168923 Ga0070662_1001689232 305
459 3300005458 Ga0070681_10291296 Ga0070681_102912962 305
460 3300005459 Ga0068867_100173810 Ga0068867_1001738102 305
461 3300005471 Ga0070698_100027821 Ga0070698_1000278213 305
462 3300005471 Ga0070698_100183280 Ga0070698_1001832802 305
463 3300005518 Ga0070699_100046903 Ga0070699_1000469032 305
464 3300005536 Ga0070697_100328973 Ga0070697_1003289732 305
465 3300005539 Ga0068853_100021248 Ga0068853_1000212483 305
466 3300005539 Ga0068853_100061766 Ga0068853_1000617663 305
467 3300005539 Ga0068853_100067715 Ga0068853_1000677152 305
468 3300005539 Ga0068853_100095697 Ga0068853_1000956972 305
469 3300005539 Ga0068853_100112138 Ga0068853_1001121382 305
470 3300005539 Ga0068853_100155890 Ga0068853_1001558902 305
471 3300005548 Ga0070665_100000008 Ga0070665_100000008179 305
472 3300005548 Ga0070665_100000125 Ga0070665_100000125100 305
473 3300005548 Ga0070665_100000205 Ga0070665_10000020549 305
474 3300005549 Ga0070704_100152645 Ga0070704_1001526452 305
475 3300005563 Ga0068855_100011059 Ga0068855_1000110592 305
476 3300005563 Ga0068855_100025193 Ga0068855_1000251932 305
477 3300005563 Ga0068855_100246644 Ga0068855_1002466442 305
478 3300005577 Ga0068857_100044420 Ga0068857_1000444203 305
479 3300005577 Ga0068857_100268592 Ga0068857_1002685922 305
480 3300005578 Ga0068854_100035592 Ga0068854_1000355922 305
481 3300005614 Ga0068856_100002280 Ga0068856_10000228010 305
482 3300005616 Ga0068852_100009844 Ga0068852_1000098441 305
483 3300005616 Ga0068852_100091236 Ga0068852_1000912363 305
484 3300005616 Ga0068852_100643462 Ga0068852_1006434621 305
485 3300005843 Ga0068860_100018491 Ga0068860_10001849110 305
486 3300006195 Ga0075366_10000235 Ga0075366_1000023516 305
487 3300006195 Ga0075366_10078244 Ga0075366_100782442 305
488 3300006237 Ga0097621_100000288 Ga0097621_1000002884 305
489 3300006237 Ga0097621_100012310 Ga0097621_1000123109 305
490 3300006358 Ga0068871_100000592 Ga0068871_1000005924 305
491 3300006358 Ga0068871_100144233 Ga0068871_1001442332 305
492 3300006846 Ga0075430_100146602 Ga0075430_1001466021 305
493 3300006852 Ga0075433_10173523 Ga0075433_101735231 305
494 3300006881 Ga0068865_100000029 Ga0068865_10000002991 305
495 3300009093 Ga0105240_10000020 Ga0105240_1000002018 305
496 3300009093 Ga0105240_10000117 Ga0105240_1000011721 305
497 3300009093 Ga0105240_10001228 Ga0105240_1000122811 305
498 3300009093 Ga0105240_10005598 Ga0105240_100055986 305
499 3300009093 Ga0105240_10078938 Ga0105240_100789382 305
500 3300009093 Ga0105240_10085605 Ga0105240_100856055 305
501 3300009093 Ga0105240_10125427 Ga0105240_101254272 305
502 3300009093 Ga0105240_10295014 Ga0105240_102950142 305
503 3300009098 Ga0105245_10182363 Ga0105245_101823632 305
504 3300009148 Ga0105243_10065078 Ga0105243_100650782 305
505 3300009174 Ga0105241_10000217 Ga0105241_1000021732 305
506 3300009174 Ga0105241_10001790 Ga0105241_100017903 305
507 3300009174 Ga0105241_10009176 Ga0105241_100091764 305
508 3300009174 Ga0105241_10036543 Ga0105241_100365432 305
509 3300009174 Ga0105241_10134387 Ga0105241_101343872 305
510 3300009174 Ga0105241_10491639 Ga0105241_104916392 305
511 3300009176 Ga0105242_10014823 Ga0105242_100148231 305
512 3300009545 Ga0105237_10007928 Ga0105237_100079289 305
513 3300009545 Ga0105237_10009739 Ga0105237_100097398 305
514 3300009545 Ga0105237_10042402 Ga0105237_100424023 305
515 3300009545 Ga0105237_10345398 Ga0105237_103453982 305
516 3300009551 Ga0105238_10003134 Ga0105238_100031347 305
517 3300010375 Ga0105239_10000456 Ga0105239_1000045641 305
518 3300010375 Ga0105239_10000786 Ga0105239_1000078622 305
519 3300010375 Ga0105239_10013703 Ga0105239_100137032 305
520 3300010375 Ga0105239_10028344 Ga0105239_100283445 305
521 3300010375 Ga0105239_10034714 Ga0105239_100347144 305
522 3300010375 Ga0105239_10049416 Ga0105239_100494164 305
523 3300010375 Ga0105239_10050627 Ga0105239_100506274 305
524 3300010375 Ga0105239_10138372 Ga0105239_101383722 305
525 3300010375 Ga0105239_10150850 Ga0105239_101508503 305
526 3300010375 Ga0105239_10188654 Ga0105239_101886543 305
527 3300011119 Ga0105246_10107279 Ga0105246_101072792 305
528 3300013100 Ga0157373_10012068 Ga0157373_100120688 305
529 3300013100 Ga0157373_10028139 Ga0157373_100281392 305
530 3300013100 Ga0157373_10096414 Ga0157373_100964141 305
531 3300013102 Ga0157371_10023632 Ga0157371_100236325 305
532 3300013102 Ga0157371_10062619 Ga0157371_100626193 305
533 3300013102 Ga0157371_10070727 Ga0157371_100707272 305
534 3300013102 Ga0157371_10075852 Ga0157371_100758523 305
535 3300013102 Ga0157371_10111021 Ga0157371_101110212 305
536 3300013104 Ga0157370_10000022 Ga0157370_1000002220 305
537 3300013104 Ga0157370_10147948 Ga0157370_101479482 305
538 3300013105 Ga0157369_10010087 Ga0157369_1001008710 305
539 3300013296 Ga0157374_10000887 Ga0157374_1000088714 305
540 3300013297 Ga0157378_10014463 Ga0157378_100144637 305
541 3300013306 Ga0163162_10000005 Ga0163162_1000000543 305
542 3300013306 Ga0163162_10000208 Ga0163162_1000020833 305
543 3300013306 Ga0163162_10000993 Ga0163162_100009933 305
544 3300013307 Ga0157372_10017207 Ga0157372_100172073 305
545 3300013307 Ga0157372_10038047 Ga0157372_100380477 305
546 3300013307 Ga0157372_10081439 Ga0157372_100814392 305
547 3300013307 Ga0157372_10137568 Ga0157372_101375682 305
548 3300013308 Ga0157375_10015943 Ga0157375_100159436 305
549 3300014325 Ga0163163_10084736 Ga0163163_100847363 305
550 3300014497 Ga0182008_10000290 Ga0182008_1000029011 305
551 3300014969 Ga0157376_10034329 Ga0157376_100343291 305
552 3300014969 Ga0157376_10353530 Ga0157376_103535302 305
553 3300015261 Ga0182006_1004000 Ga0182006_10040001 305
554 3300017792 Ga0163161_10000994 Ga0163161_100009943 305
555 3300025230 Ga0209563_104145 Ga0209563_1041452 305
556 3300025231 Ga0207427_100152 Ga0207427_10015250 305
557 3300025233 Ga0209437_100164 Ga0209437_100164108 305
558 3300025246 Ga0209646_1000006 Ga0209646_1000006113 305
559 3300025246 Ga0209646_1000050 Ga0209646_1000050226 305
560 3300025246 Ga0209646_1003925 Ga0209646_10039252 305
561 3300025250 Ga0209026_1000185 Ga0209026_100018550 305
562 3300025250 Ga0209026_1000240 Ga0209026_100024054 305
563 3300025254 Ga0209148_1000230 Ga0209148_100023036 305
564 3300025261 Ga0209233_1000038 Ga0209233_1000038494 305
565 3300025273 Ga0209673_1000130 Ga0209673_100013065 305
566 3300025295 Ga0209564_1001138 Ga0209564_100113817 305
567 3300025295 Ga0209564_1001327 Ga0209564_100132715 305
568 3300025295 Ga0209564_1006788 Ga0209564_10067885 305
569 3300025297 Ga0209758_1001017 Ga0209758_100101734 305
570 3300025297 Ga0209758_1001281 Ga0209758_10012819 305
571 3300025297 Ga0209758_1002179 Ga0209758_100217918 305
572 3300025298 Ga0209050_1000530 Ga0209050_100053049 305
573 3300025298 Ga0209050_1008683 Ga0209050_10086838 305
574 3300025302 Ga0207426_1000293 Ga0207426_100029345 305
575 3300025302 Ga0207426_1000452 Ga0207426_100045215 305
576 3300025302 Ga0207426_1000546 Ga0207426_100054640 305
577 3300025302 Ga0207426_1009511 Ga0207426_10095114 305
578 3300025303 Ga0209051_1007944 Ga0209051_10079445 305
579 3300025304 Ga0209257_1004595 Ga0209257_100459511 305
580 3300025904 Ga0207647_10000117 Ga0207647_1000011743 305
581 3300025904 Ga0207647_10002941 Ga0207647_100029417 305
582 3300025904 Ga0207647_10093199 Ga0207647_100931992 305
583 3300025907 Ga0207645_10001758 Ga0207645_1000175815 305
584 3300025911 Ga0207654_10002034 Ga0207654_100020342 305
585 3300025911 Ga0207654_10007288 Ga0207654_100072882 305
586 3300025911 Ga0207654_10008332 Ga0207654_100083323 305
587 3300025911 Ga0207654_10259016 Ga0207654_102590161 305
588 3300025913 Ga0207695_10000020 Ga0207695_10000020508 305
589 3300025913 Ga0207695_10000077 Ga0207695_10000077256 305
590 3300025913 Ga0207695_10001743 Ga0207695_100017433 305
591 3300025913 Ga0207695_10005927 Ga0207695_100059276 305
592 3300025913 Ga0207695_10019624 Ga0207695_100196242 305
593 3300025913 Ga0207695_10059122 Ga0207695_100591224 305
594 3300025913 Ga0207695_10278830 Ga0207695_102788302 305
595 3300025914 Ga0207671_10001505 Ga0207671_1000150515 305
596 3300025914 Ga0207671_10008266 Ga0207671_100082663 305
597 3300025914 Ga0207671_10015560 Ga0207671_100155602 305
598 3300025914 Ga0207671_10237629 Ga0207671_102376292 305
599 3300025917 Ga0207660_10162444 Ga0207660_101624442 305
600 3300025919 Ga0207657_10004524 Ga0207657_100045243 305
601 3300025919 Ga0207657_10117206 Ga0207657_101172062 305
602 3300025921 Ga0207652_10071695 Ga0207652_100716954 305
603 3300025923 Ga0207681_10129380 Ga0207681_101293801 305
604 3300025924 Ga0207694_10213769 Ga0207694_102137692 305
605 3300025931 Ga0207644_10074788 Ga0207644_100747882 305
606 3300025932 Ga0207690_10040839 Ga0207690_100408392 305
607 3300025933 Ga0207706_10000044 Ga0207706_100000446 305
608 3300025933 Ga0207706_10207900 Ga0207706_102079002 305
609 3300025934 Ga0207686_10063662 Ga0207686_100636623 305
610 3300025935 Ga0207709_10060206 Ga0207709_100602062 305
611 3300025938 Ga0207704_10000144 Ga0207704_1000014424 305
612 3300025940 Ga0207691_10058089 Ga0207691_100580893 305
613 3300025944 Ga0207661_10158549 Ga0207661_101585493 305
614 3300025949 Ga0207667_10005479 Ga0207667_1000547918 305
615 3300025949 Ga0207667_10006819 Ga0207667_100068198 305
616 3300025949 Ga0207667_10015804 Ga0207667_100158043 305
617 3300025949 Ga0207667_10319701 Ga0207667_103197012 305
618 3300025960 Ga0207651_10020505 Ga0207651_100205055 305
619 3300026023 Ga0207677_10010714 Ga0207677_100107143 305
620 3300026023 Ga0207677_10046737 Ga0207677_100467373 305
621 3300026041 Ga0207639_10010820 Ga0207639_100108206 305
622 3300026041 Ga0207639_10024535 Ga0207639_100245352 305
623 3300026041 Ga0207639_10109045 Ga0207639_101090453 305
624 3300026041 Ga0207639_10137008 Ga0207639_101370082 305
625 3300026041 Ga0207639_10149689 Ga0207639_101496892 305
626 3300026078 Ga0207702_10040257 Ga0207702_100402572 305
627 3300026089 Ga0207648_10024015 Ga0207648_100240151 305
628 3300026116 Ga0207674_10087632 Ga0207674_100876323 305
629 3300026116 Ga0207674_10330946 Ga0207674_103309462 305
630 3300026121 Ga0207683_10012346 Ga0207683_100123466 305
631 3300026142 Ga0207698_10163885 Ga0207698_101638852 305
632 3300026142 Ga0207698_10170501 Ga0207698_101705012 305
633 3300028379 Ga0268266_10000016 Ga0268266_10000016177 305
634 3300028379 Ga0268266_10000132 Ga0268266_1000013286 305
635 3300028379 Ga0268266_10000333 Ga0268266_1000033342 305
636 3300028381 Ga0268264_10121368 Ga0268264_101213682 305
637 3300028573 Ga0265334_10019771 Ga0265334_100197713 305
638 3300028573 Ga0265334_10021766 Ga0265334_100217663 305
639 3300028800 Ga0265338_10028957 Ga0265338_100289575 305
640 3300028800 Ga0265338_10135871 Ga0265338_101358712 305
641 3300028800 Ga0265338_10303418 Ga0265338_103034182 305
642 3300029957 Ga0265324_10071972 Ga0265324_100719721 305
643 3300030521 Ga0307511_10000046 Ga0307511_1000004615 305
644 3300030521 Ga0307511_10000139 Ga0307511_1000013933 305
645 3300030731 Ga0316177_1055781 Ga0316177_10557813 305
646 3300030731 Ga0316177_1062757 Ga0316177_10627576 305
647 3300030732 Ga0316176_1023444 Ga0316176_10234444 305
648 3300030732 Ga0316176_1114001 Ga0316176_11140014 305
649 3300030742 Ga0316183_1079365 Ga0316183_10793658 305
650 3300030742 Ga0316183_1211687 Ga0316183_12116873 305
651 3300030744 Ga0316181_1220040 Ga0316181_122004016 305
652 3300030744 Ga0316181_1258294 Ga0316181_12582942 305
653 3300031235 Ga0265330_10039211 Ga0265330_100392111 305
654 3300031250 Ga0265331_10011097 Ga0265331_100110975 305
655 3300031251 Ga0265327_10000306 Ga0265327_1000030629 305
656 3300031251 Ga0265327_10104704 Ga0265327_101047041 305
657 3300031344 Ga0265316_10057982 Ga0265316_100579823 305
658 3300031507 Ga0307509_10048470 Ga0307509_100484704 305
659 3300031507 Ga0307509_10053420 Ga0307509_100534202 305
660 3300031548 Ga0307408_100066292 Ga0307408_1000662922 305
661 3300032004 Ga0307414_10002617 Ga0307414_100026171 305
662 3300032004 Ga0307414_10024385 Ga0307414_100243851 305
663 3300033180 Ga0307510_10010171 Ga0307510_100101717 305
664 3300039447 Ga0436361_0292109 Ga0436361_0292109_7334_8257 305
665 3300044658 Ga0466972_0000077 Ga0466972_0000077_21619_22539 305
666 3300044658 Ga0466972_0008131 Ga0466972_0008131_331_1251 305
667 3300044683 Ga0466965_0120426 Ga0466965_0120426_109_1032 305
668 3300044683 Ga0466965_0121953 Ga0466965_0121953_245_1165 305
669 3300044693 Ga0466961_0142401 Ga0466961_0142401_465_1391 305
670 3300044693 Ga0466961_0196348 Ga0466961_0196348_137_1057 305
671 3300044706 Ga0466964_0047540 Ga0466964_0047540_93_1016 305
672 3300044765 Ga0466970_0002985 Ga0466970_0002985_5482_6402 305
673 3300045049 Ga0466959_0033002 Ga0466959_0033002_907_1833 305
674 3300045049 Ga0466959_0081890 Ga0466959_0081890_499_1419 305
675 3300046453 Ga0495627_010661 Ga0495627_010661_980_1900 305
676 3300046460 Ga0495638_0033930 Ga0495638_0033930_764_1684 305
677 3300046492 Ga0495585_0000902 Ga0495585_0000902_2841_3764 305
678 3300046507 Ga0495606_0000142 Ga0495606_0000142_16637_17560 305
679 3300046507 Ga0495606_0012300 Ga0495606_0012300_4859_5782 305
680 3300046524 Ga0495648_0017408 Ga0495648_0017408_328_1251 305
681 3300046538 Ga0495609_0103927 Ga0495609_0103927_39_962 305
682 3300046558 Ga0495633_0000159 Ga0495633_0000159_71243_72163 305
683 3300046616 Ga0495668_0000003 Ga0495668_0000003_644438_645361 305
684 3300046648 Ga0495611_0001790 Ga0495611_0001790_5417_6337 305
685 3300046648 Ga0495611_0043233 Ga0495611_0043233_112_1032 305
686 3300046660 Ga0495625_0000663 Ga0495625_0000663_27190_28110 305
687 3300046660 Ga0495625_0046382 Ga0495625_0046382_558_1481 305
688 3300046665 Ga0495661_0024459 Ga0495661_0024459_1584_2504 305
689 3300046683 Ga0495658_0047518 Ga0495658_0047518_374_1297 305
690 3300046694 Ga0495649_0037185 Ga0495649_0037185_1153_2073 305
691 3300047320 Ga0495672_0128183 Ga0495672_0128183_73_993 305
692 3300047443 Ga0495687_002423 Ga0495687_002423_10176_11096 305
693 3300047443 Ga0495687_018255 Ga0495687_018255_1752_2675 305
694 3300047472 Ga0495686_0000040 Ga0495686_0000040_240766_241692 305
695 3300047472 Ga0495686_0043016 Ga0495686_0043016_1140_2063 305
696 3300047472 Ga0495686_0198909 Ga0495686_0198909_100_1023 305
697 3300048925 Ga0496122_0001254 Ga0496122_0001254_2327_3250 305
698 3300048926 Ga0496123_0002075 Ga0496123_0002075_5777_6700 305
699 3300049459 Ga0495678_040446 Ga0495678_040446_342_1265 305
700 3300049571 Ga0501034_0213057 Ga0501034_0213057_623_1549 305
701 3300049586 Ga0501070_0063907 Ga0501070_0063907_562_1488 305
702 3300049670 Ga0501236_001334 Ga0501236_001334_11_937 305
703 3300049761 Ga0501264_000679 Ga0501264_000679_2012_2938 305
704 3300050493 nmdc:mga0k408_22188_c2 nmdc:mga0k408_22188_c2_562_1521 305
705 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_74955_75875 305
706 3300053086 Ga0500578_0180556 Ga0500578_0180556_257_1177 305
707 3300053088 Ga0500644_0000415 Ga0500644_0000415_1676_2602 305
708 3300053092 Ga0500583_0001157 Ga0500583_0001157_3066_3986 305
709 3300053092 Ga0500583_0027619 Ga0500583_0027619_385_1305 305
710 3300053125 Ga0500618_000026 Ga0500618_000026_27331_28251 305
711 3300053131 Ga0500652_030618 Ga0500652_030618_666_1598 305
712 3300053139 Ga0500568_0072145 Ga0500568_0072145_160_1080 305
713 3300053146 Ga0500588_0000391 Ga0500588_0000391_5343_6263 305
714 3300053147 Ga0500589_038312 Ga0500589_038312_865_1785 305
715 3300053151 Ga0500604_0010616 Ga0500604_0010616_1184_2104 305
716 3300053153 Ga0500616_0013208 Ga0500616_0013208_2162_3088 305
717 3300053153 Ga0500616_0090181 Ga0500616_0090181_492_1418 305
718 3300053156 Ga0500622_0000034 Ga0500622_0000034_113921_114841 305
719 3300053156 Ga0500622_0034172 Ga0500622_0034172_1657_2577 305
720 3300053160 Ga0500633_0000454 Ga0500633_0000454_5176_6102 305
721 3300053177 Ga0500636_0014649 Ga0500636_0014649_3241_4161 305
722 3300053178 Ga0500637_0154862 Ga0500637_0154862_67_987 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

242

321

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

281

320

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8908 199 304
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.882 200 301
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8773 196 303
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.8703 196 304
3mkl-assembly1.cif.gz_A crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8669 196 303
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9821 257 301 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9555 253 304 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9553 258 301 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9508 257 301 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9455 258 302 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q3EPE4-F1-model_v4 deleted 0.9522 213 305
AF-A0A1G8AJA1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9448 219 305 GO:0003700
GO:0043565
AF-A0A1I4TB30-F1-model_v4 Helix-turn-helix domain-containing protein 0.9425 188 303 GO:0003700
GO:0043565
AF-A0A3C0CTA9-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9355 219 304 GO:0003700
GO:0043565
AF-A0A2E5EFX0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9355 222 305 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
87.59 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map