F477413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 300 | 656 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10000235|Ga0075366_1000023516 |
| Length | 323 |
| Sequence | LQKNLRLFIINNNYFSNVTSTKLYRIKTISEFHQLRGLPKPEHPLISVVDYGSIRHTPEFNVTSWTLDFYSISLKRNSAAKMKYGQQDYDFDEGIMFFMAPGQVFSVEINNSLPSIHSGWILLIHPDFLWSTSLAKTIKKYEYFDYSVNEALFLSEKEESTINNIIQNIQLEYHANIDKFSQDIIISQIETLFNYAERFYHRQFITRKKANHQILDRLEVILASYFNSDILTLKGLPTVAYIAGELNVSPNYLSSLLKALTGQSTQQHIHDKLIERAKQKLSTTNLSVSEIAYQLGFEHPQSFSKLFKTKTQVSPLEFRQAFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 4 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 5 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 6 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 7 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 8 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 9 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 10 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 11 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 12 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 13 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 14 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 15 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 16 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 17 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 18 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 19 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 20 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 21 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 22 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 23 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 24 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 25 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 26 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 27 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 28 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 29 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 30 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 31 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 32 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 33 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 34 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 35 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 36 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 37 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 38 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 39 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 43 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 44 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 50 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 53 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 197 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 198 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 199 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 200 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 274 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 276 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 277 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 278 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 279 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 283 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 284 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 285 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 293 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 298 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 299 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 300 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.69 |
| Metatranscriptomes | 0 |
| Isolates | 8.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.45 |
| Nodule | 0 |
| Rhizoplane | 0.14 |
| Rhizosphere | 68.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | SwRhRL2b_contig_3054839 | 2162886007 | Bacteria | 3365 |
| 3 | JGI24740J21852_10002617 | 3300001979 | Bacteria | 8105 |
| 4 | JGI24740J21852_10004228 | 3300001979 | Bacteria | 6200 |
| 5 | JGI24740J21852_10011221 | 3300001979 | Bacteria | 3418 |
| 6 | JGI24739J22299_10010833 | 3300001989 | Bacteria | 3376 |
| 7 | JGI24739J22299_10035090 | 3300001989 | Bacteria | 1703 |
| 8 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 9 | JGI25162J39368_1000650 | 3300002737 | Bacteria | 24576 |
| 10 | JGI25162J39368_1004624 | 3300002737 | Bacteria | 3102 |
| 11 | JGI25154J39366_1000016 | 3300002738 | Bacteria | 255057 |
| 12 | JGI25154J39366_1000021 | 3300002738 | Bacteria | 221559 |
| 13 | JGI25154J39366_1000028 | 3300002738 | Bacteria | 195818 |
| 14 | JGI25154J39366_1000073 | 3300002738 | Bacteria | 92928 |
| 15 | JGI25154J39366_1007707 | 3300002738 | Unclassified | 1447 |
| 16 | JGI25158J39367_1009303 | 3300002739 | Bacteria | 1348 |
| 17 | JGI25157J39369_1002336 | 3300002741 | Bacteria | 4917 |
| 18 | JGI25157J39369_1006944 | 3300002741 | Bacteria | 1676 |
| 19 | JGI25164J39214_1002804 | 3300002772 | Bacteria | 2457 |
| 20 | JGI25165J46597_1001427 | 3300003214 | Bacteria | 12848 |
| 21 | JGI25165J46597_1001861 | 3300003214 | Bacteria | 8710 |
| 22 | JGI25153J46596_10000412 | 3300003215 | Bacteria | 28300 |
| 23 | JGI25153J46596_10003899 | 3300003215 | Bacteria | 8194 |
| 24 | JGI25153J46596_10003991 | 3300003215 | Bacteria | 8066 |
| 25 | JGI25153J46596_10016074 | 3300003215 | Bacteria | 3018 |
| 26 | rootH1_10049637 | 3300003316 | Bacteria | 9342 |
| 27 | rootH1_10136412 | 3300003316 | Bacteria | 2510 |
| 28 | rootH1_10179979 | 3300003316 | Unclassified | 1433 |
| 29 | rootH2_10006586 | 3300003320 | Bacteria | 35799 |
| 30 | rootH2_10011844 | 3300003320 | Bacteria | 47214 |
| 31 | rootH2_10017356 | 3300003320 | Bacteria | 25318 |
| 32 | rootH2_10017519 | 3300003320 | Bacteria | 5939 |
| 33 | rootH2_10039495 | 3300003320 | Bacteria | 12680 |
| 34 | rootH2_10053271 | 3300003320 | Bacteria | 29083 |
| 35 | rootH2_10059195 | 3300003320 | Bacteria | 13284 |
| 36 | rootL2_10035699 | 3300003322 | Bacteria | 8944 |
| 37 | rootL2_10050185 | 3300003322 | Bacteria | 8281 |
| 38 | rootL2_10051367 | 3300003322 | Bacteria | 8904 |
| 39 | rootL2_10054129 | 3300003322 | Bacteria | 16526 |
| 40 | rootL2_10082053 | 3300003322 | Bacteria | 4212 |
| 41 | rootL2_10198918 | 3300003322 | Bacteria | 1208 |
| 42 | rootL2_10221287 | 3300003322 | Bacteria | 3335 |
| 43 | rootL2_10235423 | 3300003322 | Bacteria | 4480 |
| 44 | rootH1_10007228 | 3300003316 | Bacteria | 1529 |
| 45 | rootH1_10007228 | 3300003323 | Bacteria | 16763 |
| 46 | rootH1_10009799 | 3300003323 | Bacteria | 7505 |
| 47 | rootH1_10012561 | 3300003323 | Bacteria | 12653 |
| 48 | rootH1_10012978 | 3300003323 | Bacteria | 27481 |
| 49 | rootH1_10028162 | 3300003323 | Bacteria | 9421 |
| 50 | rootH1_10029695 | 3300003323 | Bacteria | 13788 |
| 51 | rootH1_10053844 | 3300003323 | Unclassified | 3070 |
| 52 | rootH1_10063994 | 3300003323 | Bacteria | 5975 |
| 53 | rootH1_10073247 | 3300003323 | Bacteria | 2152 |
| 54 | rootH1_10085833 | 3300003323 | Bacteria | 12771 |
| 55 | rootH1_10088871 | 3300003323 | Bacteria | 7577 |
| 56 | rootH1_10107342 | 3300003323 | Bacteria | 5548 |
| 57 | rootH1_10192656 | 3300003323 | Bacteria | 3809 |
| 58 | JGI25160J50197_1004139 | 3300003354 | Bacteria | 6322 |
| 59 | JGI25160J50197_1005252 | 3300003354 | Bacteria | 5421 |
| 60 | JGI25160J50197_1010685 | 3300003354 | Bacteria | 3302 |
| 61 | JGI25160J50197_1015296 | 3300003354 | Bacteria | 2525 |
| 62 | Ga0055526_1001833 | 3300003771 | Bacteria | 14701 |
| 63 | Ga0055526_1005671 | 3300003771 | Bacteria | 7087 |
| 64 | Ga0055528_1000072 | 3300003790 | Bacteria | 77661 |
| 65 | Ga0055528_1000400 | 3300003790 | Bacteria | 35185 |
| 66 | Ga0055530_10000052 | 3300003791 | Bacteria | 104501 |
| 67 | Ga0055531_10000030 | 3300003794 | Bacteria | 157459 |
| 68 | Ga0055531_10000063 | 3300003794 | Bacteria | 119938 |
| 69 | Ga0055531_10000324 | 3300003794 | Bacteria | 47052 |
| 70 | Ga0065165_1000038 | 3300005262 | Bacteria | 211664 |
| 71 | Ga0065165_1000052 | 3300005262 | Bacteria | 192010 |
| 72 | Ga0065165_1000104 | 3300005262 | Bacteria | 140410 |
| 73 | Ga0065165_1002831 | 3300005262 | Bacteria | 13547 |
| 74 | Ga0065165_1008355 | 3300005262 | Bacteria | 4864 |
| 75 | Ga0065165_1009648 | 3300005262 | Bacteria | 4292 |
| 76 | Ga0065165_1061846 | 3300005262 | Bacteria | 1023 |
| 77 | Ga0065714_10004857 | 3300005288 | Bacteria | 5363 |
| 78 | Ga0065714_10064427 | 3300005288 | Bacteria | 167245 |
| 79 | Ga0065714_10064627 | 3300005288 | Bacteria | 27603 |
| 80 | Ga0065714_10065152 | 3300005288 | Bacteria | 12474 |
| 81 | Ga0065714_10065174 | 3300005288 | Bacteria | 12226 |
| 82 | Ga0065714_10072760 | 3300005288 | Bacteria | 3306 |
| 83 | Ga0065714_10073661 | 3300005288 | Bacteria | 3151 |
| 84 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 85 | Ga0065704_10071425 | 3300005289 | Bacteria | 11233 |
| 86 | Ga0065704_10071791 | 3300005289 | Bacteria | 9938 |
| 87 | Ga0065704_10074739 | 3300005289 | Bacteria | 6030 |
| 88 | Ga0065715_10116786 | 3300005293 | Bacteria | 2369 |
| 89 | Ga0070676_10000259 | 3300005328 | Bacteria | 23074 |
| 90 | Ga0070683_100123265 | 3300005329 | Bacteria | 2449 |
| 91 | Ga0070670_100215176 | 3300005331 | Bacteria | 1671 |
| 92 | Ga0068869_100119585 | 3300005334 | Bacteria | 2013 |
| 93 | Ga0070666_10000041 | 3300005335 | Bacteria | 112410 |
| 94 | Ga0068868_100021703 | 3300005338 | Bacteria | 4838 |
| 95 | Ga0068868_100046305 | 3300005338 | Bacteria | 3404 |
| 96 | Ga0068868_100061094 | 3300005338 | Bacteria | 2985 |
| 97 | Ga0068868_100062299 | 3300005338 | Bacteria | 2956 |
| 98 | Ga0070668_100301027 | 3300005347 | Bacteria | 1345 |
| 99 | Ga0070668_100440224 | 3300005347 | Bacteria | 1119 |
| 100 | Ga0070669_100016646 | 3300005353 | Bacteria | 5248 |
| 101 | Ga0070669_100059425 | 3300005353 | Bacteria | 2807 |
| 102 | Ga0070671_100097921 | 3300005355 | Bacteria | 2460 |
| 103 | Ga0070671_100236417 | 3300005355 | Bacteria | 1551 |
| 104 | Ga0070673_100370828 | 3300005364 | Bacteria | 1274 |
| 105 | Ga0070659_100176570 | 3300005366 | Bacteria | 1751 |
| 106 | Ga0070667_100027616 | 3300005367 | Bacteria | 4722 |
| 107 | Ga0070667_100037449 | 3300005367 | Bacteria | 4066 |
| 108 | Ga0070678_100258702 | 3300005456 | Bacteria | 1463 |
| 109 | Ga0070662_100000449 | 3300005457 | Bacteria | 24260 |
| 110 | Ga0070662_100168923 | 3300005457 | Bacteria | 1716 |
| 111 | Ga0070681_10291296 | 3300005458 | Bacteria | 1542 |
| 112 | Ga0068867_100173810 | 3300005459 | Bacteria | 1708 |
| 113 | Ga0070698_100027821 | 3300005471 | Bacteria | 5875 |
| 114 | Ga0070698_100183280 | 3300005471 | Bacteria | 2032 |
| 115 | Ga0070699_100046903 | 3300005518 | Bacteria | 3739 |
| 116 | Ga0070684_100092912 | 3300005535 | Bacteria | 2685 |
| 117 | Ga0070697_100328973 | 3300005536 | Bacteria | 1317 |
| 118 | Ga0068853_100021248 | 3300005539 | Bacteria | 5408 |
| 119 | Ga0068853_100061766 | 3300005539 | Bacteria | 3241 |
| 120 | Ga0068853_100067715 | 3300005539 | Bacteria | 3102 |
| 121 | Ga0068853_100095697 | 3300005539 | Bacteria | 2619 |
| 122 | Ga0068853_100112138 | 3300005539 | Bacteria | 2424 |
| 123 | Ga0068853_100155890 | 3300005539 | Bacteria | 2058 |
| 124 | Ga0068853_100169231 | 3300005539 | Bacteria | 1976 |
| 125 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 126 | Ga0070665_100000125 | 3300005548 | Bacteria | 146809 |
| 127 | Ga0070665_100000205 | 3300005548 | Bacteria | 103515 |
| 128 | Ga0070704_100152645 | 3300005549 | Bacteria | 1818 |
| 129 | Ga0068855_100011059 | 3300005563 | Bacteria | 10888 |
| 130 | Ga0068855_100025193 | 3300005563 | Bacteria | 7122 |
| 131 | Ga0068855_100246644 | 3300005563 | Bacteria | 1993 |
| 132 | Ga0068855_100360068 | 3300005563 | Bacteria | 1601 |
| 133 | Ga0068857_100031624 | 3300005577 | Bacteria | 4677 |
| 134 | Ga0068857_100044420 | 3300005577 | Bacteria | 3941 |
| 135 | Ga0068857_100046935 | 3300005577 | Bacteria | 3834 |
| 136 | Ga0068857_100268592 | 3300005577 | Bacteria | 1567 |
| 137 | Ga0068854_100035592 | 3300005578 | Bacteria | 3486 |
| 138 | Ga0068856_100002280 | 3300005614 | Bacteria | 19791 |
| 139 | Ga0068856_100016440 | 3300005614 | Bacteria | 7160 |
| 140 | Ga0068856_100164100 | 3300005614 | Bacteria | 2232 |
| 141 | Ga0068852_100009844 | 3300005616 | Bacteria | 7111 |
| 142 | Ga0068852_100041753 | 3300005616 | Bacteria | 3878 |
| 143 | Ga0068852_100091236 | 3300005616 | Bacteria | 2726 |
| 144 | Ga0068852_100643462 | 3300005616 | Bacteria | 1067 |
| 145 | Ga0068859_100000083 | 3300005617 | Bacteria | 87079 |
| 146 | Ga0068859_100007759 | 3300005617 | Bacteria | 10897 |
| 147 | Ga0068864_100208169 | 3300005618 | Bacteria | 1800 |
| 148 | Ga0068864_100237753 | 3300005618 | Bacteria | 1687 |
| 149 | Ga0068851_10012190 | 3300005834 | Bacteria | 4049 |
| 150 | Ga0068851_10064575 | 3300005834 | Bacteria | 1882 |
| 151 | Ga0068863_100121661 | 3300005841 | Bacteria | 2489 |
| 152 | Ga0068863_100216998 | 3300005841 | Bacteria | 1842 |
| 153 | Ga0068858_100050970 | 3300005842 | Bacteria | 3830 |
| 154 | Ga0068860_100018491 | 3300005843 | Bacteria | 6777 |
| 155 | Ga0068860_100018710 | 3300005843 | Bacteria | 6734 |
| 156 | Ga0068860_100043649 | 3300005843 | Bacteria | 4276 |
| 157 | Ga0081539_10001245 | 3300005985 | Bacteria | 45262 |
| 158 | Ga0075366_10000235 | 3300006195 | Bacteria | 24550 |
| 159 | Ga0075366_10078244 | 3300006195 | Bacteria | 1974 |
| 160 | Ga0097621_100000288 | 3300006237 | Bacteria | 33839 |
| 161 | Ga0097621_100012310 | 3300006237 | Bacteria | 6334 |
| 162 | Ga0097621_100098442 | 3300006237 | Bacteria | 2457 |
| 163 | Ga0097621_100240654 | 3300006237 | Bacteria | 1582 |
| 164 | Ga0068871_100000592 | 3300006358 | Bacteria | 24903 |
| 165 | Ga0068871_100144233 | 3300006358 | Bacteria | 2026 |
| 166 | Ga0068871_100206970 | 3300006358 | Bacteria | 1696 |
| 167 | Ga0075430_100146602 | 3300006846 | Bacteria | 1966 |
| 168 | Ga0075433_10173523 | 3300006852 | Bacteria | 1918 |
| 169 | Ga0068865_100000029 | 3300006881 | Bacteria | 91199 |
| 170 | Ga0097620_100000083 | 3300006931 | Bacteria | 87079 |
| 171 | Ga0097620_100007759 | 3300006931 | Bacteria | 10897 |
| 172 | Ga0105244_10016568 | 3300009036 | Bacteria | 4195 |
| 173 | Ga0105240_10000020 | 3300009093 | Bacteria | 399699 |
| 174 | Ga0105240_10000117 | 3300009093 | Bacteria | 165286 |
| 175 | Ga0105240_10001228 | 3300009093 | Bacteria | 44551 |
| 176 | Ga0105240_10005598 | 3300009093 | Bacteria | 18660 |
| 177 | Ga0105240_10078938 | 3300009093 | Bacteria | 4052 |
| 178 | Ga0105240_10085605 | 3300009093 | Bacteria | 3862 |
| 179 | Ga0105240_10125427 | 3300009093 | Bacteria | 3086 |
| 180 | Ga0105240_10295014 | 3300009093 | Bacteria | 1857 |
| 181 | Ga0105240_10325225 | 3300009093 | Bacteria | 1751 |
| 182 | Ga0105245_10182363 | 3300009098 | Bacteria | 2006 |
| 183 | Ga0105247_10005474 | 3300009101 | Bacteria | 8001 |
| 184 | Ga0114129_10005726 | 3300009147 | Bacteria | 17605 |
| 185 | Ga0105243_10065078 | 3300009148 | Bacteria | 2927 |
| 186 | Ga0105241_10000217 | 3300009174 | Bacteria | 43160 |
| 187 | Ga0105241_10001084 | 3300009174 | Bacteria | 20714 |
| 188 | Ga0105241_10001790 | 3300009174 | Bacteria | 16323 |
| 189 | Ga0105241_10009176 | 3300009174 | Bacteria | 7280 |
| 190 | Ga0105241_10036543 | 3300009174 | Bacteria | 3697 |
| 191 | Ga0105241_10134387 | 3300009174 | Bacteria | 2006 |
| 192 | Ga0105241_10252989 | 3300009174 | Bacteria | 1494 |
| 193 | Ga0105241_10491639 | 3300009174 | Bacteria | 1092 |
| 194 | Ga0105242_10014823 | 3300009176 | Bacteria | 6038 |
| 195 | Ga0105237_10000087 | 3300009545 | Bacteria | 124934 |
| 196 | Ga0105237_10003016 | 3300009545 | Bacteria | 20311 |
| 197 | Ga0105237_10007928 | 3300009545 | Bacteria | 11574 |
| 198 | Ga0105237_10009739 | 3300009545 | Bacteria | 10280 |
| 199 | Ga0105237_10016009 | 3300009545 | Bacteria | 7797 |
| 200 | Ga0105237_10022897 | 3300009545 | Bacteria | 6407 |
| 201 | Ga0105237_10042402 | 3300009545 | Bacteria | 4588 |
| 202 | Ga0105237_10345398 | 3300009545 | Bacteria | 1492 |
| 203 | Ga0105238_10003134 | 3300009551 | Bacteria | 16503 |
| 204 | Ga0105238_10171917 | 3300009551 | Bacteria | 2143 |
| 205 | Ga0105239_10000068 | 3300010375 | Bacteria | 144666 |
| 206 | Ga0105239_10000456 | 3300010375 | Bacteria | 59689 |
| 207 | Ga0105239_10000786 | 3300010375 | Bacteria | 45039 |
| 208 | Ga0105239_10001610 | 3300010375 | Bacteria | 29834 |
| 209 | Ga0105239_10013703 | 3300010375 | Bacteria | 9004 |
| 210 | Ga0105239_10028344 | 3300010375 | Bacteria | 6160 |
| 211 | Ga0105239_10034714 | 3300010375 | Bacteria | 5540 |
| 212 | Ga0105239_10049416 | 3300010375 | Bacteria | 4612 |
| 213 | Ga0105239_10050627 | 3300010375 | Bacteria | 4555 |
| 214 | Ga0105239_10138372 | 3300010375 | Bacteria | 2712 |
| 215 | Ga0105239_10144075 | 3300010375 | Bacteria | 2656 |
| 216 | Ga0105239_10150850 | 3300010375 | Bacteria | 2594 |
| 217 | Ga0105239_10188654 | 3300010375 | Bacteria | 2308 |
| 218 | Ga0105239_10251180 | 3300010375 | Bacteria | 1986 |
| 219 | Ga0105239_10423948 | 3300010375 | Bacteria | 1507 |
| 220 | Ga0105246_10012789 | 3300011119 | Bacteria | 5247 |
| 221 | Ga0105246_10037939 | 3300011119 | Bacteria | 3236 |
| 222 | Ga0105246_10046798 | 3300011119 | Bacteria | 2952 |
| 223 | Ga0105246_10107279 | 3300011119 | Bacteria | 2045 |
| 224 | Ga0157373_10000299 | 3300013100 | Bacteria | 40111 |
| 225 | Ga0157373_10006608 | 3300013100 | Bacteria | 8650 |
| 226 | Ga0157373_10012068 | 3300013100 | Bacteria | 6350 |
| 227 | Ga0157373_10028139 | 3300013100 | Bacteria | 4055 |
| 228 | Ga0157373_10096414 | 3300013100 | Bacteria | 2082 |
| 229 | Ga0157371_10023632 | 3300013102 | Bacteria | 4496 |
| 230 | Ga0157371_10062619 | 3300013102 | Bacteria | 2637 |
| 231 | Ga0157371_10070727 | 3300013102 | Bacteria | 2470 |
| 232 | Ga0157371_10075852 | 3300013102 | Bacteria | 2381 |
| 233 | Ga0157371_10111021 | 3300013102 | Bacteria | 1946 |
| 234 | Ga0157370_10000022 | 3300013104 | Bacteria | 163793 |
| 235 | Ga0157370_10007911 | 3300013104 | Bacteria | 11516 |
| 236 | Ga0157370_10064592 | 3300013104 | Bacteria | 3465 |
| 237 | Ga0157370_10147948 | 3300013104 | Bacteria | 2187 |
| 238 | Ga0157370_10161040 | 3300013104 | Bacteria | 2088 |
| 239 | Ga0157370_10466359 | 3300013104 | Bacteria | 1161 |
| 240 | Ga0157369_10000050 | 3300013105 | Bacteria | 167294 |
| 241 | Ga0157369_10001327 | 3300013105 | Bacteria | 30659 |
| 242 | Ga0157369_10010087 | 3300013105 | Bacteria | 10786 |
| 243 | Ga0157374_10000887 | 3300013296 | Bacteria | 26128 |
| 244 | Ga0157378_10001954 | 3300013297 | Bacteria | 18489 |
| 245 | Ga0157378_10013014 | 3300013297 | Bacteria | 7276 |
| 246 | Ga0157378_10014463 | 3300013297 | Bacteria | 6908 |
| 247 | Ga0157378_10181795 | 3300013297 | Bacteria | 1979 |
| 248 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 249 | Ga0163162_10000208 | 3300013306 | Bacteria | 54338 |
| 250 | Ga0163162_10000993 | 3300013306 | Bacteria | 26422 |
| 251 | Ga0163162_10004686 | 3300013306 | Bacteria | 13188 |
| 252 | Ga0163162_10414304 | 3300013306 | Bacteria | 1480 |
| 253 | Ga0157372_10001659 | 3300013307 | Bacteria | 24131 |
| 254 | Ga0157372_10017207 | 3300013307 | Bacteria | 7761 |
| 255 | Ga0157372_10038047 | 3300013307 | Bacteria | 5309 |
| 256 | Ga0157372_10081439 | 3300013307 | Bacteria | 3664 |
| 257 | Ga0157372_10104752 | 3300013307 | Bacteria | 3234 |
| 258 | Ga0157372_10137568 | 3300013307 | Bacteria | 2814 |
| 259 | Ga0157372_10501543 | 3300013307 | Bacteria | 1415 |
| 260 | Ga0157375_10000052 | 3300013308 | Bacteria | 130032 |
| 261 | Ga0157375_10015943 | 3300013308 | Bacteria | 6740 |
| 262 | Ga0157375_10055343 | 3300013308 | Bacteria | 3911 |
| 263 | Ga0163163_10084736 | 3300014325 | Bacteria | 3176 |
| 264 | Ga0182008_10000290 | 3300014497 | Bacteria | 39578 |
| 265 | Ga0157379_10128544 | 3300014968 | Bacteria | 2280 |
| 266 | Ga0157376_10034329 | 3300014969 | Bacteria | 4095 |
| 267 | Ga0157376_10353530 | 3300014969 | Bacteria | 1407 |
| 268 | Ga0182006_1001457 | 3300015261 | Bacteria | 14254 |
| 269 | Ga0182006_1004000 | 3300015261 | Bacteria | 7365 |
| 270 | Ga0182006_1006515 | 3300015261 | Bacteria | 5418 |
| 271 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 272 | Ga0182005_1000120 | 3300015265 | Bacteria | 57067 |
| 273 | Ga0182005_1000200 | 3300015265 | Bacteria | 40796 |
| 274 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 275 | Ga0163161_10000994 | 3300017792 | Bacteria | 21662 |
| 276 | Ga0163161_10007329 | 3300017792 | Bacteria | 7613 |
| 277 | Ga0163161_10007893 | 3300017792 | Bacteria | 7362 |
| 278 | Ga0163161_10102073 | 3300017792 | Bacteria | 2136 |
| 279 | Ga0163161_10168882 | 3300017792 | Bacteria | 1671 |
| 280 | Ga0209436_100514 | 3300025208 | Bacteria | 16873 |
| 281 | Ga0209436_102577 | 3300025208 | Bacteria | 5331 |
| 282 | Ga0209563_104145 | 3300025230 | Bacteria | 2824 |
| 283 | Ga0207427_100152 | 3300025231 | Bacteria | 78389 |
| 284 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 285 | Ga0209437_100043 | 3300025233 | Bacteria | 440454 |
| 286 | Ga0209437_100164 | 3300025233 | Bacteria | 145317 |
| 287 | Ga0209258_103672 | 3300025242 | Bacteria | 3202 |
| 288 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 289 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 290 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 291 | Ga0209646_1000158 | 3300025246 | Bacteria | 92980 |
| 292 | Ga0209646_1002384 | 3300025246 | Bacteria | 4205 |
| 293 | Ga0209646_1003925 | 3300025246 | Bacteria | 2814 |
| 294 | Ga0209026_1000168 | 3300025250 | Bacteria | 100138 |
| 295 | Ga0209026_1000185 | 3300025250 | Bacteria | 91252 |
| 296 | Ga0209026_1000202 | 3300025250 | Bacteria | 82517 |
| 297 | Ga0209026_1000240 | 3300025250 | Bacteria | 71671 |
| 298 | Ga0209148_1000230 | 3300025254 | Bacteria | 91940 |
| 299 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 300 | Ga0209673_1000130 | 3300025273 | Bacteria | 163870 |
| 301 | Ga0209673_1000226 | 3300025273 | Bacteria | 111427 |
| 302 | Ga0209130_1013317 | 3300025284 | Bacteria | 2111 |
| 303 | Ga0209676_1000310 | 3300025292 | Bacteria | 95646 |
| 304 | Ga0209564_1001138 | 3300025295 | Bacteria | 31243 |
| 305 | Ga0209564_1001327 | 3300025295 | Bacteria | 26438 |
| 306 | Ga0209564_1001627 | 3300025295 | Bacteria | 21791 |
| 307 | Ga0209564_1006788 | 3300025295 | Bacteria | 6057 |
| 308 | Ga0209758_1001017 | 3300025297 | Bacteria | 37093 |
| 309 | Ga0209758_1001281 | 3300025297 | Bacteria | 31000 |
| 310 | Ga0209758_1002179 | 3300025297 | Bacteria | 20536 |
| 311 | Ga0209758_1004653 | 3300025297 | Bacteria | 11240 |
| 312 | Ga0209758_1013871 | 3300025297 | Bacteria | 4345 |
| 313 | Ga0209050_1000125 | 3300025298 | Bacteria | 189641 |
| 314 | Ga0209050_1000530 | 3300025298 | Bacteria | 63406 |
| 315 | Ga0209050_1008683 | 3300025298 | Bacteria | 5363 |
| 316 | Ga0207426_1000135 | 3300025302 | Bacteria | 202216 |
| 317 | Ga0207426_1000175 | 3300025302 | Bacteria | 160332 |
| 318 | Ga0207426_1000293 | 3300025302 | Bacteria | 98805 |
| 319 | Ga0207426_1000452 | 3300025302 | Bacteria | 65182 |
| 320 | Ga0207426_1000546 | 3300025302 | Bacteria | 52783 |
| 321 | Ga0207426_1000882 | 3300025302 | Bacteria | 30999 |
| 322 | Ga0207426_1001549 | 3300025302 | Bacteria | 18689 |
| 323 | Ga0207426_1009511 | 3300025302 | Bacteria | 3841 |
| 324 | Ga0207426_1012466 | 3300025302 | Bacteria | 3191 |
| 325 | Ga0207426_1017237 | 3300025302 | Bacteria | 2572 |
| 326 | Ga0209051_1007944 | 3300025303 | Bacteria | 5710 |
| 327 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 328 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 329 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 330 | Ga0209257_1002919 | 3300025304 | Bacteria | 15767 |
| 331 | Ga0209257_1004595 | 3300025304 | Bacteria | 10517 |
| 332 | Ga0207710_10003963 | 3300025900 | Bacteria | 6527 |
| 333 | Ga0207680_10000634 | 3300025903 | Bacteria | 16562 |
| 334 | Ga0207680_10004822 | 3300025903 | Bacteria | 6415 |
| 335 | Ga0207647_10000117 | 3300025904 | Bacteria | 61849 |
| 336 | Ga0207647_10002941 | 3300025904 | Bacteria | 12819 |
| 337 | Ga0207647_10093199 | 3300025904 | Bacteria | 1795 |
| 338 | Ga0207647_10154860 | 3300025904 | Bacteria | 1338 |
| 339 | Ga0207645_10001758 | 3300025907 | Bacteria | 17574 |
| 340 | Ga0207705_10031606 | 3300025909 | Bacteria | 3780 |
| 341 | Ga0207654_10000501 | 3300025911 | Bacteria | 22385 |
| 342 | Ga0207654_10002034 | 3300025911 | Bacteria | 10375 |
| 343 | Ga0207654_10007288 | 3300025911 | Bacteria | 5574 |
| 344 | Ga0207654_10008332 | 3300025911 | Bacteria | 5236 |
| 345 | Ga0207654_10039789 | 3300025911 | Bacteria | 2647 |
| 346 | Ga0207654_10259016 | 3300025911 | Bacteria | 1169 |
| 347 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 348 | Ga0207695_10000077 | 3300025913 | Bacteria | 307107 |
| 349 | Ga0207695_10001743 | 3300025913 | Bacteria | 34552 |
| 350 | Ga0207695_10005927 | 3300025913 | Bacteria | 16016 |
| 351 | Ga0207695_10019624 | 3300025913 | Bacteria | 7777 |
| 352 | Ga0207695_10059122 | 3300025913 | Bacteria | 3977 |
| 353 | Ga0207695_10223985 | 3300025913 | Bacteria | 1787 |
| 354 | Ga0207695_10278830 | 3300025913 | Bacteria | 1566 |
| 355 | Ga0207671_10000096 | 3300025914 | Bacteria | 135750 |
| 356 | Ga0207671_10001505 | 3300025914 | Bacteria | 26868 |
| 357 | Ga0207671_10001628 | 3300025914 | Bacteria | 25558 |
| 358 | Ga0207671_10008266 | 3300025914 | Bacteria | 8852 |
| 359 | Ga0207671_10015560 | 3300025914 | Bacteria | 5950 |
| 360 | Ga0207671_10022112 | 3300025914 | Bacteria | 4813 |
| 361 | Ga0207671_10237629 | 3300025914 | Bacteria | 1431 |
| 362 | Ga0207660_10162444 | 3300025917 | Bacteria | 1724 |
| 363 | Ga0207657_10004524 | 3300025919 | Bacteria | 14691 |
| 364 | Ga0207657_10012983 | 3300025919 | Bacteria | 8187 |
| 365 | Ga0207657_10117206 | 3300025919 | Bacteria | 2193 |
| 366 | Ga0207652_10000180 | 3300025921 | Bacteria | 66974 |
| 367 | Ga0207652_10071695 | 3300025921 | Bacteria | 3011 |
| 368 | Ga0207681_10129380 | 3300025923 | Bacteria | 1864 |
| 369 | Ga0207681_10161117 | 3300025923 | Bacteria | 1691 |
| 370 | Ga0207694_10175254 | 3300025924 | Bacteria | 1738 |
| 371 | Ga0207694_10213769 | 3300025924 | Bacteria | 1571 |
| 372 | Ga0207644_10074788 | 3300025931 | Bacteria | 2487 |
| 373 | Ga0207690_10040839 | 3300025932 | Bacteria | 3036 |
| 374 | Ga0207706_10000044 | 3300025933 | Bacteria | 123576 |
| 375 | Ga0207706_10207900 | 3300025933 | Bacteria | 1716 |
| 376 | Ga0207686_10063662 | 3300025934 | Bacteria | 2346 |
| 377 | Ga0207709_10060206 | 3300025935 | Bacteria | 2366 |
| 378 | Ga0207704_10000144 | 3300025938 | Bacteria | 38148 |
| 379 | Ga0207691_10058089 | 3300025940 | Bacteria | 3519 |
| 380 | Ga0207691_10249200 | 3300025940 | Bacteria | 1534 |
| 381 | Ga0207689_10000746 | 3300025942 | Bacteria | 31196 |
| 382 | Ga0207661_10158549 | 3300025944 | Bacteria | 1962 |
| 383 | Ga0207667_10003555 | 3300025949 | Bacteria | 19273 |
| 384 | Ga0207667_10005479 | 3300025949 | Bacteria | 15471 |
| 385 | Ga0207667_10006819 | 3300025949 | Bacteria | 13800 |
| 386 | Ga0207667_10015804 | 3300025949 | Bacteria | 8554 |
| 387 | Ga0207667_10073213 | 3300025949 | Bacteria | 3560 |
| 388 | Ga0207667_10319701 | 3300025949 | Bacteria | 1585 |
| 389 | Ga0207651_10020505 | 3300025960 | Bacteria | 3991 |
| 390 | Ga0207651_10368491 | 3300025960 | Bacteria | 1214 |
| 391 | Ga0207712_10014860 | 3300025961 | Bacteria | 5013 |
| 392 | Ga0207668_10151722 | 3300025972 | Bacteria | 1795 |
| 393 | Ga0207668_10354876 | 3300025972 | Bacteria | 1227 |
| 394 | Ga0207658_10011346 | 3300025986 | Bacteria | 6063 |
| 395 | Ga0207677_10010714 | 3300026023 | Bacteria | 5196 |
| 396 | Ga0207677_10046737 | 3300026023 | Bacteria | 2901 |
| 397 | Ga0207677_10061359 | 3300026023 | Bacteria | 2603 |
| 398 | Ga0207703_10004577 | 3300026035 | Bacteria | 11335 |
| 399 | Ga0207639_10010820 | 3300026041 | Bacteria | 6326 |
| 400 | Ga0207639_10024535 | 3300026041 | Bacteria | 4365 |
| 401 | Ga0207639_10109045 | 3300026041 | Bacteria | 2252 |
| 402 | Ga0207639_10137008 | 3300026041 | Bacteria | 2035 |
| 403 | Ga0207639_10149689 | 3300026041 | Bacteria | 1954 |
| 404 | Ga0207702_10040257 | 3300026078 | Bacteria | 3918 |
| 405 | Ga0207702_10103048 | 3300026078 | Bacteria | 2523 |
| 406 | Ga0207702_10501010 | 3300026078 | Bacteria | 1184 |
| 407 | Ga0207641_10001993 | 3300026088 | Bacteria | 19491 |
| 408 | Ga0207648_10024015 | 3300026089 | Bacteria | 5449 |
| 409 | Ga0207676_10219125 | 3300026095 | Bacteria | 1693 |
| 410 | Ga0207674_10045323 | 3300026116 | Bacteria | 4524 |
| 411 | Ga0207674_10087632 | 3300026116 | Bacteria | 3106 |
| 412 | Ga0207674_10098720 | 3300026116 | Bacteria | 2903 |
| 413 | Ga0207674_10176237 | 3300026116 | Bacteria | 2090 |
| 414 | Ga0207674_10330946 | 3300026116 | Bacteria | 1473 |
| 415 | Ga0207683_10012346 | 3300026121 | Bacteria | 7288 |
| 416 | Ga0207698_10140892 | 3300026142 | Bacteria | 2077 |
| 417 | Ga0207698_10163885 | 3300026142 | Bacteria | 1948 |
| 418 | Ga0207698_10170501 | 3300026142 | Bacteria | 1915 |
| 419 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 420 | Ga0268266_10000132 | 3300028379 | Bacteria | 145563 |
| 421 | Ga0268266_10000333 | 3300028379 | Bacteria | 74168 |
| 422 | Ga0268264_10006483 | 3300028381 | Bacteria | 9853 |
| 423 | Ga0268264_10009773 | 3300028381 | Bacteria | 7941 |
| 424 | Ga0268264_10121368 | 3300028381 | Bacteria | 2303 |
| 425 | Ga0265334_10019771 | 3300028573 | Bacteria | 2765 |
| 426 | Ga0265334_10021766 | 3300028573 | Unclassified | 2617 |
| 427 | Ga0307515_10000299 | 3300028794 | Bacteria | 122087 |
| 428 | Ga0307515_10013796 | 3300028794 | Bacteria | 15058 |
| 429 | Ga0307515_10102161 | 3300028794 | Bacteria | 3452 |
| 430 | Ga0265338_10028957 | 3300028800 | Bacteria | 5507 |
| 431 | Ga0265338_10135871 | 3300028800 | Bacteria | 1933 |
| 432 | Ga0265338_10280726 | 3300028800 | Bacteria | 1217 |
| 433 | Ga0265338_10303418 | 3300028800 | Bacteria | 1160 |
| 434 | Ga0265324_10071972 | 3300029957 | Unclassified | 1178 |
| 435 | Ga0307511_10000046 | 3300030521 | Bacteria | 100284 |
| 436 | Ga0307511_10000139 | 3300030521 | Bacteria | 67385 |
| 437 | Ga0316177_1055781 | 3300030731 | Bacteria | 4311 |
| 438 | Ga0316177_1062757 | 3300030731 | Bacteria | 5195 |
| 439 | Ga0316177_1203066 | 3300030731 | Bacteria | 10306 |
| 440 | Ga0316176_1023444 | 3300030732 | Bacteria | 24481 |
| 441 | Ga0316176_1070747 | 3300030732 | Bacteria | 28508 |
| 442 | Ga0316176_1114001 | 3300030732 | Bacteria | 10292 |
| 443 | Ga0316179_1094714 | 3300030734 | Bacteria | 3658 |
| 444 | Ga0316183_1073918 | 3300030742 | Bacteria | 38322 |
| 445 | Ga0316183_1079365 | 3300030742 | Bacteria | 35752 |
| 446 | Ga0316183_1211687 | 3300030742 | Bacteria | 37631 |
| 447 | Ga0316181_1015635 | 3300030744 | Bacteria | 11896 |
| 448 | Ga0316181_1220040 | 3300030744 | Bacteria | 23387 |
| 449 | Ga0316181_1258294 | 3300030744 | Bacteria | 2228 |
| 450 | Ga0265330_10039211 | 3300031235 | Unclassified | 2105 |
| 451 | Ga0265331_10011097 | 3300031250 | Bacteria | 4943 |
| 452 | Ga0265327_10000306 | 3300031251 | Bacteria | 95199 |
| 453 | Ga0265327_10104704 | 3300031251 | Bacteria | 1360 |
| 454 | Ga0265316_10057982 | 3300031344 | Unclassified | 3018 |
| 455 | Ga0307509_10048470 | 3300031507 | Bacteria | 4562 |
| 456 | Ga0307509_10053420 | 3300031507 | Bacteria | 4309 |
| 457 | Ga0307408_100005638 | 3300031548 | Bacteria | 8368 |
| 458 | Ga0307408_100066292 | 3300031548 | Bacteria | 2651 |
| 459 | Ga0307408_100124191 | 3300031548 | Bacteria | 2004 |
| 460 | Ga0307405_10000002 | 3300031731 | Bacteria | 575196 |
| 461 | Ga0307405_10091577 | 3300031731 | Bacteria | 2015 |
| 462 | Ga0307413_10000188 | 3300031824 | Bacteria | 17709 |
| 463 | Ga0307410_10000018 | 3300031852 | Bacteria | 69156 |
| 464 | Ga0307410_10006559 | 3300031852 | Bacteria | 6291 |
| 465 | Ga0307406_10000243 | 3300031901 | Bacteria | 32852 |
| 466 | Ga0307406_10000422 | 3300031901 | Bacteria | 24633 |
| 467 | Ga0307406_10013865 | 3300031901 | Bacteria | 4627 |
| 468 | Ga0307406_10291095 | 3300031901 | Bacteria | 1250 |
| 469 | Ga0307407_10000808 | 3300031903 | Bacteria | 10373 |
| 470 | Ga0307407_10070377 | 3300031903 | Bacteria | 2079 |
| 471 | Ga0307412_10000179 | 3300031911 | Bacteria | 44961 |
| 472 | Ga0307414_10000002 | 3300032004 | Bacteria | 623006 |
| 473 | Ga0307414_10000008 | 3300032004 | Bacteria | 375832 |
| 474 | Ga0307414_10000024 | 3300032004 | Bacteria | 205727 |
| 475 | Ga0307414_10002617 | 3300032004 | Bacteria | 9467 |
| 476 | Ga0307414_10008772 | 3300032004 | Bacteria | 5765 |
| 477 | Ga0307414_10024385 | 3300032004 | Bacteria | 3857 |
| 478 | Ga0307411_10000008 | 3300032005 | Bacteria | 321575 |
| 479 | Ga0307411_10001132 | 3300032005 | Bacteria | 10430 |
| 480 | Ga0307411_10001224 | 3300032005 | Bacteria | 10202 |
| 481 | Ga0316583_10049290 | 3300032133 | Bacteria | 1483 |
| 482 | Ga0307510_10010171 | 3300033180 | Bacteria | 11185 |
| 483 | Ga0307510_10015549 | 3300033180 | Bacteria | 9002 |
| 484 | Ga0436361_0292109 | 3300039447 | Bacteria | 16952 |
| 485 | Ga0439447_000827 | 3300041407 | Bacteria | 11348 |
| 486 | Ga0439466_0000400 | 3300041411 | Bacteria | 16601 |
| 487 | Ga0439466_0001202 | 3300041411 | Bacteria | 10062 |
| 488 | Ga0451800_1401227 | 3300041459 | Bacteria | 1108 |
| 489 | Ga0439431_0001837 | 3300041997 | Bacteria | 4705 |
| 490 | Ga0439431_0054950 | 3300041997 | Unclassified | 1039 |
| 491 | Ga0439445_0000048 | 3300042004 | Bacteria | 17050 |
| 492 | Ga0466969_0000282 | 3300044656 | Bacteria | 27814 |
| 493 | Ga0466969_0001133 | 3300044656 | Bacteria | 14335 |
| 494 | Ga0466972_0000077 | 3300044658 | Bacteria | 91574 |
| 495 | Ga0466972_0000235 | 3300044658 | Bacteria | 38259 |
| 496 | Ga0466972_0005859 | 3300044658 | Bacteria | 6161 |
| 497 | Ga0466972_0008131 | 3300044658 | Bacteria | 5259 |
| 498 | Ga0466965_0037929 | 3300044683 | Unclassified | 2366 |
| 499 | Ga0466965_0120426 | 3300044683 | Bacteria | 1355 |
| 500 | Ga0466965_0121953 | 3300044683 | Bacteria | 1347 |
| 501 | Ga0466966_0000014 | 3300044684 | Bacteria | 127891 |
| 502 | Ga0466966_0000147 | 3300044684 | Bacteria | 44993 |
| 503 | Ga0466966_0015812 | 3300044684 | Bacteria | 4986 |
| 504 | Ga0466961_0096155 | 3300044693 | Bacteria | 1868 |
| 505 | Ga0466961_0142401 | 3300044693 | Bacteria | 1500 |
| 506 | Ga0466961_0196348 | 3300044693 | Bacteria | 1249 |
| 507 | Ga0466964_0012685 | 3300044706 | Bacteria | 3190 |
| 508 | Ga0466964_0012905 | 3300044706 | Bacteria | 3165 |
| 509 | Ga0466964_0047540 | 3300044706 | Bacteria | 1752 |
| 510 | Ga0466968_0009531 | 3300044735 | Bacteria | 3736 |
| 511 | Ga0466968_0023808 | 3300044735 | Bacteria | 2498 |
| 512 | Ga0466970_0002985 | 3300044765 | Bacteria | 8200 |
| 513 | Ga0466970_0028608 | 3300044765 | Bacteria | 2930 |
| 514 | Ga0466970_0089820 | 3300044765 | Unclassified | 1667 |
| 515 | Ga0466957_0000474 | 3300044842 | Bacteria | 19959 |
| 516 | Ga0466957_0001027 | 3300044842 | Bacteria | 14399 |
| 517 | Ga0466957_0020301 | 3300044842 | Bacteria | 3909 |
| 518 | Ga0466960_0009625 | 3300044901 | Bacteria | 3990 |
| 519 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 520 | Ga0466959_0000011 | 3300045049 | Bacteria | 173387 |
| 521 | Ga0466959_0000013 | 3300045049 | Bacteria | 157000 |
| 522 | Ga0466959_0033002 | 3300045049 | Bacteria | 3831 |
| 523 | Ga0466959_0055694 | 3300045049 | Bacteria | 2886 |
| 524 | Ga0466959_0081890 | 3300045049 | Bacteria | 2326 |
| 525 | Ga0495627_002044 | 3300046453 | Bacteria | 10345 |
| 526 | Ga0495627_010661 | 3300046453 | Bacteria | 3331 |
| 527 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 528 | Ga0495638_0000050 | 3300046460 | Bacteria | 206131 |
| 529 | Ga0495638_0033930 | 3300046460 | Bacteria | 3260 |
| 530 | Ga0495638_0042600 | 3300046460 | Bacteria | 2867 |
| 531 | Ga0495650_0010640 | 3300046471 | Bacteria | 5116 |
| 532 | Ga0495585_0000902 | 3300046492 | Bacteria | 25158 |
| 533 | Ga0495606_0000142 | 3300046507 | Bacteria | 123277 |
| 534 | Ga0495606_0003060 | 3300046507 | Bacteria | 18234 |
| 535 | Ga0495606_0007133 | 3300046507 | Bacteria | 10100 |
| 536 | Ga0495606_0012300 | 3300046507 | Bacteria | 6882 |
| 537 | Ga0495606_0013090 | 3300046507 | Bacteria | 6589 |
| 538 | Ga0495610_0000747 | 3300046512 | Bacteria | 30695 |
| 539 | Ga0495610_0022799 | 3300046512 | Bacteria | 3415 |
| 540 | Ga0495616_0010696 | 3300046513 | Bacteria | 5298 |
| 541 | Ga0495632_0008332 | 3300046519 | Bacteria | 6374 |
| 542 | Ga0495648_0012417 | 3300046524 | Bacteria | 6356 |
| 543 | Ga0495648_0017408 | 3300046524 | Bacteria | 5136 |
| 544 | Ga0495609_0000480 | 3300046538 | Bacteria | 32078 |
| 545 | Ga0495609_0103927 | 3300046538 | Bacteria | 1229 |
| 546 | Ga0495633_0000159 | 3300046558 | Bacteria | 88400 |
| 547 | Ga0495633_0000263 | 3300046558 | Bacteria | 62381 |
| 548 | Ga0495633_0001455 | 3300046558 | Bacteria | 18369 |
| 549 | Ga0495633_0003178 | 3300046558 | Bacteria | 11099 |
| 550 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 551 | Ga0495611_0001790 | 3300046648 | Bacteria | 10332 |
| 552 | Ga0495611_0043233 | 3300046648 | Bacteria | 2014 |
| 553 | Ga0495625_0000663 | 3300046660 | Bacteria | 49012 |
| 554 | Ga0495625_0001290 | 3300046660 | Bacteria | 31476 |
| 555 | Ga0495625_0003418 | 3300046660 | Bacteria | 15856 |
| 556 | Ga0495625_0011872 | 3300046660 | Bacteria | 7074 |
| 557 | Ga0495625_0013086 | 3300046660 | Bacteria | 6684 |
| 558 | Ga0495625_0030083 | 3300046660 | Bacteria | 4055 |
| 559 | Ga0495625_0043716 | 3300046660 | Bacteria | 3248 |
| 560 | Ga0495625_0046382 | 3300046660 | Bacteria | 3136 |
| 561 | Ga0495661_0024459 | 3300046665 | Bacteria | 3909 |
| 562 | Ga0495658_0047518 | 3300046683 | Bacteria | 2417 |
| 563 | Ga0495649_0037185 | 3300046694 | Bacteria | 2673 |
| 564 | Ga0495660_0009167 | 3300046810 | Bacteria | 5780 |
| 565 | Ga0495672_0088216 | 3300047320 | Bacteria | 1710 |
| 566 | Ga0495672_0128183 | 3300047320 | Bacteria | 1338 |
| 567 | Ga0495687_002423 | 3300047443 | Bacteria | 15009 |
| 568 | Ga0495687_018255 | 3300047443 | Bacteria | 3470 |
| 569 | Ga0495686_0000040 | 3300047472 | Bacteria | 301210 |
| 570 | Ga0495686_0000079 | 3300047472 | Bacteria | 202668 |
| 571 | Ga0495686_0000355 | 3300047472 | Bacteria | 74939 |
| 572 | Ga0495686_0000524 | 3300047472 | Bacteria | 55256 |
| 573 | Ga0495686_0000607 | 3300047472 | Bacteria | 49581 |
| 574 | Ga0495686_0022398 | 3300047472 | Unclassified | 4181 |
| 575 | Ga0495686_0043016 | 3300047472 | Bacteria | 2868 |
| 576 | Ga0495686_0198909 | 3300047472 | Bacteria | 1151 |
| 577 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 578 | Ga0496122_0001254 | 3300048925 | Bacteria | 42541 |
| 579 | Ga0496123_0002075 | 3300048926 | Bacteria | 25802 |
| 580 | Ga0496125_0008240 | 3300048928 | Bacteria | 10951 |
| 581 | Ga0496125_0011846 | 3300048928 | Bacteria | 8688 |
| 582 | Ga0496126_0014030 | 3300048929 | Bacteria | 8121 |
| 583 | Ga0496126_0018056 | 3300048929 | Bacteria | 7008 |
| 584 | Ga0496126_0026178 | 3300048929 | Bacteria | 5597 |
| 585 | Ga0496126_0367928 | 3300048929 | Bacteria | 1173 |
| 586 | Ga0495678_016614 | 3300049459 | Bacteria | 3360 |
| 587 | Ga0495678_040446 | 3300049459 | Bacteria | 1874 |
| 588 | Ga0501034_0213057 | 3300049571 | Bacteria | 1886 |
| 589 | Ga0501070_0063907 | 3300049586 | Bacteria | 3049 |
| 590 | Ga0501070_0242689 | 3300049586 | Unclassified | 1474 |
| 591 | Ga0501070_0402726 | 3300049586 | Bacteria | 1106 |
| 592 | Ga0501236_001334 | 3300049670 | Bacteria | 2802 |
| 593 | Ga0501238_000293 | 3300049671 | Bacteria | 6584 |
| 594 | Ga0501238_000427 | 3300049671 | Bacteria | 5002 |
| 595 | Ga0501225_0000389 | 3300049705 | Bacteria | 13834 |
| 596 | Ga0501225_0014746 | 3300049705 | Bacteria | 2180 |
| 597 | Ga0501080_0281275 | 3300049742 | Bacteria | 1512 |
| 598 | Ga0501083_0092236 | 3300049744 | Bacteria | 1999 |
| 599 | Ga0501241_001093 | 3300049758 | Bacteria | 5707 |
| 600 | Ga0501241_005584 | 3300049758 | Bacteria | 2342 |
| 601 | Ga0501241_010875 | 3300049758 | Bacteria | 1653 |
| 602 | Ga0501264_000679 | 3300049761 | Bacteria | 4668 |
| 603 | Ga0501044_0072765 | 3300049823 | Bacteria | 3495 |
| 604 | Ga0501044_0293412 | 3300049823 | Bacteria | 1557 |
| 605 | nmdc:mga0k408_22188_c2 | 3300050493 | Bacteria | 1646 |
| 606 | nmdc:mga0k408_31_c1 | 3300050493 | Bacteria | 85612 |
| 607 | nmdc:mga05p37_29731_c1 | 3300050507 | Bacteria | 6667 |
| 608 | Ga0500578_0000003 | 3300053086 | Bacteria | 266033 |
| 609 | Ga0500578_0000312 | 3300053086 | Bacteria | 59640 |
| 610 | Ga0500578_0001042 | 3300053086 | Bacteria | 30296 |
| 611 | Ga0500578_0180556 | 3300053086 | Bacteria | 1301 |
| 612 | Ga0500578_0292207 | 3300053086 | Bacteria | 969 |
| 613 | Ga0500644_0000415 | 3300053088 | Bacteria | 20101 |
| 614 | Ga0500583_0001157 | 3300053092 | Bacteria | 7520 |
| 615 | Ga0500583_0005578 | 3300053092 | Unclassified | 4235 |
| 616 | Ga0500583_0027619 | 3300053092 | Unclassified | 2452 |
| 617 | Ga0500651_0000303 | 3300053093 | Bacteria | 28480 |
| 618 | Ga0500562_000066 | 3300053108 | Bacteria | 51218 |
| 619 | Ga0500592_001839 | 3300053116 | Bacteria | 3420 |
| 620 | Ga0500594_0007676 | 3300053118 | Bacteria | 2446 |
| 621 | Ga0500608_027912 | 3300053122 | Bacteria | 2661 |
| 622 | Ga0500618_000026 | 3300053125 | Bacteria | 148672 |
| 623 | Ga0500642_0090282 | 3300053130 | Bacteria | 1415 |
| 624 | Ga0500652_012834 | 3300053131 | Bacteria | 2953 |
| 625 | Ga0500652_030618 | 3300053131 | Bacteria | 2105 |
| 626 | Ga0500655_011923 | 3300053133 | Bacteria | 1579 |
| 627 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 628 | Ga0500568_0038214 | 3300053139 | Bacteria | 1943 |
| 629 | Ga0500568_0072145 | 3300053139 | Bacteria | 1321 |
| 630 | Ga0500588_0000391 | 3300053146 | Bacteria | 6835 |
| 631 | Ga0500589_038312 | 3300053147 | Unclassified | 2238 |
| 632 | Ga0500604_0010616 | 3300053151 | Bacteria | 2465 |
| 633 | Ga0500616_0013208 | 3300053153 | Bacteria | 4806 |
| 634 | Ga0500616_0048643 | 3300053153 | Bacteria | 2247 |
| 635 | Ga0500616_0060369 | 3300053153 | Bacteria | 1966 |
| 636 | Ga0500616_0090181 | 3300053153 | Bacteria | 1520 |
| 637 | Ga0500622_0000034 | 3300053156 | Bacteria | 187647 |
| 638 | Ga0500622_0000051 | 3300053156 | Bacteria | 145514 |
| 639 | Ga0500622_0000213 | 3300053156 | Bacteria | 61430 |
| 640 | Ga0500622_0001051 | 3300053156 | Bacteria | 23014 |
| 641 | Ga0500622_0001201 | 3300053156 | Bacteria | 21308 |
| 642 | Ga0500622_0001368 | 3300053156 | Bacteria | 19678 |
| 643 | Ga0500622_0001589 | 3300053156 | Bacteria | 17882 |
| 644 | Ga0500622_0027948 | 3300053156 | Bacteria | 2972 |
| 645 | Ga0500622_0034172 | 3300053156 | Bacteria | 2664 |
| 646 | Ga0500633_0000454 | 3300053160 | Bacteria | 6464 |
| 647 | Ga0500633_0002778 | 3300053160 | Unclassified | 3680 |
| 648 | Ga0500636_0014649 | 3300053177 | Bacteria | 4611 |
| 649 | Ga0500637_0154862 | 3300053178 | Bacteria | 1323 |
| 650 | Ga0500645_010433 | 3300053730 | Bacteria | 3075 |
| 651 | Ga0501084_0028092 | 3300054114 | Bacteria | 4701 |
| 652 | Ga0500661_005951 | 3300055283 | Bacteria | 2273 |
| 653 | Ga0500661_009524 | 3300055283 | Bacteria | 1776 |
| 654 | Ga0500661_031200 | 3300055283 | Unclassified | 940 |
| 655 | Ga0466962_0024349 | 3300061719 | Bacteria | 2908 |
| 656 | Ga0466962_0100937 | 3300061719 | Bacteria | 1386 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0242689 | Ga0501070_0242689_663_1463 | 248 |
| 2 | 3300009036 | Ga0105244_10016568 | Ga0105244_100165681 | 254 |
| 3 | 3300053156 | Ga0500622_0000213 | Ga0500622_0000213_45194_46048 | 255 |
| 4 | 3300025972 | Ga0207668_10151722 | Ga0207668_101517221 | 256 |
| 5 | 3300053156 | Ga0500622_0001201 | Ga0500622_0001201_20005_20913 | 257 |
| 6 | 3300003322 | rootL2_10050185 | rootL2_100501852 | 262 |
| 7 | 3300055283 | Ga0500661_005951 | Ga0500661_005951_273_1130 | 265 |
| 8 | 3300046660 | Ga0495625_0011872 | Ga0495625_0011872_3825_4631 | 267 |
| 9 | 3300005262 | Ga0065165_1009648 | Ga0065165_10096482 | 268 |
| 10 | 3300025208 | Ga0209436_102577 | Ga0209436_1025773 | 268 |
| 11 | 3300025302 | Ga0207426_1012466 | Ga0207426_10124663 | 268 |
| 12 | 3300010375 | Ga0105239_10144075 | Ga0105239_101440753 | 269 |
| 13 | 3300032004 | Ga0307414_10002617 | Ga0307414_100026178 | 270 |
| 14 | 3300041997 | Ga0439431_0001837 | Ga0439431_0001837_3395_4249 | 271 |
| 15 | 3300046507 | Ga0495606_0007133 | Ga0495606_0007133_9250_10068 | 271 |
| 16 | 3300053086 | Ga0500578_0292207 | Ga0500578_0292207_112_933 | 271 |
| 17 | 3300005288 | Ga0065714_10064427 | Ga0065714_1006442745 | 272 |
| 18 | 3300030731 | Ga0316177_1203066 | Ga0316177_12030665 | 272 |
| 19 | 3300030732 | Ga0316176_1070747 | Ga0316176_10707479 | 272 |
| 20 | 3300055283 | Ga0500661_031200 | Ga0500661_031200_40_864 | 273 |
| 21 | 3300013104 | Ga0157370_10466359 | Ga0157370_104663591 | 274 |
| 22 | 3300041459 | Ga0451800_1401227 | Ga0451800_1401227_269_1093 | 274 |
| 23 | 3300001989 | JGI24739J22299_10035090 | JGI24739J22299_100350902 | 275 |
| 24 | 3300009174 | Ga0105241_10252989 | Ga0105241_102529892 | 275 |
| 25 | 3300015682 | Ga0183373_1001 | Ga0183373_100151 | 275 |
| 26 | 3300025242 | Ga0209258_103672 | Ga0209258_1036724 | 275 |
| 27 | 3300032004 | Ga0307414_10000024 | Ga0307414_1000002494 | 275 |
| 28 | 3300046524 | Ga0495648_0012417 | Ga0495648_0012417_5475_6305 | 275 |
| 29 | 3300053130 | Ga0500642_0090282 | Ga0500642_0090282_33_863 | 275 |
| 30 | 3300005353 | Ga0070669_100016646 | Ga0070669_1000166461 | 276 |
| 31 | 3300025923 | Ga0207681_10161117 | Ga0207681_101611172 | 276 |
| 32 | 3300030742 | Ga0316183_1073918 | Ga0316183_107391817 | 276 |
| 33 | 3300030744 | Ga0316181_1015635 | Ga0316181_10156359 | 276 |
| 34 | 3300003323 | rootH1_10053844 | rootH1_100538442 | 278 |
| 35 | 3300005289 | Ga0065704_10071425 | Ga0065704_100714259 | 279 |
| 36 | 3300015265 | Ga0182005_1000120 | Ga0182005_100012040 | 279 |
| 37 | 3300005289 | Ga0065704_10074739 | Ga0065704_100747394 | 280 |
| 38 | 2162886007 | SwRhRL2b_contig_3054839 | SwRhRL2b_0180.00006100 | 281 |
| 39 | 3300009545 | Ga0105237_10000087 | Ga0105237_1000008768 | 281 |
| 40 | 3300010375 | Ga0105239_10000068 | Ga0105239_1000006833 | 281 |
| 41 | 3300011119 | Ga0105246_10037939 | Ga0105246_100379391 | 281 |
| 42 | 3300013100 | Ga0157373_10006608 | Ga0157373_100066088 | 281 |
| 43 | 3300013105 | Ga0157369_10000050 | Ga0157369_10000050119 | 281 |
| 44 | 3300015262 | Ga0182007_10000008 | Ga0182007_10000008291 | 281 |
| 45 | 3300041997 | Ga0439431_0054950 | Ga0439431_0054950_137_991 | 281 |
| 46 | 3300046519 | Ga0495632_0008332 | Ga0495632_0008332_5128_5982 | 281 |
| 47 | 3300046558 | Ga0495633_0003178 | Ga0495633_0003178_4769_5623 | 281 |
| 48 | 3300046660 | Ga0495625_0003418 | Ga0495625_0003418_6416_7270 | 281 |
| 49 | 3300053092 | Ga0500583_0005578 | Ga0500583_0005578_961_1815 | 281 |
| 50 | 3300053131 | Ga0500652_012834 | Ga0500652_012834_64_918 | 281 |
| 51 | 3300053133 | Ga0500655_011923 | Ga0500655_011923_678_1532 | 281 |
| 52 | 3300053139 | Ga0500568_0038214 | Ga0500568_0038214_986_1840 | 281 |
| 53 | 3300047472 | Ga0495686_0022398 | Ga0495686_0022398_630_1538 | 282 |
| 54 | 3300053156 | Ga0500622_0001368 | Ga0500622_0001368_6207_7115 | 282 |
| 55 | 3300049586 | Ga0501070_0402726 | Ga0501070_0402726_80_988 | 284 |
| 56 | 3300049742 | Ga0501080_0281275 | Ga0501080_0281275_486_1394 | 284 |
| 57 | 3300049744 | Ga0501083_0092236 | Ga0501083_0092236_119_1027 | 284 |
| 58 | 3300049823 | Ga0501044_0072765 | Ga0501044_0072765_1214_2122 | 284 |
| 59 | 3300054114 | Ga0501084_0028092 | Ga0501084_0028092_3359_4267 | 284 |
| 60 | 3300044656 | Ga0466969_0000282 | Ga0466969_0000282_14833_15693 | 285 |
| 61 | 3300044684 | Ga0466966_0000147 | Ga0466966_0000147_3965_4825 | 285 |
| 62 | 3300044693 | Ga0466961_0096155 | Ga0466961_0096155_657_1517 | 285 |
| 63 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_188741_189601 | 285 |
| 64 | 3300005563 | Ga0068855_100360068 | Ga0068855_1003600682 | 286 |
| 65 | 3300005577 | Ga0068857_100031624 | Ga0068857_1000316245 | 286 |
| 66 | 3300005614 | Ga0068856_100016440 | Ga0068856_1000164407 | 286 |
| 67 | 3300026116 | Ga0207674_10098720 | Ga0207674_100987202 | 286 |
| 68 | 3300048929 | Ga0496126_0014030 | Ga0496126_0014030_1777_2643 | 286 |
| 69 | iso_pu_bacteria | 2513020052 | 2513236155 | 286 |
| 70 | 3300009545 | Ga0105237_10003016 | Ga0105237_100030164 | 287 |
| 71 | 3300046660 | Ga0495625_0030083 | Ga0495625_0030083_905_1771 | 287 |
| 72 | 3300005347 | Ga0070668_100301027 | Ga0070668_1003010272 | 288 |
| 73 | 3300028800 | Ga0265338_10280726 | Ga0265338_102807261 | 288 |
| 74 | 3300032005 | Ga0307411_10001224 | Ga0307411_100012246 | 288 |
| 75 | 3300049758 | Ga0501241_010875 | Ga0501241_010875_579_1445 | 288 |
| 76 | 3300053122 | Ga0500608_027912 | Ga0500608_027912_376_1245 | 288 |
| 77 | 3300001979 | JGI24740J21852_10002617 | JGI24740J21852_100026177 | 289 |
| 78 | 3300010375 | Ga0105239_10423948 | Ga0105239_104239482 | 289 |
| 79 | 3300028794 | Ga0307515_10013796 | Ga0307515_1001379617 | 289 |
| 80 | 3300049705 | Ga0501225_0014746 | Ga0501225_0014746_672_1544 | 289 |
| 81 | 3300053093 | Ga0500651_0000303 | Ga0500651_0000303_24161_25084 | 289 |
| 82 | iso_pu_bacteria | 2821136567 | 2821138588 | 289 |
| 83 | iso_pu_bacteria | 2904467357 | 2904469381 | 289 |
| 84 | 3300003323 | rootH1_10029695 | rootH1_1002969510 | 290 |
| 85 | 3300005535 | Ga0070684_100092912 | Ga0070684_1000929122 | 292 |
| 86 | 3300013100 | Ga0157373_10000299 | Ga0157373_1000029917 | 292 |
| 87 | 3300013307 | Ga0157372_10001659 | Ga0157372_100016599 | 292 |
| 88 | 3300026078 | Ga0207702_10501010 | Ga0207702_105010101 | 292 |
| 89 | 3300031548 | Ga0307408_100005638 | Ga0307408_1000056388 | 292 |
| 90 | 3300031901 | Ga0307406_10000243 | Ga0307406_1000024326 | 292 |
| 91 | iso_pu_bacteria | 2739367663 | 2739646797 | 293 |
| 92 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_660772_661692 | 294 |
| 93 | iso_pu_bacteria | 2522125168 | 2522553082 | 295 |
| 94 | iso_pu_bacteria | 2585428187 | 2588234198 | 295 |
| 95 | iso_pu_bacteria | 2818991437 | 2819546926 | 295 |
| 96 | iso_pu_bacteria | 2818991442 | 2819573017 | 295 |
| 97 | iso_pu_bacteria | 2818991442 | 2819577871 | 295 |
| 98 | iso_pu_bacteria | 2818991444 | 2819587290 | 295 |
| 99 | iso_pu_bacteria | 2842903701 | 2842907522 | 295 |
| 100 | iso_pu_bacteria | 2842903701 | 2842908991 | 295 |
| 101 | iso_pu_bacteria | 2911138879 | 2911140513 | 295 |
| 102 | iso_pu_bacteria | 2919692658 | 2919696881 | 295 |
| 103 | iso_pu_bacteria | 2929239360 | 2929245098 | 295 |
| 104 | iso_pu_bacteria | 2958512119 | 2958513936 | 295 |
| 105 | iso_pu_bacteria | 2965320100 | 2965323110 | 295 |
| 106 | iso_pu_bacteria | 3003233435 | 3003237284 | 295 |
| 107 | iso_pu_bacteria | 8003151029 | 8003156562 | 295 |
| 108 | 3300017792 | Ga0163161_10007329 | Ga0163161_100073296 | 296 |
| 109 | 3300017792 | Ga0163161_10102073 | Ga0163161_101020731 | 296 |
| 110 | 3300053153 | Ga0500616_0048643 | Ga0500616_0048643_354_1253 | 296 |
| 111 | iso_pu_bacteria | 2821136567 | 2821142963 | 296 |
| 112 | iso_pu_bacteria | 2904467357 | 2904470690 | 296 |
| 113 | iso_pu_bacteria | 2929177148 | 2929182553 | 296 |
| 114 | 3300001979 | JGI24740J21852_10004228 | JGI24740J21852_100042284 | 297 |
| 115 | 3300002738 | JGI25154J39366_1000016 | JGI25154J39366_100001678 | 297 |
| 116 | 3300003215 | JGI25153J46596_10003991 | JGI25153J46596_100039913 | 297 |
| 117 | 3300003320 | rootH2_10039495 | rootH2_100394957 | 297 |
| 118 | 3300003323 | rootH1_10088871 | rootH1_100888712 | 297 |
| 119 | 3300005288 | Ga0065714_10064627 | Ga0065714_1006462715 | 297 |
| 120 | 3300013308 | Ga0157375_10000052 | Ga0157375_1000005231 | 297 |
| 121 | 3300025246 | Ga0209646_1000003 | Ga0209646_100000378 | 297 |
| 122 | 3300025250 | Ga0209026_1000202 | Ga0209026_100020219 | 297 |
| 123 | 3300025297 | Ga0209758_1013871 | Ga0209758_10138712 | 297 |
| 124 | 3300025302 | Ga0207426_1001549 | Ga0207426_100154911 | 297 |
| 125 | 3300048928 | Ga0496125_0011846 | Ga0496125_0011846_5992_6897 | 297 |
| 126 | 3300003322 | rootL2_10221287 | rootL2_102212873 | 298 |
| 127 | 3300003323 | rootH1_10012561 | rootH1_100125614 | 298 |
| 128 | 3300005262 | Ga0065165_1002831 | Ga0065165_10028315 | 298 |
| 129 | 3300044656 | Ga0466969_0001133 | Ga0466969_0001133_10251_11177 | 298 |
| 130 | 3300044765 | Ga0466970_0089820 | Ga0466970_0089820_203_1153 | 298 |
| 131 | 3300044842 | Ga0466957_0000474 | Ga0466957_0000474_14791_15717 | 298 |
| 132 | 3300045049 | Ga0466959_0000013 | Ga0466959_0000013_81291_82241 | 298 |
| 133 | 3300046810 | Ga0495660_0009167 | Ga0495660_0009167_2116_3015 | 298 |
| 134 | 3300053116 | Ga0500592_001839 | Ga0500592_001839_2388_3293 | 298 |
| 135 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008263 | 299 |
| 136 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008313 | 299 |
| 137 | 3300002738 | JGI25154J39366_1000073 | JGI25154J39366_100007324 | 299 |
| 138 | 3300003215 | JGI25153J46596_10016074 | JGI25153J46596_100160743 | 299 |
| 139 | 3300003316 | rootH1_10179979 | rootH1_101799792 | 299 |
| 140 | 3300003320 | rootH2_10017356 | rootH2_100173563 | 299 |
| 141 | 3300003320 | rootH2_10053271 | rootH2_1005327110 | 299 |
| 142 | 3300003322 | rootL2_10051367 | rootL2_100513674 | 299 |
| 143 | 3300003322 | rootL2_10198918 | rootL2_101989182 | 299 |
| 144 | 3300003323 | rootH1_10107342 | rootH1_101073424 | 299 |
| 145 | 3300003354 | JGI25160J50197_1005252 | JGI25160J50197_10052526 | 299 |
| 146 | 3300003354 | JGI25160J50197_1010685 | JGI25160J50197_10106853 | 299 |
| 147 | 3300003771 | Ga0055526_1005671 | Ga0055526_10056713 | 299 |
| 148 | 3300003790 | Ga0055528_1000400 | Ga0055528_100040033 | 299 |
| 149 | 3300003791 | Ga0055530_10000052 | Ga0055530_100000529 | 299 |
| 150 | 3300003794 | Ga0055531_10000063 | Ga0055531_1000006324 | 299 |
| 151 | 3300005262 | Ga0065165_1000052 | Ga0065165_1000052141 | 299 |
| 152 | 3300005262 | Ga0065165_1000104 | Ga0065165_100010434 | 299 |
| 153 | 3300005288 | Ga0065714_10065152 | Ga0065714_100651525 | 299 |
| 154 | 3300005289 | Ga0065704_10071791 | Ga0065704_1007179110 | 299 |
| 155 | 3300005331 | Ga0070670_100215176 | Ga0070670_1002151762 | 299 |
| 156 | 3300005338 | Ga0068868_100046305 | Ga0068868_1000463051 | 299 |
| 157 | 3300013104 | Ga0157370_10064592 | Ga0157370_100645922 | 299 |
| 158 | 3300013104 | Ga0157370_10161040 | Ga0157370_101610402 | 299 |
| 159 | 3300017792 | Ga0163161_10168882 | Ga0163161_101688823 | 299 |
| 160 | 3300025233 | Ga0209437_100030 | Ga0209437_100030133 | 299 |
| 161 | 3300025233 | Ga0209437_100043 | Ga0209437_100043237 | 299 |
| 162 | 3300025246 | Ga0209646_1000158 | Ga0209646_100015860 | 299 |
| 163 | 3300025250 | Ga0209026_1000168 | Ga0209026_100016831 | 299 |
| 164 | 3300025273 | Ga0209673_1000226 | Ga0209673_100022656 | 299 |
| 165 | 3300025292 | Ga0209676_1000310 | Ga0209676_100031065 | 299 |
| 166 | 3300025295 | Ga0209564_1001627 | Ga0209564_100162726 | 299 |
| 167 | 3300025297 | Ga0209758_1004653 | Ga0209758_10046536 | 299 |
| 168 | 3300025298 | Ga0209050_1000125 | Ga0209050_1000125139 | 299 |
| 169 | 3300025302 | Ga0207426_1000175 | Ga0207426_100017595 | 299 |
| 170 | 3300025302 | Ga0207426_1000882 | Ga0207426_100088226 | 299 |
| 171 | 3300025302 | Ga0207426_1017237 | Ga0207426_10172372 | 299 |
| 172 | 3300025304 | Ga0209257_1000008 | Ga0209257_1000008810 | 299 |
| 173 | 3300025304 | Ga0209257_1002919 | Ga0209257_100291911 | 299 |
| 174 | 3300025914 | Ga0207671_10000096 | Ga0207671_1000009673 | 299 |
| 175 | 3300026116 | Ga0207674_10176237 | Ga0207674_101762372 | 299 |
| 176 | 3300031731 | Ga0307405_10000002 | Ga0307405_10000002205 | 299 |
| 177 | 3300031901 | Ga0307406_10013865 | Ga0307406_100138656 | 299 |
| 178 | 3300031901 | Ga0307406_10291095 | Ga0307406_102910952 | 299 |
| 179 | 3300032004 | Ga0307414_10008772 | Ga0307414_100087725 | 299 |
| 180 | 3300032005 | Ga0307411_10001132 | Ga0307411_100011323 | 299 |
| 181 | 3300046460 | Ga0495638_0000050 | Ga0495638_0000050_84855_85763 | 299 |
| 182 | 3300046538 | Ga0495609_0000480 | Ga0495609_0000480_19426_20334 | 299 |
| 183 | 3300048929 | Ga0496126_0018056 | Ga0496126_0018056_156_1064 | 299 |
| 184 | 3300048929 | Ga0496126_0026178 | Ga0496126_0026178_1192_2100 | 299 |
| 185 | 3300049705 | Ga0501225_0000389 | Ga0501225_0000389_4394_5302 | 299 |
| 186 | 3300053086 | Ga0500578_0000003 | Ga0500578_0000003_254957_255865 | 299 |
| 187 | iso_pu_bacteria | 2585428187 | 2588233058 | 299 |
| 188 | iso_pu_bacteria | 2738541278 | 2738730180 | 299 |
| 189 | iso_pu_bacteria | 2739367857 | 2740002204 | 299 |
| 190 | iso_pu_bacteria | 2739367858 | 2740007020 | 299 |
| 191 | iso_pu_bacteria | 2802428842 | 2802652585 | 299 |
| 192 | iso_pu_bacteria | 2816332280 | 2817417172 | 299 |
| 193 | iso_pu_bacteria | 2857613821 | 2857616065 | 299 |
| 194 | iso_pu_bacteria | 2889290771 | 2889291722 | 299 |
| 195 | iso_pu_bacteria | 2904555929 | 2904558884 | 299 |
| 196 | iso_pu_bacteria | 2945924605 | 2945926134 | 299 |
| 197 | iso_pu_bacteria | 2945977869 | 2945978478 | 299 |
| 198 | iso_pu_bacteria | 2946013367 | 2946015660 | 299 |
| 199 | iso_pu_bacteria | 2977268062 | 2977271319 | 299 |
| 200 | iso_pu_bacteria | 8055419101 | 8055422776 | 299 |
| 201 | 3300003320 | rootH2_10017519 | rootH2_100175192 | 300 |
| 202 | 3300003794 | Ga0055531_10000324 | Ga0055531_1000032429 | 300 |
| 203 | 3300005355 | Ga0070671_100236417 | Ga0070671_1002364172 | 300 |
| 204 | 3300005618 | Ga0068864_100208169 | Ga0068864_1002081692 | 300 |
| 205 | 3300005834 | Ga0068851_10064575 | Ga0068851_100645753 | 300 |
| 206 | 3300005841 | Ga0068863_100121661 | Ga0068863_1001216612 | 300 |
| 207 | 3300006237 | Ga0097621_100098442 | Ga0097621_1000984423 | 300 |
| 208 | 3300006358 | Ga0068871_100206970 | Ga0068871_1002069702 | 300 |
| 209 | 3300013297 | Ga0157378_10013014 | Ga0157378_100130143 | 300 |
| 210 | 3300025304 | Ga0209257_1000023 | Ga0209257_1000023533 | 300 |
| 211 | 3300025960 | Ga0207651_10368491 | Ga0207651_103684912 | 300 |
| 212 | 3300026023 | Ga0207677_10061359 | Ga0207677_100613593 | 300 |
| 213 | 3300046660 | Ga0495625_0013086 | Ga0495625_0013086_576_1481 | 300 |
| 214 | iso_pu_bacteria | 2739367656 | 2739614094 | 300 |
| 215 | iso_pu_bacteria | 2818991442 | 2819577660 | 300 |
| 216 | iso_pu_bacteria | 2818991460 | 2819677488 | 300 |
| 217 | iso_pu_bacteria | 2857613821 | 2857617340 | 300 |
| 218 | iso_pu_bacteria | 2904419702 | 2904420750 | 300 |
| 219 | iso_pu_bacteria | 2929177148 | 2929179571 | 300 |
| 220 | iso_pu_bacteria | 2929177148 | 2929180643 | 300 |
| 221 | iso_pu_bacteria | 2945977869 | 2945981985 | 300 |
| 222 | iso_pu_bacteria | 2945977869 | 2945983042 | 300 |
| 223 | iso_pu_bacteria | 2946013367 | 2946017563 | 300 |
| 224 | iso_pu_bacteria | 2946013367 | 2946018618 | 300 |
| 225 | iso_pu_bacteria | 2818991444 | 2819590150 | 301 |
| 226 | iso_pu_bacteria | 2842903701 | 2842904667 | 301 |
| 227 | iso_pu_bacteria | 2842903701 | 2842907478 | 301 |
| 228 | iso_pu_bacteria | 2857618242 | 2857619626 | 301 |
| 229 | iso_pu_bacteria | 2884791551 | 2884792342 | 301 |
| 230 | iso_pu_bacteria | 2904419702 | 2904422255 | 301 |
| 231 | iso_pu_bacteria | 2904780799 | 2904784686 | 301 |
| 232 | iso_pu_bacteria | 2919437846 | 2919437856 | 301 |
| 233 | iso_pu_bacteria | 2929239360 | 2929239568 | 301 |
| 234 | iso_pu_bacteria | 2929239360 | 2929242493 | 301 |
| 235 | iso_pu_bacteria | 2929921140 | 2929926183 | 301 |
| 236 | iso_pu_bacteria | 2977243572 | 2977245496 | 301 |
| 237 | iso_pu_bacteria | 8003151029 | 8003156029 | 301 |
| 238 | 3300003316 | rootH1_10136412 | rootH1_101364122 | 302 |
| 239 | 3300005539 | Ga0068853_100169231 | Ga0068853_1001692313 | 302 |
| 240 | 3300009093 | Ga0105240_10325225 | Ga0105240_103252252 | 302 |
| 241 | 3300010375 | Ga0105239_10001610 | Ga0105239_1000161013 | 302 |
| 242 | 3300015261 | Ga0182006_1006515 | Ga0182006_10065153 | 302 |
| 243 | 3300025903 | Ga0207680_10004822 | Ga0207680_100048226 | 302 |
| 244 | 3300025913 | Ga0207695_10223985 | Ga0207695_102239852 | 302 |
| 245 | 3300033180 | Ga0307510_10015549 | Ga0307510_100155496 | 302 |
| 246 | 3300047320 | Ga0495672_0088216 | Ga0495672_0088216_89_1000 | 302 |
| 247 | 3300049758 | Ga0501241_001093 | Ga0501241_001093_95_1009 | 302 |
| 248 | 3300053118 | Ga0500594_0007676 | Ga0500594_0007676_508_1428 | 302 |
| 249 | 3300002738 | JGI25154J39366_1007707 | JGI25154J39366_10077071 | 303 |
| 250 | 3300003316 | rootH1_10049637 | rootH1_100496376 | 303 |
| 251 | 3300003320 | rootH2_10011844 | rootH2_1001184446 | 303 |
| 252 | 3300003322 | rootL2_10035699 | rootL2_100356993 | 303 |
| 253 | 3300003322 | rootL2_10082053 | rootL2_100820533 | 303 |
| 254 | 3300003323 | rootH1_10009799 | rootH1_100097992 | 303 |
| 255 | 3300003323 | rootH1_10192656 | rootH1_101926564 | 303 |
| 256 | 3300005367 | Ga0070667_100037449 | Ga0070667_1000374493 | 303 |
| 257 | 3300005577 | Ga0068857_100046935 | Ga0068857_1000469352 | 303 |
| 258 | 3300005614 | Ga0068856_100164100 | Ga0068856_1001641002 | 303 |
| 259 | 3300005617 | Ga0068859_100007759 | Ga0068859_1000077597 | 303 |
| 260 | 3300005843 | Ga0068860_100043649 | Ga0068860_1000436493 | 303 |
| 261 | 3300005985 | Ga0081539_10001245 | Ga0081539_100012459 | 303 |
| 262 | 3300006931 | Ga0097620_100007759 | Ga0097620_1000077597 | 303 |
| 263 | 3300009147 | Ga0114129_10005726 | Ga0114129_100057263 | 303 |
| 264 | 3300009551 | Ga0105238_10171917 | Ga0105238_101719172 | 303 |
| 265 | 3300013104 | Ga0157370_10007911 | Ga0157370_1000791110 | 303 |
| 266 | 3300013297 | Ga0157378_10001954 | Ga0157378_100019549 | 303 |
| 267 | 3300013306 | Ga0163162_10414304 | Ga0163162_104143042 | 303 |
| 268 | 3300015261 | Ga0182006_1001457 | Ga0182006_100145713 | 303 |
| 269 | 3300025246 | Ga0209646_1002384 | Ga0209646_10023843 | 303 |
| 270 | 3300025924 | Ga0207694_10175254 | Ga0207694_101752542 | 303 |
| 271 | 3300025986 | Ga0207658_10011346 | Ga0207658_100113462 | 303 |
| 272 | 3300026078 | Ga0207702_10103048 | Ga0207702_101030482 | 303 |
| 273 | 3300026116 | Ga0207674_10045323 | Ga0207674_100453234 | 303 |
| 274 | 3300028381 | Ga0268264_10006483 | Ga0268264_1000648310 | 303 |
| 275 | 3300031548 | Ga0307408_100124191 | Ga0307408_1001241912 | 303 |
| 276 | 3300031731 | Ga0307405_10091577 | Ga0307405_100915772 | 303 |
| 277 | 3300031824 | Ga0307413_10000188 | Ga0307413_1000018811 | 303 |
| 278 | 3300031852 | Ga0307410_10000018 | Ga0307410_1000001858 | 303 |
| 279 | 3300031901 | Ga0307406_10000422 | Ga0307406_100004226 | 303 |
| 280 | 3300031903 | Ga0307407_10000808 | Ga0307407_100008083 | 303 |
| 281 | 3300031911 | Ga0307412_10000179 | Ga0307412_1000017934 | 303 |
| 282 | 3300032004 | Ga0307414_10000008 | Ga0307414_10000008244 | 303 |
| 283 | 3300032005 | Ga0307411_10000008 | Ga0307411_10000008248 | 303 |
| 284 | 3300041407 | Ga0439447_000827 | Ga0439447_000827_9481_10395 | 303 |
| 285 | 3300041411 | Ga0439466_0001202 | Ga0439466_0001202_7888_8802 | 303 |
| 286 | 3300042004 | Ga0439445_0000048 | Ga0439445_0000048_2278_3198 | 303 |
| 287 | 3300044658 | Ga0466972_0000235 | Ga0466972_0000235_34728_35642 | 303 |
| 288 | 3300044658 | Ga0466972_0005859 | Ga0466972_0005859_4186_5100 | 303 |
| 289 | 3300044683 | Ga0466965_0037929 | Ga0466965_0037929_1065_1979 | 303 |
| 290 | 3300044684 | Ga0466966_0000014 | Ga0466966_0000014_20207_21121 | 303 |
| 291 | 3300044684 | Ga0466966_0015812 | Ga0466966_0015812_2839_3753 | 303 |
| 292 | 3300044706 | Ga0466964_0012685 | Ga0466964_0012685_934_1848 | 303 |
| 293 | 3300044706 | Ga0466964_0012905 | Ga0466964_0012905_403_1317 | 303 |
| 294 | 3300044735 | Ga0466968_0009531 | Ga0466968_0009531_1854_2768 | 303 |
| 295 | 3300044735 | Ga0466968_0023808 | Ga0466968_0023808_806_1720 | 303 |
| 296 | 3300044765 | Ga0466970_0028608 | Ga0466970_0028608_808_1722 | 303 |
| 297 | 3300044842 | Ga0466957_0001027 | Ga0466957_0001027_10676_11590 | 303 |
| 298 | 3300044901 | Ga0466960_0009625 | Ga0466960_0009625_2699_3613 | 303 |
| 299 | 3300045049 | Ga0466959_0000011 | Ga0466959_0000011_132207_133121 | 303 |
| 300 | 3300045049 | Ga0466959_0055694 | Ga0466959_0055694_1175_2089 | 303 |
| 301 | 3300046453 | Ga0495627_002044 | Ga0495627_002044_2671_3591 | 303 |
| 302 | 3300046512 | Ga0495610_0000747 | Ga0495610_0000747_1967_2881 | 303 |
| 303 | 3300046512 | Ga0495610_0022799 | Ga0495610_0022799_2319_3233 | 303 |
| 304 | 3300046558 | Ga0495633_0001455 | Ga0495633_0001455_15657_16577 | 303 |
| 305 | 3300046660 | Ga0495625_0001290 | Ga0495625_0001290_10599_11519 | 303 |
| 306 | 3300047472 | Ga0495686_0000079 | Ga0495686_0000079_196242_197162 | 303 |
| 307 | 3300047472 | Ga0495686_0000524 | Ga0495686_0000524_33241_34155 | 303 |
| 308 | 3300048924 | Ga0496121_0000008 | Ga0496121_0000008_313466_314383 | 303 |
| 309 | 3300048928 | Ga0496125_0008240 | Ga0496125_0008240_5098_6018 | 303 |
| 310 | 3300049671 | Ga0501238_000427 | Ga0501238_000427_3822_4736 | 303 |
| 311 | 3300050507 | nmdc:mga05p37_29731_c1 | nmdc:mga05p37_29731_c1_5049_5963 | 303 |
| 312 | 3300053086 | Ga0500578_0000312 | Ga0500578_0000312_36230_37150 | 303 |
| 313 | 3300053108 | Ga0500562_000066 | Ga0500562_000066_2255_3169 | 303 |
| 314 | 3300053156 | Ga0500622_0001051 | Ga0500622_0001051_8011_8925 | 303 |
| 315 | 3300053730 | Ga0500645_010433 | Ga0500645_010433_1191_2105 | 303 |
| 316 | 3300055283 | Ga0500661_009524 | Ga0500661_009524_498_1412 | 303 |
| 317 | 3300061719 | Ga0466962_0024349 | Ga0466962_0024349_1733_2647 | 303 |
| 318 | 3300002737 | JGI25162J39368_1004624 | JGI25162J39368_10046243 | 304 |
| 319 | 3300002739 | JGI25158J39367_1009303 | JGI25158J39367_10093031 | 304 |
| 320 | 3300003214 | JGI25165J46597_1001861 | JGI25165J46597_10018613 | 304 |
| 321 | 3300003322 | rootL2_10054129 | rootL2_1005412911 | 304 |
| 322 | 3300003322 | rootL2_10235423 | rootL2_102354233 | 304 |
| 323 | 3300003794 | Ga0055531_10000030 | Ga0055531_1000003077 | 304 |
| 324 | 3300005288 | Ga0065714_10004857 | Ga0065714_100048572 | 304 |
| 325 | 3300005288 | Ga0065714_10065174 | Ga0065714_100651745 | 304 |
| 326 | 3300005288 | Ga0065714_10072760 | Ga0065714_100727602 | 304 |
| 327 | 3300005334 | Ga0068869_100119585 | Ga0068869_1001195851 | 304 |
| 328 | 3300005335 | Ga0070666_10000041 | Ga0070666_1000004174 | 304 |
| 329 | 3300005338 | Ga0068868_100021703 | Ga0068868_1000217033 | 304 |
| 330 | 3300005347 | Ga0070668_100440224 | Ga0070668_1004402241 | 304 |
| 331 | 3300005367 | Ga0070667_100027616 | Ga0070667_1000276162 | 304 |
| 332 | 3300005616 | Ga0068852_100041753 | Ga0068852_1000417534 | 304 |
| 333 | 3300005617 | Ga0068859_100000083 | Ga0068859_10000008375 | 304 |
| 334 | 3300005618 | Ga0068864_100237753 | Ga0068864_1002377532 | 304 |
| 335 | 3300005834 | Ga0068851_10012190 | Ga0068851_100121902 | 304 |
| 336 | 3300005841 | Ga0068863_100216998 | Ga0068863_1002169981 | 304 |
| 337 | 3300005842 | Ga0068858_100050970 | Ga0068858_1000509702 | 304 |
| 338 | 3300005843 | Ga0068860_100018710 | Ga0068860_1000187104 | 304 |
| 339 | 3300006237 | Ga0097621_100240654 | Ga0097621_1002406542 | 304 |
| 340 | 3300006931 | Ga0097620_100000083 | Ga0097620_10000008375 | 304 |
| 341 | 3300009101 | Ga0105247_10005474 | Ga0105247_100054746 | 304 |
| 342 | 3300009174 | Ga0105241_10001084 | Ga0105241_1000108414 | 304 |
| 343 | 3300009545 | Ga0105237_10016009 | Ga0105237_100160093 | 304 |
| 344 | 3300009545 | Ga0105237_10022897 | Ga0105237_100228977 | 304 |
| 345 | 3300010375 | Ga0105239_10251180 | Ga0105239_102511802 | 304 |
| 346 | 3300011119 | Ga0105246_10012789 | Ga0105246_100127894 | 304 |
| 347 | 3300011119 | Ga0105246_10046798 | Ga0105246_100467982 | 304 |
| 348 | 3300013105 | Ga0157369_10001327 | Ga0157369_1000132716 | 304 |
| 349 | 3300013297 | Ga0157378_10181795 | Ga0157378_101817952 | 304 |
| 350 | 3300013306 | Ga0163162_10004686 | Ga0163162_100046862 | 304 |
| 351 | 3300013307 | Ga0157372_10104752 | Ga0157372_101047524 | 304 |
| 352 | 3300013307 | Ga0157372_10501543 | Ga0157372_105015432 | 304 |
| 353 | 3300013308 | Ga0157375_10055343 | Ga0157375_100553432 | 304 |
| 354 | 3300014968 | Ga0157379_10128544 | Ga0157379_101285444 | 304 |
| 355 | 3300015265 | Ga0182005_1000200 | Ga0182005_100020032 | 304 |
| 356 | 3300017792 | Ga0163161_10007893 | Ga0163161_100078932 | 304 |
| 357 | 3300025208 | Ga0209436_100514 | Ga0209436_1005146 | 304 |
| 358 | 3300025231 | Ga0207427_100152 | Ga0207427_10015256 | 304 |
| 359 | 3300025233 | Ga0209437_100164 | Ga0209437_100164114 | 304 |
| 360 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038488 | 304 |
| 361 | 3300025284 | Ga0209130_1013317 | Ga0209130_10133173 | 304 |
| 362 | 3300025302 | Ga0207426_1000135 | Ga0207426_100013547 | 304 |
| 363 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013386 | 304 |
| 364 | 3300025900 | Ga0207710_10003963 | Ga0207710_100039634 | 304 |
| 365 | 3300025903 | Ga0207680_10000634 | Ga0207680_1000063413 | 304 |
| 366 | 3300025904 | Ga0207647_10154860 | Ga0207647_101548601 | 304 |
| 367 | 3300025909 | Ga0207705_10031606 | Ga0207705_100316062 | 304 |
| 368 | 3300025911 | Ga0207654_10000501 | Ga0207654_1000050120 | 304 |
| 369 | 3300025911 | Ga0207654_10039789 | Ga0207654_100397894 | 304 |
| 370 | 3300025914 | Ga0207671_10001628 | Ga0207671_100016283 | 304 |
| 371 | 3300025914 | Ga0207671_10022112 | Ga0207671_100221127 | 304 |
| 372 | 3300025919 | Ga0207657_10012983 | Ga0207657_100129832 | 304 |
| 373 | 3300025921 | Ga0207652_10000180 | Ga0207652_1000018021 | 304 |
| 374 | 3300025940 | Ga0207691_10249200 | Ga0207691_102492002 | 304 |
| 375 | 3300025942 | Ga0207689_10000746 | Ga0207689_1000074622 | 304 |
| 376 | 3300025949 | Ga0207667_10003555 | Ga0207667_100035557 | 304 |
| 377 | 3300025949 | Ga0207667_10073213 | Ga0207667_100732134 | 304 |
| 378 | 3300025961 | Ga0207712_10014860 | Ga0207712_100148603 | 304 |
| 379 | 3300025972 | Ga0207668_10354876 | Ga0207668_103548762 | 304 |
| 380 | 3300026035 | Ga0207703_10004577 | Ga0207703_100045776 | 304 |
| 381 | 3300026088 | Ga0207641_10001993 | Ga0207641_100019932 | 304 |
| 382 | 3300026095 | Ga0207676_10219125 | Ga0207676_102191252 | 304 |
| 383 | 3300026142 | Ga0207698_10140892 | Ga0207698_101408922 | 304 |
| 384 | 3300028381 | Ga0268264_10009773 | Ga0268264_100097732 | 304 |
| 385 | 3300028794 | Ga0307515_10000299 | Ga0307515_1000029920 | 304 |
| 386 | 3300028794 | Ga0307515_10102161 | Ga0307515_101021613 | 304 |
| 387 | 3300030734 | Ga0316179_1094714 | Ga0316179_10947142 | 304 |
| 388 | 3300031852 | Ga0307410_10006559 | Ga0307410_100065596 | 304 |
| 389 | 3300031903 | Ga0307407_10070377 | Ga0307407_100703772 | 304 |
| 390 | 3300032004 | Ga0307414_10000002 | Ga0307414_10000002141 | 304 |
| 391 | 3300032133 | Ga0316583_10049290 | Ga0316583_100492901 | 304 |
| 392 | 3300041411 | Ga0439466_0000400 | Ga0439466_0000400_4438_5355 | 304 |
| 393 | 3300044684 | Ga0466966_0000147 | Ga0466966_0000147_35729_36649 | 304 |
| 394 | 3300044842 | Ga0466957_0020301 | Ga0466957_0020301_1004_1924 | 304 |
| 395 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_218949_219869 | 304 |
| 396 | 3300046460 | Ga0495638_0042600 | Ga0495638_0042600_498_1418 | 304 |
| 397 | 3300046471 | Ga0495650_0010640 | Ga0495650_0010640_3619_4539 | 304 |
| 398 | 3300046507 | Ga0495606_0003060 | Ga0495606_0003060_526_1446 | 304 |
| 399 | 3300046507 | Ga0495606_0013090 | Ga0495606_0013090_1026_1943 | 304 |
| 400 | 3300046513 | Ga0495616_0010696 | Ga0495616_0010696_4326_5243 | 304 |
| 401 | 3300046558 | Ga0495633_0000263 | Ga0495633_0000263_46283_47200 | 304 |
| 402 | 3300046660 | Ga0495625_0043716 | Ga0495625_0043716_1077_1994 | 304 |
| 403 | 3300047472 | Ga0495686_0000355 | Ga0495686_0000355_33098_34018 | 304 |
| 404 | 3300047472 | Ga0495686_0000607 | Ga0495686_0000607_32908_33828 | 304 |
| 405 | 3300048929 | Ga0496126_0367928 | Ga0496126_0367928_81_998 | 304 |
| 406 | 3300049459 | Ga0495678_016614 | Ga0495678_016614_2020_2937 | 304 |
| 407 | 3300049671 | Ga0501238_000293 | Ga0501238_000293_70_987 | 304 |
| 408 | 3300049758 | Ga0501241_005584 | Ga0501241_005584_921_1838 | 304 |
| 409 | 3300049823 | Ga0501044_0293412 | Ga0501044_0293412_21_941 | 304 |
| 410 | 3300053086 | Ga0500578_0001042 | Ga0500578_0001042_8012_8932 | 304 |
| 411 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_94678_95592 | 304 |
| 412 | 3300053153 | Ga0500616_0060369 | Ga0500616_0060369_1037_1954 | 304 |
| 413 | 3300053156 | Ga0500622_0000051 | Ga0500622_0000051_23558_24475 | 304 |
| 414 | 3300053156 | Ga0500622_0001589 | Ga0500622_0001589_16821_17738 | 304 |
| 415 | 3300053156 | Ga0500622_0027948 | Ga0500622_0027948_474_1391 | 304 |
| 416 | 3300053160 | Ga0500633_0002778 | Ga0500633_0002778_459_1376 | 304 |
| 417 | 3300061719 | Ga0466962_0100937 | Ga0466962_0100937_367_1290 | 304 |
| 418 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00005350 | 305 |
| 419 | 3300001979 | JGI24740J21852_10011221 | JGI24740J21852_100112213 | 305 |
| 420 | 3300001989 | JGI24739J22299_10010833 | JGI24739J22299_100108332 | 305 |
| 421 | 3300002737 | JGI25162J39368_1000650 | JGI25162J39368_100065030 | 305 |
| 422 | 3300002738 | JGI25154J39366_1000021 | JGI25154J39366_100002129 | 305 |
| 423 | 3300002738 | JGI25154J39366_1000028 | JGI25154J39366_1000028116 | 305 |
| 424 | 3300002741 | JGI25157J39369_1002336 | JGI25157J39369_10023363 | 305 |
| 425 | 3300002741 | JGI25157J39369_1006944 | JGI25157J39369_10069442 | 305 |
| 426 | 3300002772 | JGI25164J39214_1002804 | JGI25164J39214_10028042 | 305 |
| 427 | 3300003214 | JGI25165J46597_1001427 | JGI25165J46597_100142716 | 305 |
| 428 | 3300003215 | JGI25153J46596_10000412 | JGI25153J46596_1000041229 | 305 |
| 429 | 3300003215 | JGI25153J46596_10003899 | JGI25153J46596_100038998 | 305 |
| 430 | 3300003320 | rootH2_10006586 | rootH2_1000658628 | 305 |
| 431 | 3300003320 | rootH2_10059195 | rootH2_100591952 | 305 |
| 432 | 3300003323 | rootH1_10007228 | rootH1_100072285 | 305 |
| 433 | 3300003323 | rootH1_10012978 | rootH1_1001297815 | 305 |
| 434 | 3300003323 | rootH1_10028162 | rootH1_100281629 | 305 |
| 435 | 3300003323 | rootH1_10063994 | rootH1_100639947 | 305 |
| 436 | 3300003323 | rootH1_10073247 | rootH1_100732472 | 305 |
| 437 | 3300003323 | rootH1_10085833 | rootH1_100858337 | 305 |
| 438 | 3300003354 | JGI25160J50197_1004139 | JGI25160J50197_10041393 | 305 |
| 439 | 3300003354 | JGI25160J50197_1015296 | JGI25160J50197_10152962 | 305 |
| 440 | 3300003771 | Ga0055526_1001833 | Ga0055526_100183313 | 305 |
| 441 | 3300003790 | Ga0055528_1000072 | Ga0055528_10000729 | 305 |
| 442 | 3300005262 | Ga0065165_1000038 | Ga0065165_100003870 | 305 |
| 443 | 3300005262 | Ga0065165_1008355 | Ga0065165_10083552 | 305 |
| 444 | 3300005262 | Ga0065165_1061846 | Ga0065165_10618461 | 305 |
| 445 | 3300005288 | Ga0065714_10073661 | Ga0065714_100736613 | 305 |
| 446 | 3300005289 | Ga0065704_10070140 | Ga0065704_10070140411 | 305 |
| 447 | 3300005293 | Ga0065715_10116786 | Ga0065715_101167862 | 305 |
| 448 | 3300005328 | Ga0070676_10000259 | Ga0070676_1000025918 | 305 |
| 449 | 3300005329 | Ga0070683_100123265 | Ga0070683_1001232653 | 305 |
| 450 | 3300005338 | Ga0068868_100061094 | Ga0068868_1000610943 | 305 |
| 451 | 3300005338 | Ga0068868_100062299 | Ga0068868_1000622993 | 305 |
| 452 | 3300005353 | Ga0070669_100059425 | Ga0070669_1000594252 | 305 |
| 453 | 3300005355 | Ga0070671_100097921 | Ga0070671_1000979212 | 305 |
| 454 | 3300005364 | Ga0070673_100370828 | Ga0070673_1003708281 | 305 |
| 455 | 3300005366 | Ga0070659_100176570 | Ga0070659_1001765701 | 305 |
| 456 | 3300005456 | Ga0070678_100258702 | Ga0070678_1002587022 | 305 |
| 457 | 3300005457 | Ga0070662_100000449 | Ga0070662_1000004496 | 305 |
| 458 | 3300005457 | Ga0070662_100168923 | Ga0070662_1001689232 | 305 |
| 459 | 3300005458 | Ga0070681_10291296 | Ga0070681_102912962 | 305 |
| 460 | 3300005459 | Ga0068867_100173810 | Ga0068867_1001738102 | 305 |
| 461 | 3300005471 | Ga0070698_100027821 | Ga0070698_1000278213 | 305 |
| 462 | 3300005471 | Ga0070698_100183280 | Ga0070698_1001832802 | 305 |
| 463 | 3300005518 | Ga0070699_100046903 | Ga0070699_1000469032 | 305 |
| 464 | 3300005536 | Ga0070697_100328973 | Ga0070697_1003289732 | 305 |
| 465 | 3300005539 | Ga0068853_100021248 | Ga0068853_1000212483 | 305 |
| 466 | 3300005539 | Ga0068853_100061766 | Ga0068853_1000617663 | 305 |
| 467 | 3300005539 | Ga0068853_100067715 | Ga0068853_1000677152 | 305 |
| 468 | 3300005539 | Ga0068853_100095697 | Ga0068853_1000956972 | 305 |
| 469 | 3300005539 | Ga0068853_100112138 | Ga0068853_1001121382 | 305 |
| 470 | 3300005539 | Ga0068853_100155890 | Ga0068853_1001558902 | 305 |
| 471 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008179 | 305 |
| 472 | 3300005548 | Ga0070665_100000125 | Ga0070665_100000125100 | 305 |
| 473 | 3300005548 | Ga0070665_100000205 | Ga0070665_10000020549 | 305 |
| 474 | 3300005549 | Ga0070704_100152645 | Ga0070704_1001526452 | 305 |
| 475 | 3300005563 | Ga0068855_100011059 | Ga0068855_1000110592 | 305 |
| 476 | 3300005563 | Ga0068855_100025193 | Ga0068855_1000251932 | 305 |
| 477 | 3300005563 | Ga0068855_100246644 | Ga0068855_1002466442 | 305 |
| 478 | 3300005577 | Ga0068857_100044420 | Ga0068857_1000444203 | 305 |
| 479 | 3300005577 | Ga0068857_100268592 | Ga0068857_1002685922 | 305 |
| 480 | 3300005578 | Ga0068854_100035592 | Ga0068854_1000355922 | 305 |
| 481 | 3300005614 | Ga0068856_100002280 | Ga0068856_10000228010 | 305 |
| 482 | 3300005616 | Ga0068852_100009844 | Ga0068852_1000098441 | 305 |
| 483 | 3300005616 | Ga0068852_100091236 | Ga0068852_1000912363 | 305 |
| 484 | 3300005616 | Ga0068852_100643462 | Ga0068852_1006434621 | 305 |
| 485 | 3300005843 | Ga0068860_100018491 | Ga0068860_10001849110 | 305 |
| 486 | 3300006195 | Ga0075366_10000235 | Ga0075366_1000023516 | 305 |
| 487 | 3300006195 | Ga0075366_10078244 | Ga0075366_100782442 | 305 |
| 488 | 3300006237 | Ga0097621_100000288 | Ga0097621_1000002884 | 305 |
| 489 | 3300006237 | Ga0097621_100012310 | Ga0097621_1000123109 | 305 |
| 490 | 3300006358 | Ga0068871_100000592 | Ga0068871_1000005924 | 305 |
| 491 | 3300006358 | Ga0068871_100144233 | Ga0068871_1001442332 | 305 |
| 492 | 3300006846 | Ga0075430_100146602 | Ga0075430_1001466021 | 305 |
| 493 | 3300006852 | Ga0075433_10173523 | Ga0075433_101735231 | 305 |
| 494 | 3300006881 | Ga0068865_100000029 | Ga0068865_10000002991 | 305 |
| 495 | 3300009093 | Ga0105240_10000020 | Ga0105240_1000002018 | 305 |
| 496 | 3300009093 | Ga0105240_10000117 | Ga0105240_1000011721 | 305 |
| 497 | 3300009093 | Ga0105240_10001228 | Ga0105240_1000122811 | 305 |
| 498 | 3300009093 | Ga0105240_10005598 | Ga0105240_100055986 | 305 |
| 499 | 3300009093 | Ga0105240_10078938 | Ga0105240_100789382 | 305 |
| 500 | 3300009093 | Ga0105240_10085605 | Ga0105240_100856055 | 305 |
| 501 | 3300009093 | Ga0105240_10125427 | Ga0105240_101254272 | 305 |
| 502 | 3300009093 | Ga0105240_10295014 | Ga0105240_102950142 | 305 |
| 503 | 3300009098 | Ga0105245_10182363 | Ga0105245_101823632 | 305 |
| 504 | 3300009148 | Ga0105243_10065078 | Ga0105243_100650782 | 305 |
| 505 | 3300009174 | Ga0105241_10000217 | Ga0105241_1000021732 | 305 |
| 506 | 3300009174 | Ga0105241_10001790 | Ga0105241_100017903 | 305 |
| 507 | 3300009174 | Ga0105241_10009176 | Ga0105241_100091764 | 305 |
| 508 | 3300009174 | Ga0105241_10036543 | Ga0105241_100365432 | 305 |
| 509 | 3300009174 | Ga0105241_10134387 | Ga0105241_101343872 | 305 |
| 510 | 3300009174 | Ga0105241_10491639 | Ga0105241_104916392 | 305 |
| 511 | 3300009176 | Ga0105242_10014823 | Ga0105242_100148231 | 305 |
| 512 | 3300009545 | Ga0105237_10007928 | Ga0105237_100079289 | 305 |
| 513 | 3300009545 | Ga0105237_10009739 | Ga0105237_100097398 | 305 |
| 514 | 3300009545 | Ga0105237_10042402 | Ga0105237_100424023 | 305 |
| 515 | 3300009545 | Ga0105237_10345398 | Ga0105237_103453982 | 305 |
| 516 | 3300009551 | Ga0105238_10003134 | Ga0105238_100031347 | 305 |
| 517 | 3300010375 | Ga0105239_10000456 | Ga0105239_1000045641 | 305 |
| 518 | 3300010375 | Ga0105239_10000786 | Ga0105239_1000078622 | 305 |
| 519 | 3300010375 | Ga0105239_10013703 | Ga0105239_100137032 | 305 |
| 520 | 3300010375 | Ga0105239_10028344 | Ga0105239_100283445 | 305 |
| 521 | 3300010375 | Ga0105239_10034714 | Ga0105239_100347144 | 305 |
| 522 | 3300010375 | Ga0105239_10049416 | Ga0105239_100494164 | 305 |
| 523 | 3300010375 | Ga0105239_10050627 | Ga0105239_100506274 | 305 |
| 524 | 3300010375 | Ga0105239_10138372 | Ga0105239_101383722 | 305 |
| 525 | 3300010375 | Ga0105239_10150850 | Ga0105239_101508503 | 305 |
| 526 | 3300010375 | Ga0105239_10188654 | Ga0105239_101886543 | 305 |
| 527 | 3300011119 | Ga0105246_10107279 | Ga0105246_101072792 | 305 |
| 528 | 3300013100 | Ga0157373_10012068 | Ga0157373_100120688 | 305 |
| 529 | 3300013100 | Ga0157373_10028139 | Ga0157373_100281392 | 305 |
| 530 | 3300013100 | Ga0157373_10096414 | Ga0157373_100964141 | 305 |
| 531 | 3300013102 | Ga0157371_10023632 | Ga0157371_100236325 | 305 |
| 532 | 3300013102 | Ga0157371_10062619 | Ga0157371_100626193 | 305 |
| 533 | 3300013102 | Ga0157371_10070727 | Ga0157371_100707272 | 305 |
| 534 | 3300013102 | Ga0157371_10075852 | Ga0157371_100758523 | 305 |
| 535 | 3300013102 | Ga0157371_10111021 | Ga0157371_101110212 | 305 |
| 536 | 3300013104 | Ga0157370_10000022 | Ga0157370_1000002220 | 305 |
| 537 | 3300013104 | Ga0157370_10147948 | Ga0157370_101479482 | 305 |
| 538 | 3300013105 | Ga0157369_10010087 | Ga0157369_1001008710 | 305 |
| 539 | 3300013296 | Ga0157374_10000887 | Ga0157374_1000088714 | 305 |
| 540 | 3300013297 | Ga0157378_10014463 | Ga0157378_100144637 | 305 |
| 541 | 3300013306 | Ga0163162_10000005 | Ga0163162_1000000543 | 305 |
| 542 | 3300013306 | Ga0163162_10000208 | Ga0163162_1000020833 | 305 |
| 543 | 3300013306 | Ga0163162_10000993 | Ga0163162_100009933 | 305 |
| 544 | 3300013307 | Ga0157372_10017207 | Ga0157372_100172073 | 305 |
| 545 | 3300013307 | Ga0157372_10038047 | Ga0157372_100380477 | 305 |
| 546 | 3300013307 | Ga0157372_10081439 | Ga0157372_100814392 | 305 |
| 547 | 3300013307 | Ga0157372_10137568 | Ga0157372_101375682 | 305 |
| 548 | 3300013308 | Ga0157375_10015943 | Ga0157375_100159436 | 305 |
| 549 | 3300014325 | Ga0163163_10084736 | Ga0163163_100847363 | 305 |
| 550 | 3300014497 | Ga0182008_10000290 | Ga0182008_1000029011 | 305 |
| 551 | 3300014969 | Ga0157376_10034329 | Ga0157376_100343291 | 305 |
| 552 | 3300014969 | Ga0157376_10353530 | Ga0157376_103535302 | 305 |
| 553 | 3300015261 | Ga0182006_1004000 | Ga0182006_10040001 | 305 |
| 554 | 3300017792 | Ga0163161_10000994 | Ga0163161_100009943 | 305 |
| 555 | 3300025230 | Ga0209563_104145 | Ga0209563_1041452 | 305 |
| 556 | 3300025231 | Ga0207427_100152 | Ga0207427_10015250 | 305 |
| 557 | 3300025233 | Ga0209437_100164 | Ga0209437_100164108 | 305 |
| 558 | 3300025246 | Ga0209646_1000006 | Ga0209646_1000006113 | 305 |
| 559 | 3300025246 | Ga0209646_1000050 | Ga0209646_1000050226 | 305 |
| 560 | 3300025246 | Ga0209646_1003925 | Ga0209646_10039252 | 305 |
| 561 | 3300025250 | Ga0209026_1000185 | Ga0209026_100018550 | 305 |
| 562 | 3300025250 | Ga0209026_1000240 | Ga0209026_100024054 | 305 |
| 563 | 3300025254 | Ga0209148_1000230 | Ga0209148_100023036 | 305 |
| 564 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038494 | 305 |
| 565 | 3300025273 | Ga0209673_1000130 | Ga0209673_100013065 | 305 |
| 566 | 3300025295 | Ga0209564_1001138 | Ga0209564_100113817 | 305 |
| 567 | 3300025295 | Ga0209564_1001327 | Ga0209564_100132715 | 305 |
| 568 | 3300025295 | Ga0209564_1006788 | Ga0209564_10067885 | 305 |
| 569 | 3300025297 | Ga0209758_1001017 | Ga0209758_100101734 | 305 |
| 570 | 3300025297 | Ga0209758_1001281 | Ga0209758_10012819 | 305 |
| 571 | 3300025297 | Ga0209758_1002179 | Ga0209758_100217918 | 305 |
| 572 | 3300025298 | Ga0209050_1000530 | Ga0209050_100053049 | 305 |
| 573 | 3300025298 | Ga0209050_1008683 | Ga0209050_10086838 | 305 |
| 574 | 3300025302 | Ga0207426_1000293 | Ga0207426_100029345 | 305 |
| 575 | 3300025302 | Ga0207426_1000452 | Ga0207426_100045215 | 305 |
| 576 | 3300025302 | Ga0207426_1000546 | Ga0207426_100054640 | 305 |
| 577 | 3300025302 | Ga0207426_1009511 | Ga0207426_10095114 | 305 |
| 578 | 3300025303 | Ga0209051_1007944 | Ga0209051_10079445 | 305 |
| 579 | 3300025304 | Ga0209257_1004595 | Ga0209257_100459511 | 305 |
| 580 | 3300025904 | Ga0207647_10000117 | Ga0207647_1000011743 | 305 |
| 581 | 3300025904 | Ga0207647_10002941 | Ga0207647_100029417 | 305 |
| 582 | 3300025904 | Ga0207647_10093199 | Ga0207647_100931992 | 305 |
| 583 | 3300025907 | Ga0207645_10001758 | Ga0207645_1000175815 | 305 |
| 584 | 3300025911 | Ga0207654_10002034 | Ga0207654_100020342 | 305 |
| 585 | 3300025911 | Ga0207654_10007288 | Ga0207654_100072882 | 305 |
| 586 | 3300025911 | Ga0207654_10008332 | Ga0207654_100083323 | 305 |
| 587 | 3300025911 | Ga0207654_10259016 | Ga0207654_102590161 | 305 |
| 588 | 3300025913 | Ga0207695_10000020 | Ga0207695_10000020508 | 305 |
| 589 | 3300025913 | Ga0207695_10000077 | Ga0207695_10000077256 | 305 |
| 590 | 3300025913 | Ga0207695_10001743 | Ga0207695_100017433 | 305 |
| 591 | 3300025913 | Ga0207695_10005927 | Ga0207695_100059276 | 305 |
| 592 | 3300025913 | Ga0207695_10019624 | Ga0207695_100196242 | 305 |
| 593 | 3300025913 | Ga0207695_10059122 | Ga0207695_100591224 | 305 |
| 594 | 3300025913 | Ga0207695_10278830 | Ga0207695_102788302 | 305 |
| 595 | 3300025914 | Ga0207671_10001505 | Ga0207671_1000150515 | 305 |
| 596 | 3300025914 | Ga0207671_10008266 | Ga0207671_100082663 | 305 |
| 597 | 3300025914 | Ga0207671_10015560 | Ga0207671_100155602 | 305 |
| 598 | 3300025914 | Ga0207671_10237629 | Ga0207671_102376292 | 305 |
| 599 | 3300025917 | Ga0207660_10162444 | Ga0207660_101624442 | 305 |
| 600 | 3300025919 | Ga0207657_10004524 | Ga0207657_100045243 | 305 |
| 601 | 3300025919 | Ga0207657_10117206 | Ga0207657_101172062 | 305 |
| 602 | 3300025921 | Ga0207652_10071695 | Ga0207652_100716954 | 305 |
| 603 | 3300025923 | Ga0207681_10129380 | Ga0207681_101293801 | 305 |
| 604 | 3300025924 | Ga0207694_10213769 | Ga0207694_102137692 | 305 |
| 605 | 3300025931 | Ga0207644_10074788 | Ga0207644_100747882 | 305 |
| 606 | 3300025932 | Ga0207690_10040839 | Ga0207690_100408392 | 305 |
| 607 | 3300025933 | Ga0207706_10000044 | Ga0207706_100000446 | 305 |
| 608 | 3300025933 | Ga0207706_10207900 | Ga0207706_102079002 | 305 |
| 609 | 3300025934 | Ga0207686_10063662 | Ga0207686_100636623 | 305 |
| 610 | 3300025935 | Ga0207709_10060206 | Ga0207709_100602062 | 305 |
| 611 | 3300025938 | Ga0207704_10000144 | Ga0207704_1000014424 | 305 |
| 612 | 3300025940 | Ga0207691_10058089 | Ga0207691_100580893 | 305 |
| 613 | 3300025944 | Ga0207661_10158549 | Ga0207661_101585493 | 305 |
| 614 | 3300025949 | Ga0207667_10005479 | Ga0207667_1000547918 | 305 |
| 615 | 3300025949 | Ga0207667_10006819 | Ga0207667_100068198 | 305 |
| 616 | 3300025949 | Ga0207667_10015804 | Ga0207667_100158043 | 305 |
| 617 | 3300025949 | Ga0207667_10319701 | Ga0207667_103197012 | 305 |
| 618 | 3300025960 | Ga0207651_10020505 | Ga0207651_100205055 | 305 |
| 619 | 3300026023 | Ga0207677_10010714 | Ga0207677_100107143 | 305 |
| 620 | 3300026023 | Ga0207677_10046737 | Ga0207677_100467373 | 305 |
| 621 | 3300026041 | Ga0207639_10010820 | Ga0207639_100108206 | 305 |
| 622 | 3300026041 | Ga0207639_10024535 | Ga0207639_100245352 | 305 |
| 623 | 3300026041 | Ga0207639_10109045 | Ga0207639_101090453 | 305 |
| 624 | 3300026041 | Ga0207639_10137008 | Ga0207639_101370082 | 305 |
| 625 | 3300026041 | Ga0207639_10149689 | Ga0207639_101496892 | 305 |
| 626 | 3300026078 | Ga0207702_10040257 | Ga0207702_100402572 | 305 |
| 627 | 3300026089 | Ga0207648_10024015 | Ga0207648_100240151 | 305 |
| 628 | 3300026116 | Ga0207674_10087632 | Ga0207674_100876323 | 305 |
| 629 | 3300026116 | Ga0207674_10330946 | Ga0207674_103309462 | 305 |
| 630 | 3300026121 | Ga0207683_10012346 | Ga0207683_100123466 | 305 |
| 631 | 3300026142 | Ga0207698_10163885 | Ga0207698_101638852 | 305 |
| 632 | 3300026142 | Ga0207698_10170501 | Ga0207698_101705012 | 305 |
| 633 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016177 | 305 |
| 634 | 3300028379 | Ga0268266_10000132 | Ga0268266_1000013286 | 305 |
| 635 | 3300028379 | Ga0268266_10000333 | Ga0268266_1000033342 | 305 |
| 636 | 3300028381 | Ga0268264_10121368 | Ga0268264_101213682 | 305 |
| 637 | 3300028573 | Ga0265334_10019771 | Ga0265334_100197713 | 305 |
| 638 | 3300028573 | Ga0265334_10021766 | Ga0265334_100217663 | 305 |
| 639 | 3300028800 | Ga0265338_10028957 | Ga0265338_100289575 | 305 |
| 640 | 3300028800 | Ga0265338_10135871 | Ga0265338_101358712 | 305 |
| 641 | 3300028800 | Ga0265338_10303418 | Ga0265338_103034182 | 305 |
| 642 | 3300029957 | Ga0265324_10071972 | Ga0265324_100719721 | 305 |
| 643 | 3300030521 | Ga0307511_10000046 | Ga0307511_1000004615 | 305 |
| 644 | 3300030521 | Ga0307511_10000139 | Ga0307511_1000013933 | 305 |
| 645 | 3300030731 | Ga0316177_1055781 | Ga0316177_10557813 | 305 |
| 646 | 3300030731 | Ga0316177_1062757 | Ga0316177_10627576 | 305 |
| 647 | 3300030732 | Ga0316176_1023444 | Ga0316176_10234444 | 305 |
| 648 | 3300030732 | Ga0316176_1114001 | Ga0316176_11140014 | 305 |
| 649 | 3300030742 | Ga0316183_1079365 | Ga0316183_10793658 | 305 |
| 650 | 3300030742 | Ga0316183_1211687 | Ga0316183_12116873 | 305 |
| 651 | 3300030744 | Ga0316181_1220040 | Ga0316181_122004016 | 305 |
| 652 | 3300030744 | Ga0316181_1258294 | Ga0316181_12582942 | 305 |
| 653 | 3300031235 | Ga0265330_10039211 | Ga0265330_100392111 | 305 |
| 654 | 3300031250 | Ga0265331_10011097 | Ga0265331_100110975 | 305 |
| 655 | 3300031251 | Ga0265327_10000306 | Ga0265327_1000030629 | 305 |
| 656 | 3300031251 | Ga0265327_10104704 | Ga0265327_101047041 | 305 |
| 657 | 3300031344 | Ga0265316_10057982 | Ga0265316_100579823 | 305 |
| 658 | 3300031507 | Ga0307509_10048470 | Ga0307509_100484704 | 305 |
| 659 | 3300031507 | Ga0307509_10053420 | Ga0307509_100534202 | 305 |
| 660 | 3300031548 | Ga0307408_100066292 | Ga0307408_1000662922 | 305 |
| 661 | 3300032004 | Ga0307414_10002617 | Ga0307414_100026171 | 305 |
| 662 | 3300032004 | Ga0307414_10024385 | Ga0307414_100243851 | 305 |
| 663 | 3300033180 | Ga0307510_10010171 | Ga0307510_100101717 | 305 |
| 664 | 3300039447 | Ga0436361_0292109 | Ga0436361_0292109_7334_8257 | 305 |
| 665 | 3300044658 | Ga0466972_0000077 | Ga0466972_0000077_21619_22539 | 305 |
| 666 | 3300044658 | Ga0466972_0008131 | Ga0466972_0008131_331_1251 | 305 |
| 667 | 3300044683 | Ga0466965_0120426 | Ga0466965_0120426_109_1032 | 305 |
| 668 | 3300044683 | Ga0466965_0121953 | Ga0466965_0121953_245_1165 | 305 |
| 669 | 3300044693 | Ga0466961_0142401 | Ga0466961_0142401_465_1391 | 305 |
| 670 | 3300044693 | Ga0466961_0196348 | Ga0466961_0196348_137_1057 | 305 |
| 671 | 3300044706 | Ga0466964_0047540 | Ga0466964_0047540_93_1016 | 305 |
| 672 | 3300044765 | Ga0466970_0002985 | Ga0466970_0002985_5482_6402 | 305 |
| 673 | 3300045049 | Ga0466959_0033002 | Ga0466959_0033002_907_1833 | 305 |
| 674 | 3300045049 | Ga0466959_0081890 | Ga0466959_0081890_499_1419 | 305 |
| 675 | 3300046453 | Ga0495627_010661 | Ga0495627_010661_980_1900 | 305 |
| 676 | 3300046460 | Ga0495638_0033930 | Ga0495638_0033930_764_1684 | 305 |
| 677 | 3300046492 | Ga0495585_0000902 | Ga0495585_0000902_2841_3764 | 305 |
| 678 | 3300046507 | Ga0495606_0000142 | Ga0495606_0000142_16637_17560 | 305 |
| 679 | 3300046507 | Ga0495606_0012300 | Ga0495606_0012300_4859_5782 | 305 |
| 680 | 3300046524 | Ga0495648_0017408 | Ga0495648_0017408_328_1251 | 305 |
| 681 | 3300046538 | Ga0495609_0103927 | Ga0495609_0103927_39_962 | 305 |
| 682 | 3300046558 | Ga0495633_0000159 | Ga0495633_0000159_71243_72163 | 305 |
| 683 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_644438_645361 | 305 |
| 684 | 3300046648 | Ga0495611_0001790 | Ga0495611_0001790_5417_6337 | 305 |
| 685 | 3300046648 | Ga0495611_0043233 | Ga0495611_0043233_112_1032 | 305 |
| 686 | 3300046660 | Ga0495625_0000663 | Ga0495625_0000663_27190_28110 | 305 |
| 687 | 3300046660 | Ga0495625_0046382 | Ga0495625_0046382_558_1481 | 305 |
| 688 | 3300046665 | Ga0495661_0024459 | Ga0495661_0024459_1584_2504 | 305 |
| 689 | 3300046683 | Ga0495658_0047518 | Ga0495658_0047518_374_1297 | 305 |
| 690 | 3300046694 | Ga0495649_0037185 | Ga0495649_0037185_1153_2073 | 305 |
| 691 | 3300047320 | Ga0495672_0128183 | Ga0495672_0128183_73_993 | 305 |
| 692 | 3300047443 | Ga0495687_002423 | Ga0495687_002423_10176_11096 | 305 |
| 693 | 3300047443 | Ga0495687_018255 | Ga0495687_018255_1752_2675 | 305 |
| 694 | 3300047472 | Ga0495686_0000040 | Ga0495686_0000040_240766_241692 | 305 |
| 695 | 3300047472 | Ga0495686_0043016 | Ga0495686_0043016_1140_2063 | 305 |
| 696 | 3300047472 | Ga0495686_0198909 | Ga0495686_0198909_100_1023 | 305 |
| 697 | 3300048925 | Ga0496122_0001254 | Ga0496122_0001254_2327_3250 | 305 |
| 698 | 3300048926 | Ga0496123_0002075 | Ga0496123_0002075_5777_6700 | 305 |
| 699 | 3300049459 | Ga0495678_040446 | Ga0495678_040446_342_1265 | 305 |
| 700 | 3300049571 | Ga0501034_0213057 | Ga0501034_0213057_623_1549 | 305 |
| 701 | 3300049586 | Ga0501070_0063907 | Ga0501070_0063907_562_1488 | 305 |
| 702 | 3300049670 | Ga0501236_001334 | Ga0501236_001334_11_937 | 305 |
| 703 | 3300049761 | Ga0501264_000679 | Ga0501264_000679_2012_2938 | 305 |
| 704 | 3300050493 | nmdc:mga0k408_22188_c2 | nmdc:mga0k408_22188_c2_562_1521 | 305 |
| 705 | 3300050493 | nmdc:mga0k408_31_c1 | nmdc:mga0k408_31_c1_74955_75875 | 305 |
| 706 | 3300053086 | Ga0500578_0180556 | Ga0500578_0180556_257_1177 | 305 |
| 707 | 3300053088 | Ga0500644_0000415 | Ga0500644_0000415_1676_2602 | 305 |
| 708 | 3300053092 | Ga0500583_0001157 | Ga0500583_0001157_3066_3986 | 305 |
| 709 | 3300053092 | Ga0500583_0027619 | Ga0500583_0027619_385_1305 | 305 |
| 710 | 3300053125 | Ga0500618_000026 | Ga0500618_000026_27331_28251 | 305 |
| 711 | 3300053131 | Ga0500652_030618 | Ga0500652_030618_666_1598 | 305 |
| 712 | 3300053139 | Ga0500568_0072145 | Ga0500568_0072145_160_1080 | 305 |
| 713 | 3300053146 | Ga0500588_0000391 | Ga0500588_0000391_5343_6263 | 305 |
| 714 | 3300053147 | Ga0500589_038312 | Ga0500589_038312_865_1785 | 305 |
| 715 | 3300053151 | Ga0500604_0010616 | Ga0500604_0010616_1184_2104 | 305 |
| 716 | 3300053153 | Ga0500616_0013208 | Ga0500616_0013208_2162_3088 | 305 |
| 717 | 3300053153 | Ga0500616_0090181 | Ga0500616_0090181_492_1418 | 305 |
| 718 | 3300053156 | Ga0500622_0000034 | Ga0500622_0000034_113921_114841 | 305 |
| 719 | 3300053156 | Ga0500622_0034172 | Ga0500622_0034172_1657_2577 | 305 |
| 720 | 3300053160 | Ga0500633_0000454 | Ga0500633_0000454_5176_6102 | 305 |
| 721 | 3300053177 | Ga0500636_0014649 | Ga0500636_0014649_3241_4161 | 305 |
| 722 | 3300053178 | Ga0500637_0154862 | Ga0500637_0154862_67_987 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mkl-assembly2.cif.gz_B | crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 | 0.8908 | 199 | 304 |
| 3lsg-assembly1.cif.gz_A | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.882 | 200 | 301 |
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.8773 | 196 | 303 |
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.8703 | 196 | 304 |
| 3mkl-assembly1.cif.gz_A | crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 | 0.8669 | 196 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lsgA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9821 | 257 | 301 | 1.10.10.60 |
| af_P32677_219_275_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9555 | 253 | 304 | 1.10.10.60 |
| 1bl0A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9553 | 258 | 301 | 1.10.10.60 |
| 3lsgB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9508 | 257 | 301 | 1.10.10.60 |
| 1xs9A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9455 | 258 | 302 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3EPE4-F1-model_v4 | deleted | 0.9522 | 213 | 305 |
|
| AF-A0A1G8AJA1-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9448 | 219 | 305 |
GO:0003700
GO:0043565 |
| AF-A0A1I4TB30-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9425 | 188 | 303 |
GO:0003700
GO:0043565 |
| AF-A0A3C0CTA9-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9355 | 219 | 304 |
GO:0003700
GO:0043565 |
| AF-A0A2E5EFX0-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9355 | 222 | 305 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar