F477363

General Info

Members Datasets Scaffolds Average Seq Length
721 267 720 285

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10011500|Ga0157370_100115002
Length 306
Sequence VNDNTRQSPVNDGLRTLIARAESLLARVEALFPPLVTDPDWSHTMAARWRKRNGRGFLQPVAHPHAVALDDLVAIDAQKQTIDRNTQQFIAGLPANNVLLTGSRGTGKSSLVKAMLARYADRGLRLIEVDKSDLTXXPDIAERIESEPYRYVIFCDDLTFDAGEAGYKALKVMLDGSIAGAASNVLIYATSNRRHLLPEYFAENLETRHVGDEVHPGESVEEKISLSERFGLWISFYPFVQDDYLVAVDRWLAHFGVAAPASERDAEARTREALQFALSRGSRSGRIAWQFARHYAGSLGLDSHVG

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.19
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10058655 3300005327 Bacteria 3133
2 Ga0070676_10000862 3300005328 Bacteria 14943
3 Ga0070676_10001774 3300005328 Bacteria 10984
4 Ga0070676_10006266 3300005328 Bacteria 6356
5 Ga0070676_10088404 3300005328 Bacteria 1893
6 Ga0070683_100001287 3300005329 Bacteria 19089
7 Ga0070683_100068000 3300005329 Bacteria 3318
8 Ga0070690_100018654 3300005330 Bacteria 4193
9 Ga0070670_100011090 3300005331 Bacteria 7700
10 Ga0070670_100017466 3300005331 Bacteria 6155
11 Ga0070670_100065429 3300005331 Bacteria 3119
12 Ga0070670_100075314 3300005331 Bacteria 2900
13 Ga0070677_10000268 3300005333 Bacteria 18104
14 Ga0070677_10013475 3300005333 Bacteria 2860
15 Ga0068869_100000717 3300005334 Bacteria 18833
16 Ga0068869_100042456 3300005334 Bacteria 3260
17 Ga0068869_100158086 3300005334 Bacteria 1763
18 Ga0068869_100163024 3300005334 Bacteria 1736
19 Ga0070666_10000839 3300005335 Bacteria 18638
20 Ga0070666_10005531 3300005335 Bacteria 7751
21 Ga0070666_10013780 3300005335 Bacteria 5135
22 Ga0070666_10041436 3300005335 Bacteria 3077
23 Ga0070680_100186305 3300005336 Bacteria 1748
24 Ga0068868_100004519 3300005338 Bacteria 9760
25 Ga0068868_100008483 3300005338 Bacteria 7356
26 Ga0068868_100065551 3300005338 Bacteria 2886
27 Ga0068868_100128144 3300005338 Bacteria 2075
28 Ga0068868_100392221 3300005338 Bacteria 1196
29 Ga0068868_100414566 3300005338 Bacteria 1165
30 Ga0070660_100001693 3300005339 Bacteria 15121
31 Ga0070660_100005619 3300005339 Bacteria 8691
32 Ga0070660_100050027 3300005339 Bacteria 3215
33 Ga0070689_100005991 3300005340 Bacteria 8370
34 Ga0070689_100027510 3300005340 Bacteria 4288
35 Ga0070691_10010280 3300005341 Bacteria 4270
36 Ga0070661_100007248 3300005344 Bacteria 7647
37 Ga0070661_100010193 3300005344 Bacteria 6529
38 Ga0070661_100042872 3300005344 Bacteria 3304
39 Ga0070661_100056525 3300005344 Bacteria 2875
40 Ga0070661_100116454 3300005344 Bacteria 1999
41 Ga0070661_100139946 3300005344 Bacteria 1823
42 Ga0070661_100159511 3300005344 Bacteria 1708
43 Ga0070661_100254188 3300005344 Bacteria 1357
44 Ga0070661_100331356 3300005344 Bacteria 1191
45 Ga0070692_10090302 3300005345 Bacteria 1664
46 Ga0070668_100003003 3300005347 Bacteria 12469
47 Ga0070668_100008937 3300005347 Bacteria 7438
48 Ga0070669_100001156 3300005353 Bacteria 19281
49 Ga0070669_100051735 3300005353 Bacteria 3004
50 Ga0070675_100006504 3300005354 Bacteria 8974
51 Ga0070675_100016281 3300005354 Bacteria 5897
52 Ga0070675_100026358 3300005354 Bacteria 4665
53 Ga0070675_100047016 3300005354 Bacteria 3535
54 Ga0070675_100482173 3300005354 Bacteria 1115
55 Ga0070671_100015546 3300005355 Bacteria 6149
56 Ga0070671_100031187 3300005355 Bacteria 4402
57 Ga0070671_100046272 3300005355 Bacteria 3618
58 Ga0070671_100050634 3300005355 Bacteria 3454
59 Ga0070671_100073970 3300005355 Bacteria 2846
60 Ga0070671_100118520 3300005355 Bacteria 2227
61 Ga0070671_100236187 3300005355 Bacteria 1551
62 Ga0070674_100001276 3300005356 Bacteria 13267
63 Ga0070674_100074111 3300005356 Bacteria 2415
64 Ga0070674_100154130 3300005356 Bacteria 1737
65 Ga0070673_100001215 3300005364 Bacteria 14873
66 Ga0070673_100002411 3300005364 Bacteria 11376
67 Ga0070673_100002612 3300005364 Bacteria 11012
68 Ga0070673_100005120 3300005364 Bacteria 8359
69 Ga0070673_100012948 3300005364 Bacteria 5748
70 Ga0070673_100049248 3300005364 Bacteria 3289
71 Ga0070673_100091103 3300005364 Bacteria 2492
72 Ga0070688_100000814 3300005365 Bacteria 15398
73 Ga0070688_100023500 3300005365 Bacteria 3627
74 Ga0070688_100074221 3300005365 Bacteria 2184
75 Ga0070688_100082898 3300005365 Bacteria 2080
76 Ga0070659_100005062 3300005366 Bacteria 9448
77 Ga0070659_100029207 3300005366 Bacteria 4261
78 Ga0070659_100084993 3300005366 Bacteria 2531
79 Ga0070659_100091196 3300005366 Bacteria 2442
80 Ga0070659_100120959 3300005366 Bacteria 2121
81 Ga0070659_100163033 3300005366 Bacteria 1823
82 Ga0070659_100182219 3300005366 Bacteria 1724
83 Ga0070659_100248779 3300005366 Bacteria 1473
84 Ga0070659_100305378 3300005366 Bacteria 1328
85 Ga0070667_100003294 3300005367 Bacteria 13801
86 Ga0070667_100005512 3300005367 Bacteria 10571
87 Ga0070667_100013573 3300005367 Bacteria 6732
88 Ga0070667_100027551 3300005367 Bacteria 4728
89 Ga0070703_10040643 3300005406 Bacteria 1447
90 Ga0070709_10006696 3300005434 Bacteria 6291
91 Ga0070709_10017844 3300005434 Bacteria 4077
92 Ga0070714_100005782 3300005435 Bacteria 9484
93 Ga0070714_100007012 3300005435 Bacteria 8735
94 Ga0070714_100085264 3300005435 Bacteria 2758
95 Ga0070713_100000039 3300005436 Bacteria 83384
96 Ga0070713_100003066 3300005436 Bacteria 10984
97 Ga0070713_100114842 3300005436 Bacteria 2353
98 Ga0070713_100137683 3300005436 Bacteria 2159
99 Ga0070713_100170134 3300005436 Bacteria 1951
100 Ga0070710_10012321 3300005437 Bacteria 4243
101 Ga0070710_10065753 3300005437 Bacteria 2077
102 Ga0070701_10015768 3300005438 Bacteria 3498
103 Ga0070701_10120267 3300005438 Bacteria 1479
104 Ga0070711_100006625 3300005439 Bacteria 6996
105 Ga0070711_100043761 3300005439 Bacteria 3035
106 Ga0070711_100211393 3300005439 Bacteria 1503
107 Ga0070705_100087597 3300005440 Bacteria 1930
108 Ga0070700_100131634 3300005441 Bacteria 1689
109 Ga0070694_100026753 3300005444 Bacteria 3741
110 Ga0070708_100001846 3300005445 Bacteria 16258
111 Ga0070708_100151044 3300005445 Bacteria 2160
112 Ga0070708_100185275 3300005445 Bacteria 1946
113 Ga0070663_100027376 3300005455 Bacteria 3871
114 Ga0070663_100052938 3300005455 Bacteria 2897
115 Ga0070663_100060337 3300005455 Bacteria 2728
116 Ga0070663_100475851 3300005455 Bacteria 1033
117 Ga0070678_100000169 3300005456 Bacteria 28018
118 Ga0070678_100003566 3300005456 Bacteria 8681
119 Ga0070678_100005090 3300005456 Bacteria 7544
120 Ga0070678_100006666 3300005456 Bacteria 6792
121 Ga0070678_100008313 3300005456 Bacteria 6214
122 Ga0070678_100140767 3300005456 Bacteria 1930
123 Ga0070662_100000554 3300005457 Bacteria 22651
124 Ga0070662_100030069 3300005457 Bacteria 3797
125 Ga0070662_100303593 3300005457 Bacteria 1297
126 Ga0070681_10006907 3300005458 Bacteria 11050
127 Ga0070681_10017021 3300005458 Bacteria 7265
128 Ga0068867_100001033 3300005459 Bacteria 19020
129 Ga0068867_100002460 3300005459 Bacteria 13022
130 Ga0068867_100011620 3300005459 Bacteria 6217
131 Ga0068867_100047216 3300005459 Bacteria 3165
132 Ga0068867_100049466 3300005459 Bacteria 3095
133 Ga0068867_100052758 3300005459 Bacteria 3001
134 Ga0070685_10000622 3300005466 Bacteria 19395
135 Ga0070685_10046834 3300005466 Bacteria 2484
136 Ga0070706_100018202 3300005467 Bacteria 6481
137 Ga0070706_100082137 3300005467 Bacteria 2985
138 Ga0070698_100129941 3300005471 Bacteria 2475
139 Ga0070698_100156180 3300005471 Bacteria 2227
140 Ga0070699_100050548 3300005518 Bacteria 3599
141 Ga0070699_100173937 3300005518 Bacteria 1908
142 Ga0070679_100262724 3300005530 Bacteria 1681
143 Ga0070679_100274174 3300005530 Bacteria 1640
144 Ga0070679_100411152 3300005530 Bacteria 1299
145 Ga0070684_100001168 3300005535 Bacteria 18835
146 Ga0070684_100025993 3300005535 Bacteria 4927
147 Ga0070684_100338663 3300005535 Bacteria 1383
148 Ga0070697_100063348 3300005536 Bacteria 3019
149 Ga0068853_100009737 3300005539 Bacteria 7752
150 Ga0068853_100013365 3300005539 Bacteria 6702
151 Ga0068853_100016992 3300005539 Bacteria 5999
152 Ga0068853_100096733 3300005539 Bacteria 2605
153 Ga0068853_100197559 3300005539 Bacteria 1829
154 Ga0068853_100247661 3300005539 Bacteria 1634
155 Ga0068853_100343645 3300005539 Bacteria 1387
156 Ga0070672_100000853 3300005543 Bacteria 18220
157 Ga0070672_100005197 3300005543 Bacteria 8609
158 Ga0070672_100021220 3300005543 Bacteria 4749
159 Ga0070672_100045668 3300005543 Bacteria 3390
160 Ga0070672_100072600 3300005543 Bacteria 2740
161 Ga0070672_100206712 3300005543 Bacteria 1643
162 Ga0070686_100039973 3300005544 Bacteria 2925
163 Ga0070696_100002477 3300005546 Bacteria 12236
164 Ga0070696_100105940 3300005546 Bacteria 2020
165 Ga0070693_100002942 3300005547 Bacteria 7872
166 Ga0070665_100001395 3300005548 Bacteria 28413
167 Ga0070665_100003175 3300005548 Bacteria 17687
168 Ga0070665_100003807 3300005548 Bacteria 15975
169 Ga0070665_100061175 3300005548 Bacteria 3775
170 Ga0070665_100066705 3300005548 Bacteria 3610
171 Ga0070704_100034064 3300005549 Bacteria 3450
172 Ga0070704_100048997 3300005549 Bacteria 2960
173 Ga0068855_100007680 3300005563 Bacteria 13030
174 Ga0068855_100030425 3300005563 Bacteria 6458
175 Ga0068855_100030945 3300005563 Bacteria 6395
176 Ga0068855_100045063 3300005563 Bacteria 5217
177 Ga0068855_100129444 3300005563 Bacteria 2884
178 Ga0068855_100183612 3300005563 Bacteria 2364
179 Ga0068855_100328741 3300005563 Bacteria 1688
180 Ga0070664_100000572 3300005564 Bacteria 28020
181 Ga0070664_100004095 3300005564 Bacteria 11709
182 Ga0070664_100029911 3300005564 Bacteria 4541
183 Ga0070664_100084109 3300005564 Bacteria 2746
184 Ga0070664_100101744 3300005564 Bacteria 2499
185 Ga0070664_100132311 3300005564 Bacteria 2191
186 Ga0070664_100136900 3300005564 Bacteria 2154
187 Ga0070664_100141451 3300005564 Bacteria 2119
188 Ga0070664_100281639 3300005564 Bacteria 1499
189 Ga0068857_100000465 3300005577 Bacteria 28816
190 Ga0068857_100360528 3300005577 Bacteria 1347
191 Ga0068854_100008411 3300005578 Bacteria 6633
192 Ga0068854_100024306 3300005578 Bacteria 4146
193 Ga0068854_100026753 3300005578 Bacteria 3968
194 Ga0068854_100042845 3300005578 Bacteria 3205
195 Ga0068854_100045389 3300005578 Bacteria 3124
196 Ga0068854_100100406 3300005578 Bacteria 2168
197 Ga0068854_100311438 3300005578 Unclassified 1277
198 Ga0068856_100000962 3300005614 Bacteria 30736
199 Ga0068856_100001205 3300005614 Bacteria 27150
200 Ga0068856_100003469 3300005614 Bacteria 15937
201 Ga0068856_100045436 3300005614 Bacteria 4325
202 Ga0068856_100143504 3300005614 Bacteria 2395
203 Ga0068856_100295722 3300005614 Bacteria 1636
204 Ga0070702_100032385 3300005615 Bacteria 2868
205 Ga0070702_100242044 3300005615 Bacteria 1218
206 Ga0068852_100022082 3300005616 Bacteria 5096
207 Ga0068852_100059049 3300005616 Bacteria 3325
208 Ga0068852_100086600 3300005616 Bacteria 2793
209 Ga0068852_100233925 3300005616 Bacteria 1753
210 Ga0068852_100289191 3300005616 Bacteria 1583
211 Ga0068859_100003107 3300005617 Bacteria 16861
212 Ga0068859_100028321 3300005617 Bacteria 5616
213 Ga0068859_100159151 3300005617 Bacteria 2337
214 Ga0068859_100243831 3300005617 Bacteria 1886
215 Ga0068864_100000836 3300005618 Bacteria 25975
216 Ga0068864_100003838 3300005618 Bacteria 12389
217 Ga0068864_100007835 3300005618 Bacteria 8802
218 Ga0068864_100017807 3300005618 Bacteria 5926
219 Ga0068864_100033445 3300005618 Bacteria 4370
220 Ga0068864_100036849 3300005618 Bacteria 4171
221 Ga0068864_100082286 3300005618 Bacteria 2824
222 Ga0068866_10013319 3300005718 Bacteria 3605
223 Ga0068866_10036721 3300005718 Bacteria 2401
224 Ga0068861_100024274 3300005719 Bacteria 4384
225 Ga0068861_100218085 3300005719 Bacteria 1611
226 Ga0068851_10003303 3300005834 Bacteria 7162
227 Ga0068851_10024479 3300005834 Bacteria 2956
228 Ga0068870_10006880 3300005840 Bacteria 5045
229 Ga0068870_10011964 3300005840 Bacteria 4040
230 Ga0068870_10023079 3300005840 Bacteria 3064
231 Ga0068863_100004444 3300005841 Bacteria 13828
232 Ga0068863_100021653 3300005841 Bacteria 6131
233 Ga0068863_100089700 3300005841 Bacteria 2915
234 Ga0068863_100240337 3300005841 Bacteria 1748
235 Ga0068863_100414764 3300005841 Bacteria 1318
236 Ga0068863_100528265 3300005841 Bacteria 1164
237 Ga0068858_100002758 3300005842 Bacteria 17655
238 Ga0068858_100006556 3300005842 Bacteria 11322
239 Ga0068860_100005292 3300005843 Bacteria 13096
240 Ga0068860_100008429 3300005843 Bacteria 10267
241 Ga0068860_100012285 3300005843 Bacteria 8439
242 Ga0068860_100023819 3300005843 Bacteria 5918
243 Ga0068860_100030713 3300005843 Bacteria 5167
244 Ga0068862_100028779 3300005844 Bacteria 4679
245 Ga0081455_10219774 3300005937 Bacteria 1409
246 Ga0081539_10085150 3300005985 Bacteria 1650
247 Ga0070715_10037871 3300006163 Bacteria 1999
248 Ga0070716_100050375 3300006173 Bacteria 2363
249 Ga0070716_100133010 3300006173 Bacteria 1575
250 Ga0070712_100002822 3300006175 Bacteria 10750
251 Ga0070712_100178923 3300006175 Bacteria 1651
252 Ga0075366_10009362 3300006195 Bacteria 5466
253 Ga0097621_100007062 3300006237 Bacteria 8002
254 Ga0097621_100057224 3300006237 Bacteria 3187
255 Ga0097621_100074891 3300006237 Bacteria 2804
256 Ga0097621_100104172 3300006237 Bacteria 2390
257 Ga0097621_100127121 3300006237 Bacteria 2166
258 Ga0097621_100226331 3300006237 Bacteria 1631
259 Ga0068871_100003622 3300006358 Bacteria 10614
260 Ga0068871_100009799 3300006358 Bacteria 6951
261 Ga0068871_100300825 3300006358 Bacteria 1408
262 Ga0068871_100400965 3300006358 Bacteria 1221
263 Ga0075428_100488200 3300006844 Bacteria 1318
264 Ga0075433_10024408 3300006852 Bacteria 5102
265 Ga0075433_10086669 3300006852 Bacteria 2765
266 Ga0075434_100171298 3300006871 Bacteria 2191
267 Ga0068865_100015911 3300006881 Bacteria 4804
268 Ga0068865_100030540 3300006881 Bacteria 3585
269 Ga0068865_100122854 3300006881 Bacteria 1934
270 Ga0075436_100040081 3300006914 Bacteria 3232
271 Ga0075436_100091240 3300006914 Bacteria 2118
272 Ga0097620_100003107 3300006931 Bacteria 16861
273 Ga0097620_100028318 3300006931 Bacteria 5616
274 Ga0097620_100159153 3300006931 Bacteria 2337
275 Ga0097620_100243837 3300006931 Bacteria 1886
276 Ga0075435_100058306 3300007076 Bacteria 3126
277 Ga0075435_100157679 3300007076 Bacteria 1910
278 Ga0075435_100169732 3300007076 Bacteria 1840
279 Ga0105240_10010941 3300009093 Bacteria 12710
280 Ga0105240_10148561 3300009093 Bacteria 2793
281 Ga0105240_10288021 3300009093 Bacteria 1884
282 Ga0111539_10051311 3300009094 Bacteria 4914
283 Ga0105245_10026765 3300009098 Bacteria 5078
284 Ga0105245_10263450 3300009098 Bacteria 1678
285 Ga0114129_10064248 3300009147 Bacteria 5122
286 Ga0105243_10108611 3300009148 Bacteria 2316
287 Ga0105241_10285681 3300009174 Bacteria 1411
288 Ga0105241_10295580 3300009174 Bacteria 1388
289 Ga0105241_10295943 3300009174 Bacteria 1387
290 Ga0105241_10367499 3300009174 Bacteria 1253
291 Ga0105242_10059031 3300009176 Bacteria 3147
292 Ga0105248_10007610 3300009177 Bacteria 11898
293 Ga0105248_10019862 3300009177 Bacteria 7441
294 Ga0105248_10047229 3300009177 Bacteria 4828
295 Ga0105248_10048455 3300009177 Bacteria 4767
296 Ga0105248_10064781 3300009177 Bacteria 4103
297 Ga0105248_10091786 3300009177 Bacteria 3420
298 Ga0105248_10222372 3300009177 Bacteria 2126
299 Ga0105248_10508095 3300009177 Bacteria 1359
300 Ga0105237_10151393 3300009545 Bacteria 2316
301 Ga0105237_10241390 3300009545 Bacteria 1808
302 Ga0105238_10000817 3300009551 Bacteria 32236
303 Ga0105238_10050122 3300009551 Bacteria 4203
304 Ga0105238_10180310 3300009551 Bacteria 2089
305 Ga0105249_10175248 3300009553 Bacteria 2083
306 Ga0105249_10214776 3300009553 Bacteria 1890
307 Ga0105239_10331116 3300010375 Bacteria 1718
308 Ga0157373_10005680 3300013100 Bacteria 9346
309 Ga0157373_10008074 3300013100 Bacteria 7821
310 Ga0157371_10056803 3300013102 Bacteria 2776
311 Ga0157370_10011500 3300013104 Bacteria 9248
312 Ga0157370_10040922 3300013104 Bacteria 4473
313 Ga0157370_10213273 3300013104 Bacteria 1789
314 Ga0157369_10009759 3300013105 Bacteria 10979
315 Ga0157369_10049473 3300013105 Bacteria 4557
316 Ga0157369_10095343 3300013105 Bacteria 3175
317 Ga0157369_10100523 3300013105 Bacteria 3083
318 Ga0157369_10112711 3300013105 Bacteria 2889
319 Ga0157369_10445662 3300013105 Bacteria 1341
320 Ga0157374_10003153 3300013296 Bacteria 13861
321 Ga0157374_10008326 3300013296 Bacteria 8851
322 Ga0157374_10107749 3300013296 Bacteria 2678
323 Ga0157374_10114068 3300013296 Bacteria 2601
324 Ga0157374_10424998 3300013296 Bacteria 1328
325 Ga0157374_10722622 3300013296 Unclassified 1010
326 Ga0157378_10061343 3300013297 Bacteria 3355
327 Ga0157378_10082858 3300013297 Bacteria 2901
328 Ga0157378_10089570 3300013297 Bacteria 2795
329 Ga0163162_10004211 3300013306 Bacteria 13826
330 Ga0163162_10033285 3300013306 Bacteria 5121
331 Ga0163162_10038651 3300013306 Bacteria 4763
332 Ga0163162_10149177 3300013306 Bacteria 2455
333 Ga0163162_10326385 3300013306 Bacteria 1667
334 Ga0163162_10332843 3300013306 Bacteria 1651
335 Ga0163162_10496920 3300013306 Bacteria 1350
336 Ga0157372_10002230 3300013307 Bacteria 21023
337 Ga0157372_10009688 3300013307 Bacteria 10241
338 Ga0157372_10039603 3300013307 Bacteria 5202
339 Ga0157372_10161335 3300013307 Bacteria 2591
340 Ga0157372_10524910 3300013307 Bacteria 1380
341 Ga0157372_10646756 3300013307 Bacteria 1231
342 Ga0157375_10002925 3300013308 Bacteria 14813
343 Ga0157375_10004445 3300013308 Bacteria 12179
344 Ga0157375_10006293 3300013308 Bacteria 10340
345 Ga0157375_10030861 3300013308 Bacteria 5059
346 Ga0157375_10228450 3300013308 Bacteria 2020
347 Ga0157375_10246814 3300013308 Bacteria 1946
348 Ga0157375_10372750 3300013308 Bacteria 1594
349 Ga0163163_10001349 3300014325 Bacteria 20707
350 Ga0163163_10019983 3300014325 Bacteria 6301
351 Ga0163163_10056449 3300014325 Bacteria 3881
352 Ga0163163_10128098 3300014325 Bacteria 2577
353 Ga0157380_10054683 3300014326 Bacteria 3169
354 Ga0157380_10228374 3300014326 Bacteria 1670
355 Ga0157377_10040366 3300014745 Bacteria 2584
356 Ga0157377_10135002 3300014745 Bacteria 1511
357 Ga0157379_10001289 3300014968 Bacteria 20426
358 Ga0157379_10141967 3300014968 Bacteria 2165
359 Ga0157379_10295898 3300014968 Bacteria 1475
360 Ga0157379_10408444 3300014968 Bacteria 1249
361 Ga0157379_10435052 3300014968 Bacteria 1209
362 Ga0157376_10020955 3300014969 Bacteria 5069
363 Ga0157376_10110923 3300014969 Bacteria 2414
364 Ga0157376_10259253 3300014969 Bacteria 1628
365 Ga0157376_10403759 3300014969 Bacteria 1322
366 Ga0157376_10469363 3300014969 Bacteria 1231
367 Ga0163161_10020325 3300017792 Bacteria 4659
368 Ga0163161_10086797 3300017792 Bacteria 2310
369 Ga0163161_10453601 3300017792 Bacteria 1037
370 Ga0207697_10003677 3300025315 Bacteria 7512
371 Ga0207697_10028744 3300025315 Bacteria 2275
372 Ga0207697_10034310 3300025315 Bacteria 2077
373 Ga0207656_10017284 3300025321 Bacteria 2822
374 Ga0207682_10000010 3300025893 Bacteria 85697
375 Ga0207682_10000483 3300025893 Bacteria 18458
376 Ga0207682_10019839 3300025893 Bacteria 2635
377 Ga0207682_10029387 3300025893 Bacteria 2198
378 Ga0207692_10007307 3300025898 Bacteria 4521
379 Ga0207688_10012323 3300025901 Bacteria 4654
380 Ga0207680_10007835 3300025903 Bacteria 5221
381 Ga0207680_10063053 3300025903 Bacteria 2267
382 Ga0207680_10064584 3300025903 Bacteria 2245
383 Ga0207685_10012197 3300025905 Bacteria 2614
384 Ga0207699_10005093 3300025906 Bacteria 6288
385 Ga0207699_10261451 3300025906 Bacteria 1196
386 Ga0207645_10000617 3300025907 Bacteria 29514
387 Ga0207645_10006124 3300025907 Bacteria 8642
388 Ga0207645_10009628 3300025907 Bacteria 6676
389 Ga0207645_10010911 3300025907 Bacteria 6221
390 Ga0207645_10027594 3300025907 Bacteria 3665
391 Ga0207645_10148079 3300025907 Bacteria 1531
392 Ga0207643_10000339 3300025908 Bacteria 31901
393 Ga0207643_10004283 3300025908 Bacteria 7676
394 Ga0207643_10022770 3300025908 Bacteria 3452
395 Ga0207643_10033369 3300025908 Bacteria 2880
396 Ga0207705_10227912 3300025909 Bacteria 1417
397 Ga0207684_10014702 3300025910 Bacteria 6742
398 Ga0207654_10052805 3300025911 Bacteria 2344
399 Ga0207654_10175524 3300025911 Bacteria 1394
400 Ga0207707_10024845 3300025912 Bacteria 5240
401 Ga0207707_10048067 3300025912 Bacteria 3717
402 Ga0207707_10103171 3300025912 Bacteria 2493
403 Ga0207707_10143861 3300025912 Bacteria 2084
404 Ga0207695_10019928 3300025913 Bacteria 7703
405 Ga0207695_10023248 3300025913 Bacteria 7011
406 Ga0207695_10065559 3300025913 Bacteria 3734
407 Ga0207693_10003564 3300025915 Bacteria 13301
408 Ga0207693_10017562 3300025915 Bacteria 5704
409 Ga0207663_10018700 3300025916 Bacteria 3889
410 Ga0207660_10014493 3300025917 Bacteria 5187
411 Ga0207660_10073160 3300025917 Bacteria 2498
412 Ga0207660_10157034 3300025917 Bacteria 1752
413 Ga0207662_10047986 3300025918 Bacteria 2529
414 Ga0207657_10000329 3300025919 Bacteria 50461
415 Ga0207657_10002457 3300025919 Bacteria 20027
416 Ga0207657_10003687 3300025919 Bacteria 16291
417 Ga0207657_10008004 3300025919 Bacteria 10775
418 Ga0207657_10015277 3300025919 Bacteria 7444
419 Ga0207657_10099847 3300025919 Bacteria 2410
420 Ga0207649_10011058 3300025920 Bacteria 4966
421 Ga0207649_10039155 3300025920 Bacteria 2872
422 Ga0207649_10060934 3300025920 Bacteria 2373
423 Ga0207652_10005308 3300025921 Bacteria 10455
424 Ga0207652_10132418 3300025921 Bacteria 2225
425 Ga0207652_10197046 3300025921 Bacteria 1812
426 Ga0207646_10449050 3300025922 Bacteria 1163
427 Ga0207681_10004220 3300025923 Bacteria 8880
428 Ga0207681_10026284 3300025923 Bacteria 3753
429 Ga0207681_10100216 3300025923 Bacteria 2088
430 Ga0207681_10360033 3300025923 Bacteria 1166
431 Ga0207694_10002353 3300025924 Bacteria 15459
432 Ga0207694_10020347 3300025924 Bacteria 5019
433 Ga0207650_10017431 3300025925 Bacteria 5030
434 Ga0207650_10068939 3300025925 Bacteria 2657
435 Ga0207650_10149330 3300025925 Bacteria 1843
436 Ga0207650_10378751 3300025925 Bacteria 1168
437 Ga0207659_10010401 3300025926 Bacteria 5848
438 Ga0207659_10025052 3300025926 Bacteria 4005
439 Ga0207687_10006270 3300025927 Bacteria 7868
440 Ga0207700_10000120 3300025928 Bacteria 46325
441 Ga0207700_10042935 3300025928 Bacteria 3318
442 Ga0207700_10080174 3300025928 Bacteria 2545
443 Ga0207700_10083234 3300025928 Bacteria 2504
444 Ga0207664_10002996 3300025929 Bacteria 11219
445 Ga0207664_10038069 3300025929 Bacteria 3727
446 Ga0207664_10076114 3300025929 Bacteria 2715
447 Ga0207644_10003463 3300025931 Bacteria 10198
448 Ga0207644_10005068 3300025931 Bacteria 8599
449 Ga0207644_10096470 3300025931 Bacteria 2213
450 Ga0207644_10109199 3300025931 Bacteria 2090
451 Ga0207644_10183705 3300025931 Bacteria 1640
452 Ga0207644_10275831 3300025931 Bacteria 1349
453 Ga0207690_10001354 3300025932 Bacteria 15380
454 Ga0207690_10004135 3300025932 Bacteria 8575
455 Ga0207690_10073730 3300025932 Bacteria 2362
456 Ga0207690_10262516 3300025932 Bacteria 1338
457 Ga0207690_10307624 3300025932 Bacteria 1242
458 Ga0207690_10372730 3300025932 Bacteria 1133
459 Ga0207706_10000133 3300025933 Bacteria 80935
460 Ga0207706_10012488 3300025933 Bacteria 7739
461 Ga0207706_10144761 3300025933 Bacteria 2091
462 Ga0207706_10203781 3300025933 Bacteria 1735
463 Ga0207706_10347311 3300025933 Bacteria 1290
464 Ga0207686_10003125 3300025934 Bacteria 8907
465 Ga0207686_10117516 3300025934 Bacteria 1804
466 Ga0207670_10011023 3300025936 Bacteria 5228
467 Ga0207669_10007186 3300025937 Bacteria 5128
468 Ga0207669_10021653 3300025937 Bacteria 3399
469 Ga0207669_10062882 3300025937 Bacteria 2288
470 Ga0207669_10159484 3300025937 Bacteria 1591
471 Ga0207669_10160125 3300025937 Bacteria 1589
472 Ga0207704_10256256 3300025938 Bacteria 1316
473 Ga0207704_10308065 3300025938 Bacteria 1216
474 Ga0207665_10053124 3300025939 Bacteria 2731
475 Ga0207665_10159377 3300025939 Bacteria 1622
476 Ga0207691_10000170 3300025940 Bacteria 60463
477 Ga0207691_10000282 3300025940 Bacteria 50196
478 Ga0207691_10001454 3300025940 Bacteria 23591
479 Ga0207691_10079879 3300025940 Bacteria 2943
480 Ga0207691_10107741 3300025940 Bacteria 2480
481 Ga0207711_10000116 3300025941 Bacteria 83390
482 Ga0207711_10016910 3300025941 Bacteria 6059
483 Ga0207711_10053481 3300025941 Bacteria 3463
484 Ga0207711_10079496 3300025941 Bacteria 2862
485 Ga0207711_10162236 3300025941 Bacteria 2024
486 Ga0207711_10330269 3300025941 Bacteria 1410
487 Ga0207689_10010112 3300025942 Bacteria 8136
488 Ga0207689_10019564 3300025942 Bacteria 5705
489 Ga0207689_10021123 3300025942 Bacteria 5472
490 Ga0207689_10038725 3300025942 Bacteria 3947
491 Ga0207689_10049651 3300025942 Bacteria 3461
492 Ga0207661_10012274 3300025944 Bacteria 6222
493 Ga0207661_10370111 3300025944 Bacteria 1295
494 Ga0207679_10003266 3300025945 Bacteria 10015
495 Ga0207679_10005340 3300025945 Bacteria 8055
496 Ga0207679_10011079 3300025945 Bacteria 5822
497 Ga0207679_10090603 3300025945 Bacteria 2364
498 Ga0207679_10119664 3300025945 Bacteria 2094
499 Ga0207679_10128937 3300025945 Bacteria 2026
500 Ga0207667_10000842 3300025949 Bacteria 39549
501 Ga0207667_10005196 3300025949 Bacteria 15889
502 Ga0207667_10010385 3300025949 Bacteria 10882
503 Ga0207667_10051082 3300025949 Bacteria 4359
504 Ga0207667_10073498 3300025949 Bacteria 3552
505 Ga0207667_10114040 3300025949 Bacteria 2786
506 Ga0207667_10170799 3300025949 Bacteria 2235
507 Ga0207667_10269321 3300025949 Bacteria 1741
508 Ga0207667_10270212 3300025949 Bacteria 1738
509 Ga0207651_10008341 3300025960 Bacteria 5590
510 Ga0207651_10024981 3300025960 Bacteria 3706
511 Ga0207651_10063177 3300025960 Bacteria 2584
512 Ga0207651_10063771 3300025960 Bacteria 2575
513 Ga0207651_10173617 3300025960 Bacteria 1702
514 Ga0207712_10112632 3300025961 Bacteria 2043
515 Ga0207668_10006170 3300025972 Bacteria 7070
516 Ga0207668_10045956 3300025972 Bacteria 2980
517 Ga0207668_10303046 3300025972 Bacteria 1319
518 Ga0207668_10433410 3300025972 Bacteria 1118
519 Ga0207640_10037178 3300025981 Bacteria 3061
520 Ga0207640_10053421 3300025981 Bacteria 2637
521 Ga0207640_10301188 3300025981 Bacteria 1268
522 Ga0207658_10003932 3300025986 Bacteria 10446
523 Ga0207658_10019214 3300025986 Bacteria 4725
524 Ga0207658_10025921 3300025986 Bacteria 4107
525 Ga0207658_10032868 3300025986 Bacteria 3696
526 Ga0207658_10105264 3300025986 Bacteria 2218
527 Ga0207658_10395095 3300025986 Bacteria 1214
528 Ga0207677_10000188 3300026023 Bacteria 49751
529 Ga0207677_10030318 3300026023 Bacteria 3450
530 Ga0207677_10128029 3300026023 Bacteria 1922
531 Ga0207677_10290777 3300026023 Bacteria 1346
532 Ga0207703_10000806 3300026035 Bacteria 30873
533 Ga0207703_10048664 3300026035 Bacteria 3423
534 Ga0207703_10084450 3300026035 Bacteria 2655
535 Ga0207703_10265382 3300026035 Bacteria 1553
536 Ga0207703_10319164 3300026035 Bacteria 1422
537 Ga0207639_10006373 3300026041 Bacteria 8016
538 Ga0207639_10042654 3300026041 Bacteria 3401
539 Ga0207639_10244849 3300026041 Bacteria 1561
540 Ga0207678_10002750 3300026067 Bacteria 15930
541 Ga0207678_10005798 3300026067 Bacteria 11009
542 Ga0207678_10009500 3300026067 Bacteria 8556
543 Ga0207708_10007278 3300026075 Bacteria 8183
544 Ga0207708_10019956 3300026075 Bacteria 5053
545 Ga0207702_10005844 3300026078 Bacteria 10700
546 Ga0207702_10010663 3300026078 Bacteria 7678
547 Ga0207702_10014222 3300026078 Bacteria 6609
548 Ga0207702_10089675 3300026078 Bacteria 2689
549 Ga0207702_10293779 3300026078 Bacteria 1540
550 Ga0207641_10004545 3300026088 Bacteria 11992
551 Ga0207641_10004745 3300026088 Bacteria 11717
552 Ga0207641_10020334 3300026088 Bacteria 5452
553 Ga0207641_10022283 3300026088 Bacteria 5213
554 Ga0207641_10233487 3300026088 Bacteria 1710
555 Ga0207641_10374249 3300026088 Bacteria 1362
556 Ga0207648_10000203 3300026089 Bacteria 63192
557 Ga0207648_10000605 3300026089 Bacteria 40285
558 Ga0207648_10007681 3300026089 Bacteria 10551
559 Ga0207648_10014175 3300026089 Bacteria 7371
560 Ga0207648_10063485 3300026089 Bacteria 3219
561 Ga0207648_10082574 3300026089 Bacteria 2802
562 Ga0207676_10000230 3300026095 Bacteria 48620
563 Ga0207676_10021161 3300026095 Bacteria 4770
564 Ga0207676_10025352 3300026095 Bacteria 4399
565 Ga0207676_10037003 3300026095 Bacteria 3716
566 Ga0207676_10145613 3300026095 Bacteria 2034
567 Ga0207676_10331704 3300026095 Bacteria 1400
568 Ga0207674_10000182 3300026116 Bacteria 77228
569 Ga0207674_10001017 3300026116 Bacteria 36653
570 Ga0207674_10066702 3300026116 Bacteria 3624
571 Ga0207674_10101644 3300026116 Bacteria 2855
572 Ga0207674_10383496 3300026116 Bacteria 1359
573 Ga0207675_100004007 3300026118 Bacteria 14287
574 Ga0207675_100023790 3300026118 Bacteria 5700
575 Ga0207675_100042323 3300026118 Bacteria 4252
576 Ga0207675_100244321 3300026118 Bacteria 1735
577 Ga0207675_100505670 3300026118 Bacteria 1203
578 Ga0207683_10000005 3300026121 Bacteria 187889
579 Ga0207683_10000428 3300026121 Bacteria 38922
580 Ga0207683_10001896 3300026121 Bacteria 18497
581 Ga0207683_10016709 3300026121 Bacteria 6244
582 Ga0207683_10036191 3300026121 Bacteria 4297
583 Ga0207698_10012386 3300026142 Bacteria 5578
584 Ga0207698_10033201 3300026142 Bacteria 3748
585 Ga0207698_10297203 3300026142 Bacteria 1501
586 Ga0207698_10398588 3300026142 Bacteria 1314
587 Ga0209995_1002546 3300027471 Bacteria 2885
588 Ga0209999_1022905 3300027543 Bacteria 1150
589 Ga0210002_1003431 3300027617 Bacteria 2333
590 Ga0209983_1008024 3300027665 Bacteria 2159
591 Ga0209983_1014414 3300027665 Bacteria 1629
592 Ga0209966_1002402 3300027695 Bacteria 3122
593 Ga0209974_10000182 3300027876 Bacteria 19774
594 Ga0268266_10002847 3300028379 Bacteria 18027
595 Ga0268266_10014515 3300028379 Bacteria 6771
596 Ga0268266_10041686 3300028379 Bacteria 3918
597 Ga0268266_10129956 3300028379 Bacteria 2252
598 Ga0268266_10305396 3300028379 Bacteria 1485
599 Ga0268265_10051850 3300028380 Bacteria 3099
600 Ga0268264_10003573 3300028381 Bacteria 13392
601 Ga0268264_10004111 3300028381 Bacteria 12447
602 Ga0268264_10018697 3300028381 Bacteria 5665
603 Ga0268264_10144070 3300028381 Bacteria 2128
604 Ga0265330_10002416 3300031235 Bacteria 10192
605 Ga0265332_10001887 3300031238 Bacteria 11124
606 Ga0265332_10005275 3300031238 Bacteria 5977
607 Ga0265328_10072397 3300031239 Bacteria 1267
608 Ga0265325_10008462 3300031241 Bacteria 6070
609 Ga0265329_10007419 3300031242 Bacteria 4242
610 Ga0265340_10118569 3300031247 Bacteria 1219
611 Ga0265339_10078477 3300031249 Bacteria 1748
612 Ga0265327_10008924 3300031251 Bacteria 7355
613 Ga0265316_10005364 3300031344 Bacteria 12477
614 Ga0265316_10006826 3300031344 Bacteria 10852
615 Ga0265316_10038818 3300031344 Bacteria 3831
616 Ga0265316_10049415 3300031344 Bacteria 3314
617 Ga0307408_100061939 3300031548 Bacteria 2732
618 Ga0307508_10074857 3300031616 Bacteria 2963
619 Ga0265314_10004158 3300031711 Bacteria 13616
620 Ga0316576_10032447 3300031727 Unclassified 3711
621 Ga0307410_10061384 3300031852 Bacteria 2572
622 Ga0307406_10002618 3300031901 Bacteria 9802
623 Ga0307407_10018772 3300031903 Bacteria 3506
624 Ga0307412_10003937 3300031911 Bacteria 8274
625 Ga0307416_100003856 3300032002 Bacteria 8921
626 Ga0307411_10262094 3300032005 Bacteria 1365
627 Ga0316580_10008663 3300032139 Unclassified 3051
628 Ga0373944_0010957 3300035089 Bacteria 2479
629 Ga0373923_0003154 3300035111 Bacteria 5240
630 Ga0373954_0010837 3300035118 Bacteria 4030
631 Ga0373956_0120799 3300035119 Bacteria 1223
632 Ga0373957_0012504 3300035120 Bacteria 2860
633 Ga0373943_0023834 3300035170 Bacteria 2848
634 Ga0373943_0064831 3300035170 Bacteria 1835
635 Ga0373955_0032052 3300035172 Bacteria 2756
636 Ga0373955_0056781 3300035172 Bacteria 2148
637 Ga0316574_0012312 3300035398 Bacteria 4891
638 Ga0373931_0047422 3300035691 Bacteria 2274
639 Ga0373931_0133733 3300035691 Bacteria 1430
640 Ga0373935_0014086 3300035692 Bacteria 4828
641 Ga0373935_0154971 3300035692 Bacteria 1557
642 Ga0373935_0217193 3300035692 Bacteria 1327
643 Ga0373927_0028723 3300035695 Bacteria 3628
644 Ga0373933_0015768 3300035724 Bacteria 4215
645 Ga0373947_0024324 3300035725 Bacteria 3529
646 Ga0373947_0184992 3300035725 Bacteria 1358
647 Ga0373937_0011991 3300036401 Bacteria 7609
648 Ga0373937_0050883 3300036401 Bacteria 3796
649 Ga0373937_0062330 3300036401 Bacteria 3428
650 Ga0373937_0248276 3300036401 Bacteria 1677
651 Ga0316582_0006939 3300036647 Bacteria 5992
652 Ga0373925_0049596 3300037068 Bacteria 3129
653 Ga0395900_0036984 3300037418 Bacteria 5033
654 Ga0395898_0238826 3300037466 Bacteria 1733
655 Ga0395901_0191131 3300038443 Bacteria 2147
656 Ga0451853_2406494 3300041512 Bacteria 1924
657 Ga0451577_0010511 3300042876 Bacteria 8838
658 Ga0453683_0190070 3300044673 Bacteria 1303
659 Ga0466963_0104459 3300044694 Bacteria 1941
660 Ga0453684_0001170 3300044712 Bacteria 81366
661 Ga0453684_0023499 3300044712 Bacteria 9071
662 Ga0453684_0291070 3300044712 Bacteria 1860
663 Ga0451576_0001376 3300045051 Bacteria 41779
664 Ga0451576_0032733 3300045051 Bacteria 5530
665 Ga0466958_0188359 3300045836 Bacteria 1311
666 Ga0466967_0336022 3300045976 Bacteria 1460
667 Ga0495629_0032236 3300046459 Bacteria 3710
668 Ga0495580_0078401 3300046472 Bacteria 2304
669 Ga0495580_0112981 3300046472 Bacteria 1886
670 Ga0495582_0038857 3300046473 Bacteria 2619
671 Ga0495664_0014729 3300046477 Bacteria 4437
672 Ga0495642_0065953 3300046528 Bacteria 1508
673 Ga0495645_0105370 3300046543 Bacteria 2001
674 Ga0495635_0064143 3300046663 Bacteria 2522
675 Ga0495647_0005212 3300046681 Bacteria 4258
676 Ga0495658_0124126 3300046683 Bacteria 1565
677 Ga0495613_0025522 3300046689 Bacteria 4403
678 Ga0495581_0004852 3300047315 Bacteria 7781
679 Ga0495684_0012214 3300047471 Bacteria 6626
680 Ga0495684_0143901 3300047471 Bacteria 1786
681 Ga0495684_0297646 3300047471 Bacteria 1160
682 Ga0496100_0025658 3300048903 Bacteria 3606
683 Ga0496101_0069996 3300048904 Bacteria 2568
684 Ga0496101_0133793 3300048904 Bacteria 1885
685 Ga0496102_0068728 3300048905 Bacteria 3251
686 Ga0496102_0185283 3300048905 Bacteria 1962
687 Ga0496103_0062904 3300048906 Bacteria 2311
688 Ga0496104_0024227 3300048907 Bacteria 5582
689 Ga0496104_0217342 3300048907 Bacteria 1823
690 Ga0496105_0016623 3300048908 Bacteria 5875
691 Ga0496106_0000821 3300048909 Bacteria 22535
692 Ga0496106_0325054 3300048909 Bacteria 1235
693 Ga0496107_0097488 3300048910 Bacteria 2153
694 Ga0496107_0173569 3300048910 Bacteria 1600
695 Ga0496108_0017349 3300048911 Bacteria 5889
696 Ga0496108_0226665 3300048911 Bacteria 1624
697 Ga0496109_0034784 3300048912 Bacteria 4541
698 Ga0496109_0038858 3300048912 Bacteria 4305
699 Ga0496109_0056893 3300048912 Bacteria 3568
700 Ga0496109_0487298 3300048912 Bacteria 1164
701 Ga0496110_0082967 3300048913 Bacteria 2859
702 Ga0496112_0031287 3300048915 Bacteria 5160
703 Ga0496113_0519905 3300048916 Bacteria 955
704 Ga0496114_0142042 3300048917 Bacteria 2079
705 nmdc:mga0k408_72027_c1 3300050493 Bacteria 2018
706 nmdc:mga05p37_57695_c1 3300050507 Bacteria 4781
707 nmdc:mga0n895_182014_c1 3300050512 Bacteria 2133
708 nmdc:mga0n895_94823_c1 3300050512 Bacteria 2988
709 nmdc:mga0rr50_129280_c1 3300050513 Bacteria 2020
710 nmdc:mga0rr50_316546_c1 3300050513 Bacteria 1307
711 nmdc:mga0rr50_442489_c1 3300050513 Bacteria 1101
712 nmdc:mga08x19_26694_c1 3300050514 Bacteria 3604
713 nmdc:mga08x19_46304_c1 3300050514 Bacteria 2781
714 nmdc:mga0a205_180331_c1 3300050515 Bacteria 2006
715 nmdc:mga0a205_9988_c1 3300050515 Bacteria 8710
716 Ga0495601_0207454 3300053077 Bacteria 1280
717 Ga0495612_0057663 3300053078 Bacteria 1604
718 Ga0495619_0044721 3300053085 Bacteria 2907
719 Ga0495619_0049784 3300053085 Bacteria 2764
720 Ga0495619_0095902 3300053085 Bacteria 2013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027617 Ga0210002_1003431 Ga0210002_10034312 236
2 3300035692 Ga0373935_0014086 Ga0373935_0014086_3324_4259 237
3 3300013296 Ga0157374_10424998 Ga0157374_104249981 239
4 3300048916 Ga0496113_0519905 Ga0496113_0519905_12_848 239
5 3300006844 Ga0075428_100488200 Ga0075428_1004882001 241
6 3300031616 Ga0307508_10074857 Ga0307508_100748572 242
7 3300005329 Ga0070683_100001287 Ga0070683_10000128710 243
8 3300005339 Ga0070660_100005619 Ga0070660_1000056197 243
9 3300005344 Ga0070661_100007248 Ga0070661_1000072484 243
10 3300005366 Ga0070659_100029207 Ga0070659_1000292072 243
11 3300005435 Ga0070714_100005782 Ga0070714_1000057822 243
12 3300005436 Ga0070713_100137683 Ga0070713_1001376832 243
13 3300005458 Ga0070681_10006907 Ga0070681_100069073 243
14 3300005535 Ga0070684_100001168 Ga0070684_1000011688 243
15 3300005539 Ga0068853_100016992 Ga0068853_1000169927 243
16 3300005563 Ga0068855_100030425 Ga0068855_1000304254 243
17 3300005564 Ga0070664_100000572 Ga0070664_10000057223 243
18 3300005577 Ga0068857_100000465 Ga0068857_1000004654 243
19 3300005578 Ga0068854_100008411 Ga0068854_1000084116 243
20 3300005614 Ga0068856_100000962 Ga0068856_10000096220 243
21 3300009093 Ga0105240_10010941 Ga0105240_100109413 243
22 3300009174 Ga0105241_10367499 Ga0105241_103674992 243
23 3300009551 Ga0105238_10000817 Ga0105238_100008178 243
24 3300013105 Ga0157369_10009759 Ga0157369_100097599 243
25 3300013307 Ga0157372_10009688 Ga0157372_100096882 243
26 3300025911 Ga0207654_10175524 Ga0207654_101755242 243
27 3300025912 Ga0207707_10048067 Ga0207707_100480673 243
28 3300025913 Ga0207695_10019928 Ga0207695_100199283 243
29 3300025919 Ga0207657_10015277 Ga0207657_100152774 243
30 3300025920 Ga0207649_10011058 Ga0207649_100110584 243
31 3300025924 Ga0207694_10002353 Ga0207694_1000235316 243
32 3300025929 Ga0207664_10038069 Ga0207664_100380692 243
33 3300025932 Ga0207690_10004135 Ga0207690_100041356 243
34 3300025944 Ga0207661_10012274 Ga0207661_100122743 243
35 3300025945 Ga0207679_10003266 Ga0207679_100032668 243
36 3300025949 Ga0207667_10000842 Ga0207667_1000084215 243
37 3300025981 Ga0207640_10037178 Ga0207640_100371784 243
38 3300026041 Ga0207639_10042654 Ga0207639_100426542 243
39 3300026078 Ga0207702_10010663 Ga0207702_100106635 243
40 3300026116 Ga0207674_10000182 Ga0207674_1000018251 243
41 3300031344 Ga0265316_10038818 Ga0265316_100388184 243
42 3300045051 Ga0451576_0001376 Ga0451576_0001376_29532_30452 243
43 3300005366 Ga0070659_100248779 Ga0070659_1002487792 244
44 3300005436 Ga0070713_100000039 Ga0070713_10000003975 244
45 3300006175 Ga0070712_100178923 Ga0070712_1001789232 244
46 3300013307 Ga0157372_10161335 Ga0157372_101613352 244
47 3300025928 Ga0207700_10000120 Ga0207700_1000012039 244
48 3300025932 Ga0207690_10307624 Ga0207690_103076242 244
49 3300025945 Ga0207679_10011079 Ga0207679_100110793 244
50 3300031344 Ga0265316_10006826 Ga0265316_1000682610 244
51 3300031344 Ga0265316_10049415 Ga0265316_100494152 244
52 3300045051 Ga0451576_0032733 Ga0451576_0032733_2753_3643 244
53 3300027665 Ga0209983_1008024 Ga0209983_10080242 245
54 3300042876 Ga0451577_0010511 Ga0451577_0010511_1023_1913 245
55 3300005518 Ga0070699_100173937 Ga0070699_1001739372 246
56 3300005530 Ga0070679_100262724 Ga0070679_1002627242 246
57 3300005546 Ga0070696_100105940 Ga0070696_1001059402 246
58 3300009174 Ga0105241_10285681 Ga0105241_102856811 246
59 3300025917 Ga0207660_10014493 Ga0207660_100144933 246
60 3300025981 Ga0207640_10053421 Ga0207640_100534212 246
61 3300044712 Ga0453684_0001170 Ga0453684_0001170_42859_43761 246
62 3300048905 Ga0496102_0068728 Ga0496102_0068728_1505_2422 246
63 3300005440 Ga0070705_100087597 Ga0070705_1000875972 247
64 3300005539 Ga0068853_100343645 Ga0068853_1003436452 247
65 3300005841 Ga0068863_100528265 Ga0068863_1005282652 247
66 3300005843 Ga0068860_100023819 Ga0068860_1000238197 247
67 3300013306 Ga0163162_10496920 Ga0163162_104969202 247
68 3300044712 Ga0453684_0023499 Ga0453684_0023499_5799_6683 247
69 3300005338 Ga0068868_100065551 Ga0068868_1000655512 248
70 3300005344 Ga0070661_100331356 Ga0070661_1003313562 248
71 3300025933 Ga0207706_10144761 Ga0207706_101447612 248
72 3300031727 Ga0316576_10032447 Ga0316576_100324471 248
73 3300032139 Ga0316580_10008663 Ga0316580_100086635 248
74 3300035398 Ga0316574_0012312 Ga0316574_0012312_1665_2519 248
75 3300036647 Ga0316582_0006939 Ga0316582_0006939_1866_2720 248
76 3300044673 Ga0453683_0190070 Ga0453683_0190070_338_1186 249
77 3300048911 Ga0496108_0226665 Ga0496108_0226665_234_1130 249
78 3300048912 Ga0496109_0487298 Ga0496109_0487298_202_1098 249
79 3300036401 Ga0373937_0248276 Ga0373937_0248276_797_1666 250
80 3300005335 Ga0070666_10041436 Ga0070666_100414363 251
81 3300005344 Ga0070661_100254188 Ga0070661_1002541881 251
82 3300005355 Ga0070671_100236187 Ga0070671_1002361872 251
83 3300005364 Ga0070673_100012948 Ga0070673_1000129483 251
84 3300005564 Ga0070664_100101744 Ga0070664_1001017442 251
85 3300025920 Ga0207649_10060934 Ga0207649_100609343 251
86 3300025931 Ga0207644_10275831 Ga0207644_102758312 251
87 3300025933 Ga0207706_10347311 Ga0207706_103473111 251
88 3300025945 Ga0207679_10128937 Ga0207679_101289372 251
89 3300026142 Ga0207698_10398588 Ga0207698_103985882 251
90 3300035725 Ga0373947_0184992 Ga0373947_0184992_321_1244 251
91 3300005539 Ga0068853_100247661 Ga0068853_1002476612 252
92 3300009147 Ga0114129_10064248 Ga0114129_100642484 252
93 3300031238 Ga0265332_10005275 Ga0265332_100052758 252
94 3300035172 Ga0373955_0032052 Ga0373955_0032052_1423_2313 252
95 3300036401 Ga0373937_0062330 Ga0373937_0062330_646_1539 252
96 3300046683 Ga0495658_0124126 Ga0495658_0124126_550_1524 252
97 3300050507 nmdc:mga05p37_57695_c1 nmdc:mga05p37_57695_c1_1337_2266 252
98 3300050512 nmdc:mga0n895_94823_c1 nmdc:mga0n895_94823_c1_1898_2779 252
99 3300053085 Ga0495619_0049784 Ga0495619_0049784_1385_2278 252
100 3300005366 Ga0070659_100182219 Ga0070659_1001822191 253
101 3300005563 Ga0068855_100183612 Ga0068855_1001836122 253
102 3300005564 Ga0070664_100136900 Ga0070664_1001369002 253
103 3300006237 Ga0097621_100127121 Ga0097621_1001271212 253
104 3300013105 Ga0157369_10112711 Ga0157369_101127114 253
105 3300013296 Ga0157374_10114068 Ga0157374_101140682 253
106 3300025932 Ga0207690_10073730 Ga0207690_100737302 253
107 3300025945 Ga0207679_10119664 Ga0207679_101196641 253
108 3300025949 Ga0207667_10170799 Ga0207667_101707992 253
109 3300026041 Ga0207639_10244849 Ga0207639_102448492 253
110 3300041512 Ga0451853_2406494 Ga0451853_2406494_788_1681 253
111 3300044694 Ga0466963_0104459 Ga0466963_0104459_76_966 254
112 3300045976 Ga0466967_0336022 Ga0466967_0336022_512_1402 254
113 iso_pu_bacteria 2526164512 2526213365 254
114 3300006195 Ga0075366_10009362 Ga0075366_100093627 255
115 3300013307 Ga0157372_10646756 Ga0157372_106467562 255
116 3300050493 nmdc:mga0k408_72027_c1 nmdc:mga0k408_72027_c1_794_1684 255
117 3300005328 Ga0070676_10006266 Ga0070676_100062664 256
118 3300005331 Ga0070670_100011090 Ga0070670_1000110908 256
119 3300005344 Ga0070661_100010193 Ga0070661_1000101931 256
120 3300005364 Ga0070673_100049248 Ga0070673_1000492482 256
121 3300005366 Ga0070659_100005062 Ga0070659_1000050623 256
122 3300005366 Ga0070659_100163033 Ga0070659_1001630332 256
123 3300005457 Ga0070662_100000554 Ga0070662_10000055412 256
124 3300005458 Ga0070681_10017021 Ga0070681_100170212 256
125 3300005539 Ga0068853_100013365 Ga0068853_1000133657 256
126 3300005563 Ga0068855_100030945 Ga0068855_1000309456 256
127 3300005564 Ga0070664_100029911 Ga0070664_1000299112 256
128 3300005564 Ga0070664_100132311 Ga0070664_1001323112 256
129 3300005578 Ga0068854_100100406 Ga0068854_1001004062 256
130 3300005614 Ga0068856_100001205 Ga0068856_1000012059 256
131 3300005614 Ga0068856_100003469 Ga0068856_1000034696 256
132 3300005616 Ga0068852_100022082 Ga0068852_1000220825 256
133 3300013100 Ga0157373_10005680 Ga0157373_100056804 256
134 3300013307 Ga0157372_10002230 Ga0157372_100022308 256
135 3300013307 Ga0157372_10039603 Ga0157372_100396032 256
136 3300025315 Ga0207697_10034310 Ga0207697_100343102 256
137 3300025907 Ga0207645_10010911 Ga0207645_100109113 256
138 3300025912 Ga0207707_10024845 Ga0207707_100248452 256
139 3300025912 Ga0207707_10103171 Ga0207707_101031712 256
140 3300025917 Ga0207660_10157034 Ga0207660_101570342 256
141 3300025920 Ga0207649_10039155 Ga0207649_100391551 256
142 3300025921 Ga0207652_10132418 Ga0207652_101324181 256
143 3300025932 Ga0207690_10001354 Ga0207690_1000135415 256
144 3300025932 Ga0207690_10262516 Ga0207690_102625162 256
145 3300025933 Ga0207706_10000133 Ga0207706_1000013352 256
146 3300025945 Ga0207679_10090603 Ga0207679_100906031 256
147 3300025949 Ga0207667_10114040 Ga0207667_101140401 256
148 3300025960 Ga0207651_10063177 Ga0207651_100631772 256
149 3300026078 Ga0207702_10005844 Ga0207702_1000584410 256
150 3300026116 Ga0207674_10383496 Ga0207674_103834962 256
151 3300026142 Ga0207698_10012386 Ga0207698_100123863 256
152 3300031548 Ga0307408_100061939 Ga0307408_1000619393 256
153 3300031852 Ga0307410_10061384 Ga0307410_100613841 256
154 3300031901 Ga0307406_10002618 Ga0307406_100026184 256
155 3300031903 Ga0307407_10018772 Ga0307407_100187724 256
156 3300031911 Ga0307412_10003937 Ga0307412_100039373 256
157 3300032002 Ga0307416_100003856 Ga0307416_1000038568 256
158 3300032005 Ga0307411_10262094 Ga0307411_102620942 256
159 3300037418 Ga0395900_0036984 Ga0395900_0036984_1190_2083 256
160 3300037466 Ga0395898_0238826 Ga0395898_0238826_532_1425 256
161 3300048909 Ga0496106_0000821 Ga0496106_0000821_16521_17414 256
162 3300005339 Ga0070660_100001693 Ga0070660_1000016937 257
163 3300005355 Ga0070671_100050634 Ga0070671_1000506342 257
164 3300005455 Ga0070663_100060337 Ga0070663_1000603374 257
165 3300005563 Ga0068855_100007680 Ga0068855_1000076804 257
166 3300005564 Ga0070664_100004095 Ga0070664_1000040954 257
167 3300013105 Ga0157369_10095343 Ga0157369_100953432 257
168 3300025919 Ga0207657_10003687 Ga0207657_100036873 257
169 3300025931 Ga0207644_10183705 Ga0207644_101837052 257
170 3300025945 Ga0207679_10005340 Ga0207679_100053409 257
171 3300025949 Ga0207667_10005196 Ga0207667_100051968 257
172 3300027543 Ga0209999_1022905 Ga0209999_10229052 257
173 3300035691 Ga0373931_0047422 Ga0373931_0047422_456_1349 257
174 3300048904 Ga0496101_0133793 Ga0496101_0133793_243_1136 257
175 3300005344 Ga0070661_100116454 Ga0070661_1001164542 258
176 3300005353 Ga0070669_100051735 Ga0070669_1000517353 258
177 3300005354 Ga0070675_100026358 Ga0070675_1000263584 258
178 3300005355 Ga0070671_100118520 Ga0070671_1001185202 258
179 3300005367 Ga0070667_100027551 Ga0070667_1000275513 258
180 3300005434 Ga0070709_10017844 Ga0070709_100178442 258
181 3300005436 Ga0070713_100170134 Ga0070713_1001701342 258
182 3300005439 Ga0070711_100043761 Ga0070711_1000437615 258
183 3300005459 Ga0068867_100049466 Ga0068867_1000494662 258
184 3300005518 Ga0070699_100050548 Ga0070699_1000505483 258
185 3300005530 Ga0070679_100274174 Ga0070679_1002741742 258
186 3300005543 Ga0070672_100000853 Ga0070672_10000085315 258
187 3300005543 Ga0070672_100021220 Ga0070672_1000212206 258
188 3300005546 Ga0070696_100002477 Ga0070696_1000024776 258
189 3300005563 Ga0068855_100328741 Ga0068855_1003287412 258
190 3300005578 Ga0068854_100311438 Ga0068854_1003114382 258
191 3300005618 Ga0068864_100082286 Ga0068864_1000822863 258
192 3300005719 Ga0068861_100024274 Ga0068861_1000242742 258
193 3300005843 Ga0068860_100005292 Ga0068860_1000052928 258
194 3300009177 Ga0105248_10019862 Ga0105248_100198629 258
195 3300009177 Ga0105248_10047229 Ga0105248_100472296 258
196 3300013105 Ga0157369_10445662 Ga0157369_104456621 258
197 3300013296 Ga0157374_10722622 Ga0157374_107226221 258
198 3300013306 Ga0163162_10326385 Ga0163162_103263852 258
199 3300013308 Ga0157375_10006293 Ga0157375_100062933 258
200 3300014969 Ga0157376_10403759 Ga0157376_104037592 258
201 3300025893 Ga0207682_10029387 Ga0207682_100293872 258
202 3300025903 Ga0207680_10064584 Ga0207680_100645843 258
203 3300025913 Ga0207695_10023248 Ga0207695_100232487 258
204 3300025923 Ga0207681_10026284 Ga0207681_100262842 258
205 3300025925 Ga0207650_10149330 Ga0207650_101493302 258
206 3300025928 Ga0207700_10083234 Ga0207700_100832342 258
207 3300025929 Ga0207664_10076114 Ga0207664_100761142 258
208 3300025931 Ga0207644_10096470 Ga0207644_100964702 258
209 3300025940 Ga0207691_10001454 Ga0207691_100014547 258
210 3300025940 Ga0207691_10079879 Ga0207691_100798795 258
211 3300025941 Ga0207711_10016910 Ga0207711_100169108 258
212 3300025941 Ga0207711_10162236 Ga0207711_101622362 258
213 3300025949 Ga0207667_10073498 Ga0207667_100734982 258
214 3300025960 Ga0207651_10024981 Ga0207651_100249811 258
215 3300025960 Ga0207651_10173617 Ga0207651_101736172 258
216 3300025972 Ga0207668_10433410 Ga0207668_104334101 258
217 3300025986 Ga0207658_10019214 Ga0207658_100192144 258
218 3300026095 Ga0207676_10037003 Ga0207676_100370034 258
219 3300026118 Ga0207675_100023790 Ga0207675_1000237905 258
220 3300027471 Ga0209995_1002546 Ga0209995_10025462 258
221 3300027665 Ga0209983_1014414 Ga0209983_10144142 258
222 3300027695 Ga0209966_1002402 Ga0209966_10024022 258
223 3300027876 Ga0209974_10000182 Ga0209974_100001827 258
224 3300028381 Ga0268264_10004111 Ga0268264_100041118 258
225 3300044712 Ga0453684_0291070 Ga0453684_0291070_506_1399 258
226 3300005328 Ga0070676_10000862 Ga0070676_1000086214 259
227 3300005328 Ga0070676_10001774 Ga0070676_100017747 259
228 3300005333 Ga0070677_10000268 Ga0070677_1000026812 259
229 3300005334 Ga0068869_100158086 Ga0068869_1001580862 259
230 3300005335 Ga0070666_10000839 Ga0070666_1000083916 259
231 3300005335 Ga0070666_10005531 Ga0070666_100055313 259
232 3300005338 Ga0068868_100008483 Ga0068868_1000084833 259
233 3300005341 Ga0070691_10010280 Ga0070691_100102804 259
234 3300005347 Ga0070668_100003003 Ga0070668_1000030033 259
235 3300005347 Ga0070668_100008937 Ga0070668_1000089372 259
236 3300005353 Ga0070669_100001156 Ga0070669_10000115613 259
237 3300005354 Ga0070675_100006504 Ga0070675_1000065046 259
238 3300005354 Ga0070675_100047016 Ga0070675_1000470163 259
239 3300005355 Ga0070671_100031187 Ga0070671_1000311873 259
240 3300005355 Ga0070671_100046272 Ga0070671_1000462724 259
241 3300005356 Ga0070674_100001276 Ga0070674_10000127610 259
242 3300005356 Ga0070674_100074111 Ga0070674_1000741112 259
243 3300005364 Ga0070673_100001215 Ga0070673_10000121513 259
244 3300005364 Ga0070673_100002411 Ga0070673_1000024118 259
245 3300005365 Ga0070688_100023500 Ga0070688_1000235003 259
246 3300005367 Ga0070667_100003294 Ga0070667_1000032945 259
247 3300005367 Ga0070667_100005512 Ga0070667_10000551211 259
248 3300005455 Ga0070663_100027376 Ga0070663_1000273763 259
249 3300005455 Ga0070663_100475851 Ga0070663_1004758511 259
250 3300005456 Ga0070678_100000169 Ga0070678_10000016917 259
251 3300005456 Ga0070678_100003566 Ga0070678_1000035663 259
252 3300005459 Ga0068867_100001033 Ga0068867_1000010334 259
253 3300005459 Ga0068867_100002460 Ga0068867_1000024603 259
254 3300005466 Ga0070685_10046834 Ga0070685_100468342 259
255 3300005539 Ga0068853_100009737 Ga0068853_1000097376 259
256 3300005543 Ga0070672_100005197 Ga0070672_1000051973 259
257 3300005543 Ga0070672_100072600 Ga0070672_1000726002 259
258 3300005548 Ga0070665_100001395 Ga0070665_10000139529 259
259 3300005548 Ga0070665_100003175 Ga0070665_1000031758 259
260 3300005578 Ga0068854_100045389 Ga0068854_1000453893 259
261 3300005615 Ga0070702_100242044 Ga0070702_1002420442 259
262 3300005616 Ga0068852_100059049 Ga0068852_1000590493 259
263 3300005617 Ga0068859_100028321 Ga0068859_1000283215 259
264 3300005617 Ga0068859_100159151 Ga0068859_1001591513 259
265 3300005618 Ga0068864_100007835 Ga0068864_1000078353 259
266 3300005618 Ga0068864_100036849 Ga0068864_1000368492 259
267 3300005719 Ga0068861_100218085 Ga0068861_1002180852 259
268 3300005841 Ga0068863_100240337 Ga0068863_1002403372 259
269 3300005842 Ga0068858_100006556 Ga0068858_1000065563 259
270 3300005843 Ga0068860_100012285 Ga0068860_1000122852 259
271 3300005843 Ga0068860_100030713 Ga0068860_1000307133 259
272 3300005985 Ga0081539_10085150 Ga0081539_100851502 259
273 3300006237 Ga0097621_100007062 Ga0097621_1000070622 259
274 3300006358 Ga0068871_100003622 Ga0068871_1000036224 259
275 3300006358 Ga0068871_100009799 Ga0068871_1000097997 259
276 3300006881 Ga0068865_100030540 Ga0068865_1000305405 259
277 3300006931 Ga0097620_100028318 Ga0097620_1000283185 259
278 3300006931 Ga0097620_100159153 Ga0097620_1001591533 259
279 3300009177 Ga0105248_10007610 Ga0105248_100076103 259
280 3300009177 Ga0105248_10091786 Ga0105248_100917864 259
281 3300009177 Ga0105248_10508095 Ga0105248_105080952 259
282 3300009553 Ga0105249_10175248 Ga0105249_101752482 259
283 3300013296 Ga0157374_10008326 Ga0157374_100083263 259
284 3300013306 Ga0163162_10004211 Ga0163162_1000421112 259
285 3300013306 Ga0163162_10038651 Ga0163162_100386513 259
286 3300013308 Ga0157375_10002925 Ga0157375_100029259 259
287 3300013308 Ga0157375_10246814 Ga0157375_102468142 259
288 3300014325 Ga0163163_10128098 Ga0163163_101280982 259
289 3300014745 Ga0157377_10135002 Ga0157377_101350022 259
290 3300014968 Ga0157379_10141967 Ga0157379_101419672 259
291 3300014969 Ga0157376_10259253 Ga0157376_102592532 259
292 3300025315 Ga0207697_10003677 Ga0207697_100036774 259
293 3300025893 Ga0207682_10000483 Ga0207682_100004836 259
294 3300025893 Ga0207682_10019839 Ga0207682_100198392 259
295 3300025903 Ga0207680_10063053 Ga0207680_100630532 259
296 3300025907 Ga0207645_10000617 Ga0207645_1000061713 259
297 3300025907 Ga0207645_10009628 Ga0207645_100096283 259
298 3300025908 Ga0207643_10022770 Ga0207643_100227702 259
299 3300025909 Ga0207705_10227912 Ga0207705_102279122 259
300 3300025923 Ga0207681_10004220 Ga0207681_1000422010 259
301 3300025925 Ga0207650_10068939 Ga0207650_100689393 259
302 3300025926 Ga0207659_10010401 Ga0207659_100104015 259
303 3300025926 Ga0207659_10025052 Ga0207659_100250522 259
304 3300025931 Ga0207644_10003463 Ga0207644_100034634 259
305 3300025937 Ga0207669_10062882 Ga0207669_100628822 259
306 3300025937 Ga0207669_10159484 Ga0207669_101594842 259
307 3300025938 Ga0207704_10308065 Ga0207704_103080652 259
308 3300025940 Ga0207691_10000170 Ga0207691_1000017056 259
309 3300025940 Ga0207691_10000282 Ga0207691_1000028248 259
310 3300025941 Ga0207711_10053481 Ga0207711_100534814 259
311 3300025941 Ga0207711_10079496 Ga0207711_100794962 259
312 3300025942 Ga0207689_10010112 Ga0207689_100101123 259
313 3300025961 Ga0207712_10112632 Ga0207712_101126322 259
314 3300025972 Ga0207668_10006170 Ga0207668_100061703 259
315 3300025972 Ga0207668_10045956 Ga0207668_100459562 259
316 3300025986 Ga0207658_10032868 Ga0207658_100328682 259
317 3300025986 Ga0207658_10105264 Ga0207658_101052642 259
318 3300026023 Ga0207677_10030318 Ga0207677_100303184 259
319 3300026023 Ga0207677_10128029 Ga0207677_101280292 259
320 3300026035 Ga0207703_10048664 Ga0207703_100486643 259
321 3300026035 Ga0207703_10084450 Ga0207703_100844502 259
322 3300026041 Ga0207639_10006373 Ga0207639_100063731 259
323 3300026067 Ga0207678_10009500 Ga0207678_100095003 259
324 3300026088 Ga0207641_10004545 Ga0207641_100045453 259
325 3300026088 Ga0207641_10020334 Ga0207641_100203343 259
326 3300026089 Ga0207648_10000203 Ga0207648_100002039 259
327 3300026089 Ga0207648_10000605 Ga0207648_1000060531 259
328 3300026095 Ga0207676_10021161 Ga0207676_100211612 259
329 3300026118 Ga0207675_100244321 Ga0207675_1002443212 259
330 3300026118 Ga0207675_100505670 Ga0207675_1005056702 259
331 3300026121 Ga0207683_10000005 Ga0207683_10000005121 259
332 3300026121 Ga0207683_10000428 Ga0207683_1000042836 259
333 3300028379 Ga0268266_10002847 Ga0268266_1000284714 259
334 3300028379 Ga0268266_10014515 Ga0268266_100145152 259
335 3300028381 Ga0268264_10018697 Ga0268264_100186974 259
336 3300048910 Ga0496107_0173569 Ga0496107_0173569_626_1513 259
337 3300048912 Ga0496109_0034784 Ga0496109_0034784_2419_3306 259
338 3300053085 Ga0495619_0095902 Ga0495619_0095902_742_1647 259
339 3300005328 Ga0070676_10088404 Ga0070676_100884042 260
340 3300005331 Ga0070670_100075314 Ga0070670_1000753144 260
341 3300005334 Ga0068869_100000717 Ga0068869_10000071714 260
342 3300005338 Ga0068868_100414566 Ga0068868_1004145662 260
343 3300005340 Ga0070689_100005991 Ga0070689_1000059913 260
344 3300005354 Ga0070675_100016281 Ga0070675_1000162813 260
345 3300005354 Ga0070675_100482173 Ga0070675_1004821731 260
346 3300005355 Ga0070671_100015546 Ga0070671_1000155462 260
347 3300005364 Ga0070673_100005120 Ga0070673_1000051208 260
348 3300005364 Ga0070673_100091103 Ga0070673_1000911032 260
349 3300005365 Ga0070688_100074221 Ga0070688_1000742212 260
350 3300005365 Ga0070688_100082898 Ga0070688_1000828982 260
351 3300005445 Ga0070708_100001846 Ga0070708_1000018468 260
352 3300005456 Ga0070678_100008313 Ga0070678_1000083133 260
353 3300005459 Ga0068867_100011620 Ga0068867_1000116203 260
354 3300005543 Ga0070672_100045668 Ga0070672_1000456683 260
355 3300005548 Ga0070665_100066705 Ga0070665_1000667052 260
356 3300005617 Ga0068859_100243831 Ga0068859_1002438312 260
357 3300005618 Ga0068864_100003838 Ga0068864_1000038382 260
358 3300005618 Ga0068864_100017807 Ga0068864_1000178072 260
359 3300005618 Ga0068864_100033445 Ga0068864_1000334454 260
360 3300005840 Ga0068870_10006880 Ga0068870_100068803 260
361 3300005841 Ga0068863_100004444 Ga0068863_10000444411 260
362 3300005841 Ga0068863_100089700 Ga0068863_1000897002 260
363 3300005841 Ga0068863_100414764 Ga0068863_1004147642 260
364 3300005843 Ga0068860_100008429 Ga0068860_1000084297 260
365 3300005844 Ga0068862_100028779 Ga0068862_1000287793 260
366 3300006237 Ga0097621_100057224 Ga0097621_1000572242 260
367 3300006237 Ga0097621_100074891 Ga0097621_1000748911 260
368 3300006358 Ga0068871_100300825 Ga0068871_1003008251 260
369 3300006358 Ga0068871_100400965 Ga0068871_1004009652 260
370 3300006931 Ga0097620_100243837 Ga0097620_1002438372 260
371 3300009148 Ga0105243_10108611 Ga0105243_101086112 260
372 3300009177 Ga0105248_10064781 Ga0105248_100647814 260
373 3300009177 Ga0105248_10222372 Ga0105248_102223722 260
374 3300009553 Ga0105249_10214776 Ga0105249_102147762 260
375 3300013306 Ga0163162_10149177 Ga0163162_101491772 260
376 3300013308 Ga0157375_10030861 Ga0157375_100308613 260
377 3300014325 Ga0163163_10019983 Ga0163163_100199832 260
378 3300014325 Ga0163163_10056449 Ga0163163_100564494 260
379 3300014326 Ga0157380_10054683 Ga0157380_100546832 260
380 3300014968 Ga0157379_10408444 Ga0157379_104084441 260
381 3300014969 Ga0157376_10110923 Ga0157376_101109232 260
382 3300017792 Ga0163161_10086797 Ga0163161_100867972 260
383 3300017792 Ga0163161_10453601 Ga0163161_104536012 260
384 3300025907 Ga0207645_10027594 Ga0207645_100275942 260
385 3300025908 Ga0207643_10004283 Ga0207643_100042835 260
386 3300025923 Ga0207681_10100216 Ga0207681_101002162 260
387 3300025931 Ga0207644_10109199 Ga0207644_101091991 260
388 3300025937 Ga0207669_10160125 Ga0207669_101601252 260
389 3300025938 Ga0207704_10256256 Ga0207704_102562562 260
390 3300025941 Ga0207711_10330269 Ga0207711_103302692 260
391 3300025942 Ga0207689_10021123 Ga0207689_100211232 260
392 3300025960 Ga0207651_10063771 Ga0207651_100637712 260
393 3300025986 Ga0207658_10395095 Ga0207658_103950952 260
394 3300026035 Ga0207703_10319164 Ga0207703_103191642 260
395 3300026075 Ga0207708_10007278 Ga0207708_100072787 260
396 3300026088 Ga0207641_10022283 Ga0207641_100222832 260
397 3300026088 Ga0207641_10374249 Ga0207641_103742491 260
398 3300026089 Ga0207648_10007681 Ga0207648_100076819 260
399 3300026095 Ga0207676_10025352 Ga0207676_100253522 260
400 3300026095 Ga0207676_10145613 Ga0207676_101456132 260
401 3300026118 Ga0207675_100042323 Ga0207675_1000423234 260
402 3300026121 Ga0207683_10036191 Ga0207683_100361913 260
403 3300028379 Ga0268266_10129956 Ga0268266_101299562 260
404 3300028380 Ga0268265_10051850 Ga0268265_100518503 260
405 3300048906 Ga0496103_0062904 Ga0496103_0062904_1162_2043 260
406 3300050514 nmdc:mga08x19_26694_c1 nmdc:mga08x19_26694_c1_683_1582 260
407 3300005333 Ga0070677_10013475 Ga0070677_100134753 261
408 3300005456 Ga0070678_100006666 Ga0070678_1000066663 261
409 3300005459 Ga0068867_100047216 Ga0068867_1000472162 261
410 3300005548 Ga0070665_100003807 Ga0070665_1000038078 261
411 3300005577 Ga0068857_100360528 Ga0068857_1003605282 261
412 3300005615 Ga0070702_100032385 Ga0070702_1000323851 261
413 3300005937 Ga0081455_10219774 Ga0081455_102197742 261
414 3300006237 Ga0097621_100226331 Ga0097621_1002263312 261
415 3300013306 Ga0163162_10332843 Ga0163162_103328432 261
416 3300013308 Ga0157375_10228450 Ga0157375_102284502 261
417 3300014745 Ga0157377_10040366 Ga0157377_100403664 261
418 3300014968 Ga0157379_10295898 Ga0157379_102958982 261
419 3300014968 Ga0157379_10435052 Ga0157379_104350522 261
420 3300025315 Ga0207697_10028744 Ga0207697_100287442 261
421 3300025321 Ga0207656_10017284 Ga0207656_100172842 261
422 3300025893 Ga0207682_10000010 Ga0207682_1000001047 261
423 3300025901 Ga0207688_10012323 Ga0207688_100123233 261
424 3300025908 Ga0207643_10000339 Ga0207643_1000033934 261
425 3300025923 Ga0207681_10360033 Ga0207681_103600332 261
426 3300025925 Ga0207650_10378751 Ga0207650_103787511 261
427 3300025942 Ga0207689_10019564 Ga0207689_100195642 261
428 3300025972 Ga0207668_10303046 Ga0207668_103030462 261
429 3300026035 Ga0207703_10265382 Ga0207703_102653821 261
430 3300026067 Ga0207678_10002750 Ga0207678_100027502 261
431 3300026089 Ga0207648_10063485 Ga0207648_100634853 261
432 3300026116 Ga0207674_10066702 Ga0207674_100667022 261
433 3300026118 Ga0207675_100004007 Ga0207675_10000400710 261
434 3300026121 Ga0207683_10016709 Ga0207683_100167094 261
435 3300028379 Ga0268266_10305396 Ga0268266_103053962 261
436 3300031235 Ga0265330_10002416 Ga0265330_100024164 261
437 3300031238 Ga0265332_10001887 Ga0265332_100018877 261
438 3300031242 Ga0265329_10007419 Ga0265329_100074192 261
439 3300031247 Ga0265340_10118569 Ga0265340_101185692 261
440 3300031249 Ga0265339_10078477 Ga0265339_100784772 261
441 3300031251 Ga0265327_10008924 Ga0265327_100089244 261
442 3300031344 Ga0265316_10005364 Ga0265316_100053647 261
443 3300031711 Ga0265314_10004158 Ga0265314_100041588 261
444 3300046528 Ga0495642_0065953 Ga0495642_0065953_301_1185 261
445 3300048905 Ga0496102_0185283 Ga0496102_0185283_42_926 261
446 3300048907 Ga0496104_0217342 Ga0496104_0217342_659_1543 261
447 3300048910 Ga0496107_0097488 Ga0496107_0097488_245_1129 261
448 3300048911 Ga0496108_0017349 Ga0496108_0017349_3687_4571 261
449 3300048912 Ga0496109_0038858 Ga0496109_0038858_2114_2998 261
450 3300048913 Ga0496110_0082967 Ga0496110_0082967_1793_2677 261
451 3300048917 Ga0496114_0142042 Ga0496114_0142042_1009_1893 261
452 3300005344 Ga0070661_100159511 Ga0070661_1001595112 262
453 3300005530 Ga0070679_100411152 Ga0070679_1004111521 262
454 3300005563 Ga0068855_100045063 Ga0068855_1000450632 262
455 3300005614 Ga0068856_100143504 Ga0068856_1001435042 262
456 3300013104 Ga0157370_10213273 Ga0157370_102132732 262
457 3300025919 Ga0207657_10008004 Ga0207657_100080043 262
458 3300025949 Ga0207667_10010385 Ga0207667_100103859 262
459 3300031239 Ga0265328_10072397 Ga0265328_100723972 262
460 3300031241 Ga0265325_10008462 Ga0265325_100084626 262
461 3300035691 Ga0373931_0133733 Ga0373931_0133733_268_1161 262
462 3300045836 Ga0466958_0188359 Ga0466958_0188359_102_992 262
463 3300047471 Ga0495684_0297646 Ga0495684_0297646_208_1113 262
464 3300005330 Ga0070690_100018654 Ga0070690_1000186543 263
465 3300005331 Ga0070670_100017466 Ga0070670_1000174664 263
466 3300005331 Ga0070670_100065429 Ga0070670_1000654292 263
467 3300005334 Ga0068869_100042456 Ga0068869_1000424562 263
468 3300005334 Ga0068869_100163024 Ga0068869_1001630242 263
469 3300005335 Ga0070666_10013780 Ga0070666_100137804 263
470 3300005336 Ga0070680_100186305 Ga0070680_1001863052 263
471 3300005338 Ga0068868_100004519 Ga0068868_1000045194 263
472 3300005338 Ga0068868_100128144 Ga0068868_1001281442 263
473 3300005338 Ga0068868_100392221 Ga0068868_1003922212 263
474 3300005340 Ga0070689_100027510 Ga0070689_1000275102 263
475 3300005344 Ga0070661_100042872 Ga0070661_1000428723 263
476 3300005344 Ga0070661_100056525 Ga0070661_1000565252 263
477 3300005345 Ga0070692_10090302 Ga0070692_100903022 263
478 3300005355 Ga0070671_100073970 Ga0070671_1000739702 263
479 3300005356 Ga0070674_100154130 Ga0070674_1001541302 263
480 3300005364 Ga0070673_100002612 Ga0070673_1000026124 263
481 3300005365 Ga0070688_100000814 Ga0070688_1000008149 263
482 3300005366 Ga0070659_100091196 Ga0070659_1000911962 263
483 3300005367 Ga0070667_100013573 Ga0070667_1000135733 263
484 3300005406 Ga0070703_10040643 Ga0070703_100406432 263
485 3300005434 Ga0070709_10006696 Ga0070709_100066963 263
486 3300005435 Ga0070714_100007012 Ga0070714_1000070124 263
487 3300005436 Ga0070713_100003066 Ga0070713_1000030664 263
488 3300005436 Ga0070713_100114842 Ga0070713_1001148422 263
489 3300005437 Ga0070710_10012321 Ga0070710_100123212 263
490 3300005437 Ga0070710_10065753 Ga0070710_100657532 263
491 3300005438 Ga0070701_10015768 Ga0070701_100157683 263
492 3300005438 Ga0070701_10120267 Ga0070701_101202672 263
493 3300005439 Ga0070711_100006625 Ga0070711_1000066253 263
494 3300005439 Ga0070711_100211393 Ga0070711_1002113932 263
495 3300005441 Ga0070700_100131634 Ga0070700_1001316342 263
496 3300005444 Ga0070694_100026753 Ga0070694_1000267532 263
497 3300005445 Ga0070708_100151044 Ga0070708_1001510442 263
498 3300005445 Ga0070708_100185275 Ga0070708_1001852752 263
499 3300005456 Ga0070678_100005090 Ga0070678_1000050903 263
500 3300005456 Ga0070678_100140767 Ga0070678_1001407672 263
501 3300005457 Ga0070662_100030069 Ga0070662_1000300694 263
502 3300005457 Ga0070662_100303593 Ga0070662_1003035932 263
503 3300005459 Ga0068867_100052758 Ga0068867_1000527582 263
504 3300005466 Ga0070685_10000622 Ga0070685_100006224 263
505 3300005467 Ga0070706_100018202 Ga0070706_1000182023 263
506 3300005467 Ga0070706_100082137 Ga0070706_1000821374 263
507 3300005471 Ga0070698_100129941 Ga0070698_1001299411 263
508 3300005471 Ga0070698_100156180 Ga0070698_1001561802 263
509 3300005535 Ga0070684_100338663 Ga0070684_1003386631 263
510 3300005536 Ga0070697_100063348 Ga0070697_1000633482 263
511 3300005539 Ga0068853_100197559 Ga0068853_1001975592 263
512 3300005543 Ga0070672_100206712 Ga0070672_1002067122 263
513 3300005544 Ga0070686_100039973 Ga0070686_1000399733 263
514 3300005547 Ga0070693_100002942 Ga0070693_1000029426 263
515 3300005548 Ga0070665_100061175 Ga0070665_1000611752 263
516 3300005549 Ga0070704_100034064 Ga0070704_1000340643 263
517 3300005549 Ga0070704_100048997 Ga0070704_1000489974 263
518 3300005564 Ga0070664_100141451 Ga0070664_1001414512 263
519 3300005564 Ga0070664_100281639 Ga0070664_1002816392 263
520 3300005578 Ga0068854_100024306 Ga0068854_1000243062 263
521 3300005578 Ga0068854_100042845 Ga0068854_1000428452 263
522 3300005614 Ga0068856_100045436 Ga0068856_1000454363 263
523 3300005616 Ga0068852_100086600 Ga0068852_1000866002 263
524 3300005616 Ga0068852_100289191 Ga0068852_1002891912 263
525 3300005617 Ga0068859_100003107 Ga0068859_1000031075 263
526 3300005618 Ga0068864_100000836 Ga0068864_10000083610 263
527 3300005718 Ga0068866_10013319 Ga0068866_100133193 263
528 3300005718 Ga0068866_10036721 Ga0068866_100367212 263
529 3300005834 Ga0068851_10024479 Ga0068851_100244792 263
530 3300005840 Ga0068870_10011964 Ga0068870_100119643 263
531 3300005840 Ga0068870_10023079 Ga0068870_100230792 263
532 3300005841 Ga0068863_100021653 Ga0068863_1000216534 263
533 3300005842 Ga0068858_100002758 Ga0068858_1000027588 263
534 3300006163 Ga0070715_10037871 Ga0070715_100378712 263
535 3300006173 Ga0070716_100050375 Ga0070716_1000503753 263
536 3300006173 Ga0070716_100133010 Ga0070716_1001330102 263
537 3300006175 Ga0070712_100002822 Ga0070712_1000028223 263
538 3300006237 Ga0097621_100104172 Ga0097621_1001041722 263
539 3300006852 Ga0075433_10024408 Ga0075433_100244087 263
540 3300006852 Ga0075433_10086669 Ga0075433_100866694 263
541 3300006871 Ga0075434_100171298 Ga0075434_1001712983 263
542 3300006881 Ga0068865_100015911 Ga0068865_1000159112 263
543 3300006881 Ga0068865_100122854 Ga0068865_1001228542 263
544 3300006914 Ga0075436_100040081 Ga0075436_1000400813 263
545 3300006914 Ga0075436_100091240 Ga0075436_1000912402 263
546 3300006931 Ga0097620_100003107 Ga0097620_10000310711 263
547 3300007076 Ga0075435_100058306 Ga0075435_1000583063 263
548 3300007076 Ga0075435_100157679 Ga0075435_1001576792 263
549 3300007076 Ga0075435_100169732 Ga0075435_1001697322 263
550 3300009093 Ga0105240_10288021 Ga0105240_102880212 263
551 3300009094 Ga0111539_10051311 Ga0111539_100513111 263
552 3300009098 Ga0105245_10026765 Ga0105245_100267654 263
553 3300009098 Ga0105245_10263450 Ga0105245_102634502 263
554 3300009174 Ga0105241_10295943 Ga0105241_102959432 263
555 3300009176 Ga0105242_10059031 Ga0105242_100590312 263
556 3300009177 Ga0105248_10048455 Ga0105248_100484552 263
557 3300009545 Ga0105237_10241390 Ga0105237_102413902 263
558 3300009551 Ga0105238_10180310 Ga0105238_101803102 263
559 3300010375 Ga0105239_10331116 Ga0105239_103311162 263
560 3300013104 Ga0157370_10011500 Ga0157370_100115002 263
561 3300013104 Ga0157370_10040922 Ga0157370_100409223 263
562 3300013105 Ga0157369_10100523 Ga0157369_101005233 263
563 3300013296 Ga0157374_10003153 Ga0157374_100031533 263
564 3300013296 Ga0157374_10107749 Ga0157374_101077493 263
565 3300013297 Ga0157378_10061343 Ga0157378_100613433 263
566 3300013297 Ga0157378_10082858 Ga0157378_100828583 263
567 3300013297 Ga0157378_10089570 Ga0157378_100895702 263
568 3300013306 Ga0163162_10033285 Ga0163162_100332854 263
569 3300013308 Ga0157375_10004445 Ga0157375_100044454 263
570 3300013308 Ga0157375_10372750 Ga0157375_103727501 263
571 3300014325 Ga0163163_10001349 Ga0163163_1000134919 263
572 3300014326 Ga0157380_10228374 Ga0157380_102283742 263
573 3300014968 Ga0157379_10001289 Ga0157379_100012894 263
574 3300014969 Ga0157376_10020955 Ga0157376_100209554 263
575 3300014969 Ga0157376_10469363 Ga0157376_104693631 263
576 3300017792 Ga0163161_10020325 Ga0163161_100203253 263
577 3300025898 Ga0207692_10007307 Ga0207692_100073073 263
578 3300025903 Ga0207680_10007835 Ga0207680_100078352 263
579 3300025905 Ga0207685_10012197 Ga0207685_100121972 263
580 3300025906 Ga0207699_10005093 Ga0207699_100050934 263
581 3300025906 Ga0207699_10261451 Ga0207699_102614512 263
582 3300025907 Ga0207645_10006124 Ga0207645_100061243 263
583 3300025907 Ga0207645_10148079 Ga0207645_101480792 263
584 3300025908 Ga0207643_10033369 Ga0207643_100333693 263
585 3300025910 Ga0207684_10014702 Ga0207684_100147024 263
586 3300025915 Ga0207693_10003564 Ga0207693_100035648 263
587 3300025915 Ga0207693_10017562 Ga0207693_100175623 263
588 3300025916 Ga0207663_10018700 Ga0207663_100187002 263
589 3300025918 Ga0207662_10047986 Ga0207662_100479862 263
590 3300025919 Ga0207657_10002457 Ga0207657_1000245716 263
591 3300025921 Ga0207652_10197046 Ga0207652_101970462 263
592 3300025922 Ga0207646_10449050 Ga0207646_104490502 263
593 3300025925 Ga0207650_10017431 Ga0207650_100174314 263
594 3300025927 Ga0207687_10006270 Ga0207687_100062705 263
595 3300025928 Ga0207700_10042935 Ga0207700_100429354 263
596 3300025928 Ga0207700_10080174 Ga0207700_100801744 263
597 3300025929 Ga0207664_10002996 Ga0207664_100029966 263
598 3300025931 Ga0207644_10005068 Ga0207644_100050688 263
599 3300025932 Ga0207690_10372730 Ga0207690_103727301 263
600 3300025933 Ga0207706_10012488 Ga0207706_100124883 263
601 3300025933 Ga0207706_10203781 Ga0207706_102037812 263
602 3300025934 Ga0207686_10003125 Ga0207686_100031255 263
603 3300025934 Ga0207686_10117516 Ga0207686_101175162 263
604 3300025936 Ga0207670_10011023 Ga0207670_100110233 263
605 3300025937 Ga0207669_10007186 Ga0207669_100071863 263
606 3300025937 Ga0207669_10021653 Ga0207669_100216533 263
607 3300025939 Ga0207665_10053124 Ga0207665_100531242 263
608 3300025939 Ga0207665_10159377 Ga0207665_101593772 263
609 3300025940 Ga0207691_10107741 Ga0207691_101077412 263
610 3300025941 Ga0207711_10000116 Ga0207711_1000011611 263
611 3300025942 Ga0207689_10038725 Ga0207689_100387254 263
612 3300025942 Ga0207689_10049651 Ga0207689_100496513 263
613 3300025949 Ga0207667_10269321 Ga0207667_102693212 263
614 3300025960 Ga0207651_10008341 Ga0207651_100083412 263
615 3300025986 Ga0207658_10003932 Ga0207658_100039327 263
616 3300025986 Ga0207658_10025921 Ga0207658_100259214 263
617 3300026023 Ga0207677_10000188 Ga0207677_1000018821 263
618 3300026023 Ga0207677_10290777 Ga0207677_102907772 263
619 3300026035 Ga0207703_10000806 Ga0207703_1000080621 263
620 3300026075 Ga0207708_10019956 Ga0207708_100199562 263
621 3300026078 Ga0207702_10014222 Ga0207702_100142224 263
622 3300026078 Ga0207702_10089675 Ga0207702_100896753 263
623 3300026088 Ga0207641_10004745 Ga0207641_100047459 263
624 3300026088 Ga0207641_10233487 Ga0207641_102334872 263
625 3300026089 Ga0207648_10014175 Ga0207648_100141759 263
626 3300026089 Ga0207648_10082574 Ga0207648_100825742 263
627 3300026095 Ga0207676_10000230 Ga0207676_1000023023 263
628 3300026095 Ga0207676_10331704 Ga0207676_103317042 263
629 3300026116 Ga0207674_10101644 Ga0207674_101016442 263
630 3300026121 Ga0207683_10001896 Ga0207683_100018963 263
631 3300026142 Ga0207698_10033201 Ga0207698_100332013 263
632 3300026142 Ga0207698_10297203 Ga0207698_102972032 263
633 3300028379 Ga0268266_10041686 Ga0268266_100416864 263
634 3300028381 Ga0268264_10003573 Ga0268264_100035734 263
635 3300028381 Ga0268264_10144070 Ga0268264_101440702 263
636 3300035089 Ga0373944_0010957 Ga0373944_0010957_893_1810 263
637 3300035111 Ga0373923_0003154 Ga0373923_0003154_2665_3582 263
638 3300035118 Ga0373954_0010837 Ga0373954_0010837_223_1140 263
639 3300035119 Ga0373956_0120799 Ga0373956_0120799_222_1139 263
640 3300035120 Ga0373957_0012504 Ga0373957_0012504_1275_2192 263
641 3300035170 Ga0373943_0023834 Ga0373943_0023834_25_942 263
642 3300035170 Ga0373943_0064831 Ga0373943_0064831_795_1712 263
643 3300035172 Ga0373955_0056781 Ga0373955_0056781_1101_2018 263
644 3300035692 Ga0373935_0154971 Ga0373935_0154971_459_1376 263
645 3300035692 Ga0373935_0217193 Ga0373935_0217193_194_1102 263
646 3300035695 Ga0373927_0028723 Ga0373927_0028723_908_1825 263
647 3300035724 Ga0373933_0015768 Ga0373933_0015768_1753_2670 263
648 3300035725 Ga0373947_0024324 Ga0373947_0024324_2092_3009 263
649 3300036401 Ga0373937_0011991 Ga0373937_0011991_230_1174 263
650 3300036401 Ga0373937_0050883 Ga0373937_0050883_1127_2044 263
651 3300037068 Ga0373925_0049596 Ga0373925_0049596_736_1653 263
652 3300046459 Ga0495629_0032236 Ga0495629_0032236_747_1664 263
653 3300046472 Ga0495580_0078401 Ga0495580_0078401_575_1483 263
654 3300046472 Ga0495580_0112981 Ga0495580_0112981_27_944 263
655 3300046473 Ga0495582_0038857 Ga0495582_0038857_624_1541 263
656 3300046477 Ga0495664_0014729 Ga0495664_0014729_2089_3006 263
657 3300046543 Ga0495645_0105370 Ga0495645_0105370_43_960 263
658 3300046663 Ga0495635_0064143 Ga0495635_0064143_878_1795 263
659 3300046681 Ga0495647_0005212 Ga0495647_0005212_2112_3029 263
660 3300046689 Ga0495613_0025522 Ga0495613_0025522_1200_2117 263
661 3300047315 Ga0495581_0004852 Ga0495581_0004852_6094_7011 263
662 3300047471 Ga0495684_0012214 Ga0495684_0012214_5146_6063 263
663 3300047471 Ga0495684_0143901 Ga0495684_0143901_817_1734 263
664 3300048903 Ga0496100_0025658 Ga0496100_0025658_2002_2919 263
665 3300048904 Ga0496101_0069996 Ga0496101_0069996_650_1567 263
666 3300048907 Ga0496104_0024227 Ga0496104_0024227_3731_4648 263
667 3300048908 Ga0496105_0016623 Ga0496105_0016623_1254_2171 263
668 3300048912 Ga0496109_0056893 Ga0496109_0056893_2641_3558 263
669 3300048915 Ga0496112_0031287 Ga0496112_0031287_833_1750 263
670 3300050512 nmdc:mga0n895_182014_c1 nmdc:mga0n895_182014_c1_1064_1972 263
671 3300050513 nmdc:mga0rr50_129280_c1 nmdc:mga0rr50_129280_c1_146_1054 263
672 3300050513 nmdc:mga0rr50_316546_c1 nmdc:mga0rr50_316546_c1_205_1104 263
673 3300050513 nmdc:mga0rr50_442489_c1 nmdc:mga0rr50_442489_c1_131_1048 263
674 3300050514 nmdc:mga08x19_46304_c1 nmdc:mga08x19_46304_c1_802_1710 263
675 3300050515 nmdc:mga0a205_180331_c1 nmdc:mga0a205_180331_c1_686_1594 263
676 3300050515 nmdc:mga0a205_9988_c1 nmdc:mga0a205_9988_c1_3717_4625 263
677 3300053077 Ga0495601_0207454 Ga0495601_0207454_96_1013 263
678 3300053078 Ga0495612_0057663 Ga0495612_0057663_201_1118 263
679 3300053085 Ga0495619_0044721 Ga0495619_0044721_807_1724 263
680 3300005327 Ga0070658_10058655 Ga0070658_100586552 264
681 3300005329 Ga0070683_100068000 Ga0070683_1000680003 264
682 3300005339 Ga0070660_100050027 Ga0070660_1000500272 264
683 3300005344 Ga0070661_100139946 Ga0070661_1001399462 264
684 3300005366 Ga0070659_100084993 Ga0070659_1000849933 264
685 3300005366 Ga0070659_100120959 Ga0070659_1001209592 264
686 3300005366 Ga0070659_100305378 Ga0070659_1003053781 264
687 3300005435 Ga0070714_100085264 Ga0070714_1000852642 264
688 3300005455 Ga0070663_100052938 Ga0070663_1000529382 264
689 3300005535 Ga0070684_100025993 Ga0070684_1000259935 264
690 3300005539 Ga0068853_100096733 Ga0068853_1000967332 264
691 3300005563 Ga0068855_100129444 Ga0068855_1001294444 264
692 3300005564 Ga0070664_100084109 Ga0070664_1000841093 264
693 3300005578 Ga0068854_100026753 Ga0068854_1000267535 264
694 3300005614 Ga0068856_100295722 Ga0068856_1002957221 264
695 3300005616 Ga0068852_100233925 Ga0068852_1002339252 264
696 3300005834 Ga0068851_10003303 Ga0068851_100033032 264
697 3300009093 Ga0105240_10148561 Ga0105240_101485614 264
698 3300009174 Ga0105241_10295580 Ga0105241_102955801 264
699 3300009545 Ga0105237_10151393 Ga0105237_101513932 264
700 3300009551 Ga0105238_10050122 Ga0105238_100501225 264
701 3300013100 Ga0157373_10008074 Ga0157373_100080743 264
702 3300013102 Ga0157371_10056803 Ga0157371_100568033 264
703 3300013105 Ga0157369_10049473 Ga0157369_100494735 264
704 3300013307 Ga0157372_10524910 Ga0157372_105249102 264
705 3300025911 Ga0207654_10052805 Ga0207654_100528052 264
706 3300025912 Ga0207707_10143861 Ga0207707_101438612 264
707 3300025913 Ga0207695_10065559 Ga0207695_100655592 264
708 3300025917 Ga0207660_10073160 Ga0207660_100731602 264
709 3300025919 Ga0207657_10000329 Ga0207657_1000032937 264
710 3300025919 Ga0207657_10099847 Ga0207657_100998472 264
711 3300025921 Ga0207652_10005308 Ga0207652_100053082 264
712 3300025924 Ga0207694_10020347 Ga0207694_100203475 264
713 3300025944 Ga0207661_10370111 Ga0207661_103701111 264
714 3300025949 Ga0207667_10051082 Ga0207667_100510825 264
715 3300025949 Ga0207667_10270212 Ga0207667_102702122 264
716 3300025981 Ga0207640_10301188 Ga0207640_103011882 264
717 3300026067 Ga0207678_10005798 Ga0207678_100057987 264
718 3300026078 Ga0207702_10293779 Ga0207702_102937792 264
719 3300026116 Ga0207674_10001017 Ga0207674_1000101727 264
720 3300038443 Ga0395901_0191131 Ga0395901_0191131_1092_1985 264
721 3300048909 Ga0496106_0325054 Ga0496106_0325054_164_1084 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05673

DUF815

Protein of unknown function (DUF815)

42

299

0.96

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

98

209

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bgw-assembly1.cif.gz_B xpf from aeropyrum pernix, complex with dna 0.6824 100 169
6t8g-assembly1.cif.gz_F stalled ftsk motor domain bound to dsdna 0.6735 74 179
3io5-assembly1.cif.gz_A crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4 0.6645 65 170
2qp9-assembly1.cif.gz_X crystal structure of s.cerevisiae vps4 0.6588 44 182
6hqu-assembly5.cif.gz_E humanised rada mutant humrada22 in complex with a recombined brc repeat 8-2 0.6516 73 171
ID Description Score Start End Superfamily
af_Q58294_3_157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7838 45 181 3.40.50.300
3eieA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7558 40 182 3.40.50.300
2v1uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7405 49 171 3.40.50.300
af_Q9W102_1_216_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.731 49 178 3.40.50.300
af_Q54RM2_213_419_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.731 44 176 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537EAG2-F1-model_v4 DUF815 domain-containing protein 0.9638 59 173
AF-A0A7S1DKY2-F1-model_v4 AAA+ ATPase domain-containing protein 0.9629 27 136
AF-A0A3D0FJ67-F1-model_v4 deleted 0.9511 17 148
AF-A0A3C0IHF1-F1-model_v4 deleted 0.9504 17 134
AF-A0A6P1B0P3-F1-model_v4 deleted 0.9482 67 150

Feature Viewer

pLDDT pTM Quality
84.65 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map