F477363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 267 | 720 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10011500|Ga0157370_100115002 |
| Length | 306 |
| Sequence | VNDNTRQSPVNDGLRTLIARAESLLARVEALFPPLVTDPDWSHTMAARWRKRNGRGFLQPVAHPHAVALDDLVAIDAQKQTIDRNTQQFIAGLPANNVLLTGSRGTGKSSLVKAMLARYADRGLRLIEVDKSDLTXXPDIAERIESEPYRYVIFCDDLTFDAGEAGYKALKVMLDGSIAGAASNVLIYATSNRRHLLPEYFAENLETRHVGDEVHPGESVEEKISLSERFGLWISFYPFVQDDYLVAVDRWLAHFGVAAPASERDAEARTREALQFALSRGSRSGRIAWQFARHYAGSLGLDSHVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 3.19 |
| Rhizosphere | 96.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10058655 | 3300005327 | Bacteria | 3133 |
| 2 | Ga0070676_10000862 | 3300005328 | Bacteria | 14943 |
| 3 | Ga0070676_10001774 | 3300005328 | Bacteria | 10984 |
| 4 | Ga0070676_10006266 | 3300005328 | Bacteria | 6356 |
| 5 | Ga0070676_10088404 | 3300005328 | Bacteria | 1893 |
| 6 | Ga0070683_100001287 | 3300005329 | Bacteria | 19089 |
| 7 | Ga0070683_100068000 | 3300005329 | Bacteria | 3318 |
| 8 | Ga0070690_100018654 | 3300005330 | Bacteria | 4193 |
| 9 | Ga0070670_100011090 | 3300005331 | Bacteria | 7700 |
| 10 | Ga0070670_100017466 | 3300005331 | Bacteria | 6155 |
| 11 | Ga0070670_100065429 | 3300005331 | Bacteria | 3119 |
| 12 | Ga0070670_100075314 | 3300005331 | Bacteria | 2900 |
| 13 | Ga0070677_10000268 | 3300005333 | Bacteria | 18104 |
| 14 | Ga0070677_10013475 | 3300005333 | Bacteria | 2860 |
| 15 | Ga0068869_100000717 | 3300005334 | Bacteria | 18833 |
| 16 | Ga0068869_100042456 | 3300005334 | Bacteria | 3260 |
| 17 | Ga0068869_100158086 | 3300005334 | Bacteria | 1763 |
| 18 | Ga0068869_100163024 | 3300005334 | Bacteria | 1736 |
| 19 | Ga0070666_10000839 | 3300005335 | Bacteria | 18638 |
| 20 | Ga0070666_10005531 | 3300005335 | Bacteria | 7751 |
| 21 | Ga0070666_10013780 | 3300005335 | Bacteria | 5135 |
| 22 | Ga0070666_10041436 | 3300005335 | Bacteria | 3077 |
| 23 | Ga0070680_100186305 | 3300005336 | Bacteria | 1748 |
| 24 | Ga0068868_100004519 | 3300005338 | Bacteria | 9760 |
| 25 | Ga0068868_100008483 | 3300005338 | Bacteria | 7356 |
| 26 | Ga0068868_100065551 | 3300005338 | Bacteria | 2886 |
| 27 | Ga0068868_100128144 | 3300005338 | Bacteria | 2075 |
| 28 | Ga0068868_100392221 | 3300005338 | Bacteria | 1196 |
| 29 | Ga0068868_100414566 | 3300005338 | Bacteria | 1165 |
| 30 | Ga0070660_100001693 | 3300005339 | Bacteria | 15121 |
| 31 | Ga0070660_100005619 | 3300005339 | Bacteria | 8691 |
| 32 | Ga0070660_100050027 | 3300005339 | Bacteria | 3215 |
| 33 | Ga0070689_100005991 | 3300005340 | Bacteria | 8370 |
| 34 | Ga0070689_100027510 | 3300005340 | Bacteria | 4288 |
| 35 | Ga0070691_10010280 | 3300005341 | Bacteria | 4270 |
| 36 | Ga0070661_100007248 | 3300005344 | Bacteria | 7647 |
| 37 | Ga0070661_100010193 | 3300005344 | Bacteria | 6529 |
| 38 | Ga0070661_100042872 | 3300005344 | Bacteria | 3304 |
| 39 | Ga0070661_100056525 | 3300005344 | Bacteria | 2875 |
| 40 | Ga0070661_100116454 | 3300005344 | Bacteria | 1999 |
| 41 | Ga0070661_100139946 | 3300005344 | Bacteria | 1823 |
| 42 | Ga0070661_100159511 | 3300005344 | Bacteria | 1708 |
| 43 | Ga0070661_100254188 | 3300005344 | Bacteria | 1357 |
| 44 | Ga0070661_100331356 | 3300005344 | Bacteria | 1191 |
| 45 | Ga0070692_10090302 | 3300005345 | Bacteria | 1664 |
| 46 | Ga0070668_100003003 | 3300005347 | Bacteria | 12469 |
| 47 | Ga0070668_100008937 | 3300005347 | Bacteria | 7438 |
| 48 | Ga0070669_100001156 | 3300005353 | Bacteria | 19281 |
| 49 | Ga0070669_100051735 | 3300005353 | Bacteria | 3004 |
| 50 | Ga0070675_100006504 | 3300005354 | Bacteria | 8974 |
| 51 | Ga0070675_100016281 | 3300005354 | Bacteria | 5897 |
| 52 | Ga0070675_100026358 | 3300005354 | Bacteria | 4665 |
| 53 | Ga0070675_100047016 | 3300005354 | Bacteria | 3535 |
| 54 | Ga0070675_100482173 | 3300005354 | Bacteria | 1115 |
| 55 | Ga0070671_100015546 | 3300005355 | Bacteria | 6149 |
| 56 | Ga0070671_100031187 | 3300005355 | Bacteria | 4402 |
| 57 | Ga0070671_100046272 | 3300005355 | Bacteria | 3618 |
| 58 | Ga0070671_100050634 | 3300005355 | Bacteria | 3454 |
| 59 | Ga0070671_100073970 | 3300005355 | Bacteria | 2846 |
| 60 | Ga0070671_100118520 | 3300005355 | Bacteria | 2227 |
| 61 | Ga0070671_100236187 | 3300005355 | Bacteria | 1551 |
| 62 | Ga0070674_100001276 | 3300005356 | Bacteria | 13267 |
| 63 | Ga0070674_100074111 | 3300005356 | Bacteria | 2415 |
| 64 | Ga0070674_100154130 | 3300005356 | Bacteria | 1737 |
| 65 | Ga0070673_100001215 | 3300005364 | Bacteria | 14873 |
| 66 | Ga0070673_100002411 | 3300005364 | Bacteria | 11376 |
| 67 | Ga0070673_100002612 | 3300005364 | Bacteria | 11012 |
| 68 | Ga0070673_100005120 | 3300005364 | Bacteria | 8359 |
| 69 | Ga0070673_100012948 | 3300005364 | Bacteria | 5748 |
| 70 | Ga0070673_100049248 | 3300005364 | Bacteria | 3289 |
| 71 | Ga0070673_100091103 | 3300005364 | Bacteria | 2492 |
| 72 | Ga0070688_100000814 | 3300005365 | Bacteria | 15398 |
| 73 | Ga0070688_100023500 | 3300005365 | Bacteria | 3627 |
| 74 | Ga0070688_100074221 | 3300005365 | Bacteria | 2184 |
| 75 | Ga0070688_100082898 | 3300005365 | Bacteria | 2080 |
| 76 | Ga0070659_100005062 | 3300005366 | Bacteria | 9448 |
| 77 | Ga0070659_100029207 | 3300005366 | Bacteria | 4261 |
| 78 | Ga0070659_100084993 | 3300005366 | Bacteria | 2531 |
| 79 | Ga0070659_100091196 | 3300005366 | Bacteria | 2442 |
| 80 | Ga0070659_100120959 | 3300005366 | Bacteria | 2121 |
| 81 | Ga0070659_100163033 | 3300005366 | Bacteria | 1823 |
| 82 | Ga0070659_100182219 | 3300005366 | Bacteria | 1724 |
| 83 | Ga0070659_100248779 | 3300005366 | Bacteria | 1473 |
| 84 | Ga0070659_100305378 | 3300005366 | Bacteria | 1328 |
| 85 | Ga0070667_100003294 | 3300005367 | Bacteria | 13801 |
| 86 | Ga0070667_100005512 | 3300005367 | Bacteria | 10571 |
| 87 | Ga0070667_100013573 | 3300005367 | Bacteria | 6732 |
| 88 | Ga0070667_100027551 | 3300005367 | Bacteria | 4728 |
| 89 | Ga0070703_10040643 | 3300005406 | Bacteria | 1447 |
| 90 | Ga0070709_10006696 | 3300005434 | Bacteria | 6291 |
| 91 | Ga0070709_10017844 | 3300005434 | Bacteria | 4077 |
| 92 | Ga0070714_100005782 | 3300005435 | Bacteria | 9484 |
| 93 | Ga0070714_100007012 | 3300005435 | Bacteria | 8735 |
| 94 | Ga0070714_100085264 | 3300005435 | Bacteria | 2758 |
| 95 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 96 | Ga0070713_100003066 | 3300005436 | Bacteria | 10984 |
| 97 | Ga0070713_100114842 | 3300005436 | Bacteria | 2353 |
| 98 | Ga0070713_100137683 | 3300005436 | Bacteria | 2159 |
| 99 | Ga0070713_100170134 | 3300005436 | Bacteria | 1951 |
| 100 | Ga0070710_10012321 | 3300005437 | Bacteria | 4243 |
| 101 | Ga0070710_10065753 | 3300005437 | Bacteria | 2077 |
| 102 | Ga0070701_10015768 | 3300005438 | Bacteria | 3498 |
| 103 | Ga0070701_10120267 | 3300005438 | Bacteria | 1479 |
| 104 | Ga0070711_100006625 | 3300005439 | Bacteria | 6996 |
| 105 | Ga0070711_100043761 | 3300005439 | Bacteria | 3035 |
| 106 | Ga0070711_100211393 | 3300005439 | Bacteria | 1503 |
| 107 | Ga0070705_100087597 | 3300005440 | Bacteria | 1930 |
| 108 | Ga0070700_100131634 | 3300005441 | Bacteria | 1689 |
| 109 | Ga0070694_100026753 | 3300005444 | Bacteria | 3741 |
| 110 | Ga0070708_100001846 | 3300005445 | Bacteria | 16258 |
| 111 | Ga0070708_100151044 | 3300005445 | Bacteria | 2160 |
| 112 | Ga0070708_100185275 | 3300005445 | Bacteria | 1946 |
| 113 | Ga0070663_100027376 | 3300005455 | Bacteria | 3871 |
| 114 | Ga0070663_100052938 | 3300005455 | Bacteria | 2897 |
| 115 | Ga0070663_100060337 | 3300005455 | Bacteria | 2728 |
| 116 | Ga0070663_100475851 | 3300005455 | Bacteria | 1033 |
| 117 | Ga0070678_100000169 | 3300005456 | Bacteria | 28018 |
| 118 | Ga0070678_100003566 | 3300005456 | Bacteria | 8681 |
| 119 | Ga0070678_100005090 | 3300005456 | Bacteria | 7544 |
| 120 | Ga0070678_100006666 | 3300005456 | Bacteria | 6792 |
| 121 | Ga0070678_100008313 | 3300005456 | Bacteria | 6214 |
| 122 | Ga0070678_100140767 | 3300005456 | Bacteria | 1930 |
| 123 | Ga0070662_100000554 | 3300005457 | Bacteria | 22651 |
| 124 | Ga0070662_100030069 | 3300005457 | Bacteria | 3797 |
| 125 | Ga0070662_100303593 | 3300005457 | Bacteria | 1297 |
| 126 | Ga0070681_10006907 | 3300005458 | Bacteria | 11050 |
| 127 | Ga0070681_10017021 | 3300005458 | Bacteria | 7265 |
| 128 | Ga0068867_100001033 | 3300005459 | Bacteria | 19020 |
| 129 | Ga0068867_100002460 | 3300005459 | Bacteria | 13022 |
| 130 | Ga0068867_100011620 | 3300005459 | Bacteria | 6217 |
| 131 | Ga0068867_100047216 | 3300005459 | Bacteria | 3165 |
| 132 | Ga0068867_100049466 | 3300005459 | Bacteria | 3095 |
| 133 | Ga0068867_100052758 | 3300005459 | Bacteria | 3001 |
| 134 | Ga0070685_10000622 | 3300005466 | Bacteria | 19395 |
| 135 | Ga0070685_10046834 | 3300005466 | Bacteria | 2484 |
| 136 | Ga0070706_100018202 | 3300005467 | Bacteria | 6481 |
| 137 | Ga0070706_100082137 | 3300005467 | Bacteria | 2985 |
| 138 | Ga0070698_100129941 | 3300005471 | Bacteria | 2475 |
| 139 | Ga0070698_100156180 | 3300005471 | Bacteria | 2227 |
| 140 | Ga0070699_100050548 | 3300005518 | Bacteria | 3599 |
| 141 | Ga0070699_100173937 | 3300005518 | Bacteria | 1908 |
| 142 | Ga0070679_100262724 | 3300005530 | Bacteria | 1681 |
| 143 | Ga0070679_100274174 | 3300005530 | Bacteria | 1640 |
| 144 | Ga0070679_100411152 | 3300005530 | Bacteria | 1299 |
| 145 | Ga0070684_100001168 | 3300005535 | Bacteria | 18835 |
| 146 | Ga0070684_100025993 | 3300005535 | Bacteria | 4927 |
| 147 | Ga0070684_100338663 | 3300005535 | Bacteria | 1383 |
| 148 | Ga0070697_100063348 | 3300005536 | Bacteria | 3019 |
| 149 | Ga0068853_100009737 | 3300005539 | Bacteria | 7752 |
| 150 | Ga0068853_100013365 | 3300005539 | Bacteria | 6702 |
| 151 | Ga0068853_100016992 | 3300005539 | Bacteria | 5999 |
| 152 | Ga0068853_100096733 | 3300005539 | Bacteria | 2605 |
| 153 | Ga0068853_100197559 | 3300005539 | Bacteria | 1829 |
| 154 | Ga0068853_100247661 | 3300005539 | Bacteria | 1634 |
| 155 | Ga0068853_100343645 | 3300005539 | Bacteria | 1387 |
| 156 | Ga0070672_100000853 | 3300005543 | Bacteria | 18220 |
| 157 | Ga0070672_100005197 | 3300005543 | Bacteria | 8609 |
| 158 | Ga0070672_100021220 | 3300005543 | Bacteria | 4749 |
| 159 | Ga0070672_100045668 | 3300005543 | Bacteria | 3390 |
| 160 | Ga0070672_100072600 | 3300005543 | Bacteria | 2740 |
| 161 | Ga0070672_100206712 | 3300005543 | Bacteria | 1643 |
| 162 | Ga0070686_100039973 | 3300005544 | Bacteria | 2925 |
| 163 | Ga0070696_100002477 | 3300005546 | Bacteria | 12236 |
| 164 | Ga0070696_100105940 | 3300005546 | Bacteria | 2020 |
| 165 | Ga0070693_100002942 | 3300005547 | Bacteria | 7872 |
| 166 | Ga0070665_100001395 | 3300005548 | Bacteria | 28413 |
| 167 | Ga0070665_100003175 | 3300005548 | Bacteria | 17687 |
| 168 | Ga0070665_100003807 | 3300005548 | Bacteria | 15975 |
| 169 | Ga0070665_100061175 | 3300005548 | Bacteria | 3775 |
| 170 | Ga0070665_100066705 | 3300005548 | Bacteria | 3610 |
| 171 | Ga0070704_100034064 | 3300005549 | Bacteria | 3450 |
| 172 | Ga0070704_100048997 | 3300005549 | Bacteria | 2960 |
| 173 | Ga0068855_100007680 | 3300005563 | Bacteria | 13030 |
| 174 | Ga0068855_100030425 | 3300005563 | Bacteria | 6458 |
| 175 | Ga0068855_100030945 | 3300005563 | Bacteria | 6395 |
| 176 | Ga0068855_100045063 | 3300005563 | Bacteria | 5217 |
| 177 | Ga0068855_100129444 | 3300005563 | Bacteria | 2884 |
| 178 | Ga0068855_100183612 | 3300005563 | Bacteria | 2364 |
| 179 | Ga0068855_100328741 | 3300005563 | Bacteria | 1688 |
| 180 | Ga0070664_100000572 | 3300005564 | Bacteria | 28020 |
| 181 | Ga0070664_100004095 | 3300005564 | Bacteria | 11709 |
| 182 | Ga0070664_100029911 | 3300005564 | Bacteria | 4541 |
| 183 | Ga0070664_100084109 | 3300005564 | Bacteria | 2746 |
| 184 | Ga0070664_100101744 | 3300005564 | Bacteria | 2499 |
| 185 | Ga0070664_100132311 | 3300005564 | Bacteria | 2191 |
| 186 | Ga0070664_100136900 | 3300005564 | Bacteria | 2154 |
| 187 | Ga0070664_100141451 | 3300005564 | Bacteria | 2119 |
| 188 | Ga0070664_100281639 | 3300005564 | Bacteria | 1499 |
| 189 | Ga0068857_100000465 | 3300005577 | Bacteria | 28816 |
| 190 | Ga0068857_100360528 | 3300005577 | Bacteria | 1347 |
| 191 | Ga0068854_100008411 | 3300005578 | Bacteria | 6633 |
| 192 | Ga0068854_100024306 | 3300005578 | Bacteria | 4146 |
| 193 | Ga0068854_100026753 | 3300005578 | Bacteria | 3968 |
| 194 | Ga0068854_100042845 | 3300005578 | Bacteria | 3205 |
| 195 | Ga0068854_100045389 | 3300005578 | Bacteria | 3124 |
| 196 | Ga0068854_100100406 | 3300005578 | Bacteria | 2168 |
| 197 | Ga0068854_100311438 | 3300005578 | Unclassified | 1277 |
| 198 | Ga0068856_100000962 | 3300005614 | Bacteria | 30736 |
| 199 | Ga0068856_100001205 | 3300005614 | Bacteria | 27150 |
| 200 | Ga0068856_100003469 | 3300005614 | Bacteria | 15937 |
| 201 | Ga0068856_100045436 | 3300005614 | Bacteria | 4325 |
| 202 | Ga0068856_100143504 | 3300005614 | Bacteria | 2395 |
| 203 | Ga0068856_100295722 | 3300005614 | Bacteria | 1636 |
| 204 | Ga0070702_100032385 | 3300005615 | Bacteria | 2868 |
| 205 | Ga0070702_100242044 | 3300005615 | Bacteria | 1218 |
| 206 | Ga0068852_100022082 | 3300005616 | Bacteria | 5096 |
| 207 | Ga0068852_100059049 | 3300005616 | Bacteria | 3325 |
| 208 | Ga0068852_100086600 | 3300005616 | Bacteria | 2793 |
| 209 | Ga0068852_100233925 | 3300005616 | Bacteria | 1753 |
| 210 | Ga0068852_100289191 | 3300005616 | Bacteria | 1583 |
| 211 | Ga0068859_100003107 | 3300005617 | Bacteria | 16861 |
| 212 | Ga0068859_100028321 | 3300005617 | Bacteria | 5616 |
| 213 | Ga0068859_100159151 | 3300005617 | Bacteria | 2337 |
| 214 | Ga0068859_100243831 | 3300005617 | Bacteria | 1886 |
| 215 | Ga0068864_100000836 | 3300005618 | Bacteria | 25975 |
| 216 | Ga0068864_100003838 | 3300005618 | Bacteria | 12389 |
| 217 | Ga0068864_100007835 | 3300005618 | Bacteria | 8802 |
| 218 | Ga0068864_100017807 | 3300005618 | Bacteria | 5926 |
| 219 | Ga0068864_100033445 | 3300005618 | Bacteria | 4370 |
| 220 | Ga0068864_100036849 | 3300005618 | Bacteria | 4171 |
| 221 | Ga0068864_100082286 | 3300005618 | Bacteria | 2824 |
| 222 | Ga0068866_10013319 | 3300005718 | Bacteria | 3605 |
| 223 | Ga0068866_10036721 | 3300005718 | Bacteria | 2401 |
| 224 | Ga0068861_100024274 | 3300005719 | Bacteria | 4384 |
| 225 | Ga0068861_100218085 | 3300005719 | Bacteria | 1611 |
| 226 | Ga0068851_10003303 | 3300005834 | Bacteria | 7162 |
| 227 | Ga0068851_10024479 | 3300005834 | Bacteria | 2956 |
| 228 | Ga0068870_10006880 | 3300005840 | Bacteria | 5045 |
| 229 | Ga0068870_10011964 | 3300005840 | Bacteria | 4040 |
| 230 | Ga0068870_10023079 | 3300005840 | Bacteria | 3064 |
| 231 | Ga0068863_100004444 | 3300005841 | Bacteria | 13828 |
| 232 | Ga0068863_100021653 | 3300005841 | Bacteria | 6131 |
| 233 | Ga0068863_100089700 | 3300005841 | Bacteria | 2915 |
| 234 | Ga0068863_100240337 | 3300005841 | Bacteria | 1748 |
| 235 | Ga0068863_100414764 | 3300005841 | Bacteria | 1318 |
| 236 | Ga0068863_100528265 | 3300005841 | Bacteria | 1164 |
| 237 | Ga0068858_100002758 | 3300005842 | Bacteria | 17655 |
| 238 | Ga0068858_100006556 | 3300005842 | Bacteria | 11322 |
| 239 | Ga0068860_100005292 | 3300005843 | Bacteria | 13096 |
| 240 | Ga0068860_100008429 | 3300005843 | Bacteria | 10267 |
| 241 | Ga0068860_100012285 | 3300005843 | Bacteria | 8439 |
| 242 | Ga0068860_100023819 | 3300005843 | Bacteria | 5918 |
| 243 | Ga0068860_100030713 | 3300005843 | Bacteria | 5167 |
| 244 | Ga0068862_100028779 | 3300005844 | Bacteria | 4679 |
| 245 | Ga0081455_10219774 | 3300005937 | Bacteria | 1409 |
| 246 | Ga0081539_10085150 | 3300005985 | Bacteria | 1650 |
| 247 | Ga0070715_10037871 | 3300006163 | Bacteria | 1999 |
| 248 | Ga0070716_100050375 | 3300006173 | Bacteria | 2363 |
| 249 | Ga0070716_100133010 | 3300006173 | Bacteria | 1575 |
| 250 | Ga0070712_100002822 | 3300006175 | Bacteria | 10750 |
| 251 | Ga0070712_100178923 | 3300006175 | Bacteria | 1651 |
| 252 | Ga0075366_10009362 | 3300006195 | Bacteria | 5466 |
| 253 | Ga0097621_100007062 | 3300006237 | Bacteria | 8002 |
| 254 | Ga0097621_100057224 | 3300006237 | Bacteria | 3187 |
| 255 | Ga0097621_100074891 | 3300006237 | Bacteria | 2804 |
| 256 | Ga0097621_100104172 | 3300006237 | Bacteria | 2390 |
| 257 | Ga0097621_100127121 | 3300006237 | Bacteria | 2166 |
| 258 | Ga0097621_100226331 | 3300006237 | Bacteria | 1631 |
| 259 | Ga0068871_100003622 | 3300006358 | Bacteria | 10614 |
| 260 | Ga0068871_100009799 | 3300006358 | Bacteria | 6951 |
| 261 | Ga0068871_100300825 | 3300006358 | Bacteria | 1408 |
| 262 | Ga0068871_100400965 | 3300006358 | Bacteria | 1221 |
| 263 | Ga0075428_100488200 | 3300006844 | Bacteria | 1318 |
| 264 | Ga0075433_10024408 | 3300006852 | Bacteria | 5102 |
| 265 | Ga0075433_10086669 | 3300006852 | Bacteria | 2765 |
| 266 | Ga0075434_100171298 | 3300006871 | Bacteria | 2191 |
| 267 | Ga0068865_100015911 | 3300006881 | Bacteria | 4804 |
| 268 | Ga0068865_100030540 | 3300006881 | Bacteria | 3585 |
| 269 | Ga0068865_100122854 | 3300006881 | Bacteria | 1934 |
| 270 | Ga0075436_100040081 | 3300006914 | Bacteria | 3232 |
| 271 | Ga0075436_100091240 | 3300006914 | Bacteria | 2118 |
| 272 | Ga0097620_100003107 | 3300006931 | Bacteria | 16861 |
| 273 | Ga0097620_100028318 | 3300006931 | Bacteria | 5616 |
| 274 | Ga0097620_100159153 | 3300006931 | Bacteria | 2337 |
| 275 | Ga0097620_100243837 | 3300006931 | Bacteria | 1886 |
| 276 | Ga0075435_100058306 | 3300007076 | Bacteria | 3126 |
| 277 | Ga0075435_100157679 | 3300007076 | Bacteria | 1910 |
| 278 | Ga0075435_100169732 | 3300007076 | Bacteria | 1840 |
| 279 | Ga0105240_10010941 | 3300009093 | Bacteria | 12710 |
| 280 | Ga0105240_10148561 | 3300009093 | Bacteria | 2793 |
| 281 | Ga0105240_10288021 | 3300009093 | Bacteria | 1884 |
| 282 | Ga0111539_10051311 | 3300009094 | Bacteria | 4914 |
| 283 | Ga0105245_10026765 | 3300009098 | Bacteria | 5078 |
| 284 | Ga0105245_10263450 | 3300009098 | Bacteria | 1678 |
| 285 | Ga0114129_10064248 | 3300009147 | Bacteria | 5122 |
| 286 | Ga0105243_10108611 | 3300009148 | Bacteria | 2316 |
| 287 | Ga0105241_10285681 | 3300009174 | Bacteria | 1411 |
| 288 | Ga0105241_10295580 | 3300009174 | Bacteria | 1388 |
| 289 | Ga0105241_10295943 | 3300009174 | Bacteria | 1387 |
| 290 | Ga0105241_10367499 | 3300009174 | Bacteria | 1253 |
| 291 | Ga0105242_10059031 | 3300009176 | Bacteria | 3147 |
| 292 | Ga0105248_10007610 | 3300009177 | Bacteria | 11898 |
| 293 | Ga0105248_10019862 | 3300009177 | Bacteria | 7441 |
| 294 | Ga0105248_10047229 | 3300009177 | Bacteria | 4828 |
| 295 | Ga0105248_10048455 | 3300009177 | Bacteria | 4767 |
| 296 | Ga0105248_10064781 | 3300009177 | Bacteria | 4103 |
| 297 | Ga0105248_10091786 | 3300009177 | Bacteria | 3420 |
| 298 | Ga0105248_10222372 | 3300009177 | Bacteria | 2126 |
| 299 | Ga0105248_10508095 | 3300009177 | Bacteria | 1359 |
| 300 | Ga0105237_10151393 | 3300009545 | Bacteria | 2316 |
| 301 | Ga0105237_10241390 | 3300009545 | Bacteria | 1808 |
| 302 | Ga0105238_10000817 | 3300009551 | Bacteria | 32236 |
| 303 | Ga0105238_10050122 | 3300009551 | Bacteria | 4203 |
| 304 | Ga0105238_10180310 | 3300009551 | Bacteria | 2089 |
| 305 | Ga0105249_10175248 | 3300009553 | Bacteria | 2083 |
| 306 | Ga0105249_10214776 | 3300009553 | Bacteria | 1890 |
| 307 | Ga0105239_10331116 | 3300010375 | Bacteria | 1718 |
| 308 | Ga0157373_10005680 | 3300013100 | Bacteria | 9346 |
| 309 | Ga0157373_10008074 | 3300013100 | Bacteria | 7821 |
| 310 | Ga0157371_10056803 | 3300013102 | Bacteria | 2776 |
| 311 | Ga0157370_10011500 | 3300013104 | Bacteria | 9248 |
| 312 | Ga0157370_10040922 | 3300013104 | Bacteria | 4473 |
| 313 | Ga0157370_10213273 | 3300013104 | Bacteria | 1789 |
| 314 | Ga0157369_10009759 | 3300013105 | Bacteria | 10979 |
| 315 | Ga0157369_10049473 | 3300013105 | Bacteria | 4557 |
| 316 | Ga0157369_10095343 | 3300013105 | Bacteria | 3175 |
| 317 | Ga0157369_10100523 | 3300013105 | Bacteria | 3083 |
| 318 | Ga0157369_10112711 | 3300013105 | Bacteria | 2889 |
| 319 | Ga0157369_10445662 | 3300013105 | Bacteria | 1341 |
| 320 | Ga0157374_10003153 | 3300013296 | Bacteria | 13861 |
| 321 | Ga0157374_10008326 | 3300013296 | Bacteria | 8851 |
| 322 | Ga0157374_10107749 | 3300013296 | Bacteria | 2678 |
| 323 | Ga0157374_10114068 | 3300013296 | Bacteria | 2601 |
| 324 | Ga0157374_10424998 | 3300013296 | Bacteria | 1328 |
| 325 | Ga0157374_10722622 | 3300013296 | Unclassified | 1010 |
| 326 | Ga0157378_10061343 | 3300013297 | Bacteria | 3355 |
| 327 | Ga0157378_10082858 | 3300013297 | Bacteria | 2901 |
| 328 | Ga0157378_10089570 | 3300013297 | Bacteria | 2795 |
| 329 | Ga0163162_10004211 | 3300013306 | Bacteria | 13826 |
| 330 | Ga0163162_10033285 | 3300013306 | Bacteria | 5121 |
| 331 | Ga0163162_10038651 | 3300013306 | Bacteria | 4763 |
| 332 | Ga0163162_10149177 | 3300013306 | Bacteria | 2455 |
| 333 | Ga0163162_10326385 | 3300013306 | Bacteria | 1667 |
| 334 | Ga0163162_10332843 | 3300013306 | Bacteria | 1651 |
| 335 | Ga0163162_10496920 | 3300013306 | Bacteria | 1350 |
| 336 | Ga0157372_10002230 | 3300013307 | Bacteria | 21023 |
| 337 | Ga0157372_10009688 | 3300013307 | Bacteria | 10241 |
| 338 | Ga0157372_10039603 | 3300013307 | Bacteria | 5202 |
| 339 | Ga0157372_10161335 | 3300013307 | Bacteria | 2591 |
| 340 | Ga0157372_10524910 | 3300013307 | Bacteria | 1380 |
| 341 | Ga0157372_10646756 | 3300013307 | Bacteria | 1231 |
| 342 | Ga0157375_10002925 | 3300013308 | Bacteria | 14813 |
| 343 | Ga0157375_10004445 | 3300013308 | Bacteria | 12179 |
| 344 | Ga0157375_10006293 | 3300013308 | Bacteria | 10340 |
| 345 | Ga0157375_10030861 | 3300013308 | Bacteria | 5059 |
| 346 | Ga0157375_10228450 | 3300013308 | Bacteria | 2020 |
| 347 | Ga0157375_10246814 | 3300013308 | Bacteria | 1946 |
| 348 | Ga0157375_10372750 | 3300013308 | Bacteria | 1594 |
| 349 | Ga0163163_10001349 | 3300014325 | Bacteria | 20707 |
| 350 | Ga0163163_10019983 | 3300014325 | Bacteria | 6301 |
| 351 | Ga0163163_10056449 | 3300014325 | Bacteria | 3881 |
| 352 | Ga0163163_10128098 | 3300014325 | Bacteria | 2577 |
| 353 | Ga0157380_10054683 | 3300014326 | Bacteria | 3169 |
| 354 | Ga0157380_10228374 | 3300014326 | Bacteria | 1670 |
| 355 | Ga0157377_10040366 | 3300014745 | Bacteria | 2584 |
| 356 | Ga0157377_10135002 | 3300014745 | Bacteria | 1511 |
| 357 | Ga0157379_10001289 | 3300014968 | Bacteria | 20426 |
| 358 | Ga0157379_10141967 | 3300014968 | Bacteria | 2165 |
| 359 | Ga0157379_10295898 | 3300014968 | Bacteria | 1475 |
| 360 | Ga0157379_10408444 | 3300014968 | Bacteria | 1249 |
| 361 | Ga0157379_10435052 | 3300014968 | Bacteria | 1209 |
| 362 | Ga0157376_10020955 | 3300014969 | Bacteria | 5069 |
| 363 | Ga0157376_10110923 | 3300014969 | Bacteria | 2414 |
| 364 | Ga0157376_10259253 | 3300014969 | Bacteria | 1628 |
| 365 | Ga0157376_10403759 | 3300014969 | Bacteria | 1322 |
| 366 | Ga0157376_10469363 | 3300014969 | Bacteria | 1231 |
| 367 | Ga0163161_10020325 | 3300017792 | Bacteria | 4659 |
| 368 | Ga0163161_10086797 | 3300017792 | Bacteria | 2310 |
| 369 | Ga0163161_10453601 | 3300017792 | Bacteria | 1037 |
| 370 | Ga0207697_10003677 | 3300025315 | Bacteria | 7512 |
| 371 | Ga0207697_10028744 | 3300025315 | Bacteria | 2275 |
| 372 | Ga0207697_10034310 | 3300025315 | Bacteria | 2077 |
| 373 | Ga0207656_10017284 | 3300025321 | Bacteria | 2822 |
| 374 | Ga0207682_10000010 | 3300025893 | Bacteria | 85697 |
| 375 | Ga0207682_10000483 | 3300025893 | Bacteria | 18458 |
| 376 | Ga0207682_10019839 | 3300025893 | Bacteria | 2635 |
| 377 | Ga0207682_10029387 | 3300025893 | Bacteria | 2198 |
| 378 | Ga0207692_10007307 | 3300025898 | Bacteria | 4521 |
| 379 | Ga0207688_10012323 | 3300025901 | Bacteria | 4654 |
| 380 | Ga0207680_10007835 | 3300025903 | Bacteria | 5221 |
| 381 | Ga0207680_10063053 | 3300025903 | Bacteria | 2267 |
| 382 | Ga0207680_10064584 | 3300025903 | Bacteria | 2245 |
| 383 | Ga0207685_10012197 | 3300025905 | Bacteria | 2614 |
| 384 | Ga0207699_10005093 | 3300025906 | Bacteria | 6288 |
| 385 | Ga0207699_10261451 | 3300025906 | Bacteria | 1196 |
| 386 | Ga0207645_10000617 | 3300025907 | Bacteria | 29514 |
| 387 | Ga0207645_10006124 | 3300025907 | Bacteria | 8642 |
| 388 | Ga0207645_10009628 | 3300025907 | Bacteria | 6676 |
| 389 | Ga0207645_10010911 | 3300025907 | Bacteria | 6221 |
| 390 | Ga0207645_10027594 | 3300025907 | Bacteria | 3665 |
| 391 | Ga0207645_10148079 | 3300025907 | Bacteria | 1531 |
| 392 | Ga0207643_10000339 | 3300025908 | Bacteria | 31901 |
| 393 | Ga0207643_10004283 | 3300025908 | Bacteria | 7676 |
| 394 | Ga0207643_10022770 | 3300025908 | Bacteria | 3452 |
| 395 | Ga0207643_10033369 | 3300025908 | Bacteria | 2880 |
| 396 | Ga0207705_10227912 | 3300025909 | Bacteria | 1417 |
| 397 | Ga0207684_10014702 | 3300025910 | Bacteria | 6742 |
| 398 | Ga0207654_10052805 | 3300025911 | Bacteria | 2344 |
| 399 | Ga0207654_10175524 | 3300025911 | Bacteria | 1394 |
| 400 | Ga0207707_10024845 | 3300025912 | Bacteria | 5240 |
| 401 | Ga0207707_10048067 | 3300025912 | Bacteria | 3717 |
| 402 | Ga0207707_10103171 | 3300025912 | Bacteria | 2493 |
| 403 | Ga0207707_10143861 | 3300025912 | Bacteria | 2084 |
| 404 | Ga0207695_10019928 | 3300025913 | Bacteria | 7703 |
| 405 | Ga0207695_10023248 | 3300025913 | Bacteria | 7011 |
| 406 | Ga0207695_10065559 | 3300025913 | Bacteria | 3734 |
| 407 | Ga0207693_10003564 | 3300025915 | Bacteria | 13301 |
| 408 | Ga0207693_10017562 | 3300025915 | Bacteria | 5704 |
| 409 | Ga0207663_10018700 | 3300025916 | Bacteria | 3889 |
| 410 | Ga0207660_10014493 | 3300025917 | Bacteria | 5187 |
| 411 | Ga0207660_10073160 | 3300025917 | Bacteria | 2498 |
| 412 | Ga0207660_10157034 | 3300025917 | Bacteria | 1752 |
| 413 | Ga0207662_10047986 | 3300025918 | Bacteria | 2529 |
| 414 | Ga0207657_10000329 | 3300025919 | Bacteria | 50461 |
| 415 | Ga0207657_10002457 | 3300025919 | Bacteria | 20027 |
| 416 | Ga0207657_10003687 | 3300025919 | Bacteria | 16291 |
| 417 | Ga0207657_10008004 | 3300025919 | Bacteria | 10775 |
| 418 | Ga0207657_10015277 | 3300025919 | Bacteria | 7444 |
| 419 | Ga0207657_10099847 | 3300025919 | Bacteria | 2410 |
| 420 | Ga0207649_10011058 | 3300025920 | Bacteria | 4966 |
| 421 | Ga0207649_10039155 | 3300025920 | Bacteria | 2872 |
| 422 | Ga0207649_10060934 | 3300025920 | Bacteria | 2373 |
| 423 | Ga0207652_10005308 | 3300025921 | Bacteria | 10455 |
| 424 | Ga0207652_10132418 | 3300025921 | Bacteria | 2225 |
| 425 | Ga0207652_10197046 | 3300025921 | Bacteria | 1812 |
| 426 | Ga0207646_10449050 | 3300025922 | Bacteria | 1163 |
| 427 | Ga0207681_10004220 | 3300025923 | Bacteria | 8880 |
| 428 | Ga0207681_10026284 | 3300025923 | Bacteria | 3753 |
| 429 | Ga0207681_10100216 | 3300025923 | Bacteria | 2088 |
| 430 | Ga0207681_10360033 | 3300025923 | Bacteria | 1166 |
| 431 | Ga0207694_10002353 | 3300025924 | Bacteria | 15459 |
| 432 | Ga0207694_10020347 | 3300025924 | Bacteria | 5019 |
| 433 | Ga0207650_10017431 | 3300025925 | Bacteria | 5030 |
| 434 | Ga0207650_10068939 | 3300025925 | Bacteria | 2657 |
| 435 | Ga0207650_10149330 | 3300025925 | Bacteria | 1843 |
| 436 | Ga0207650_10378751 | 3300025925 | Bacteria | 1168 |
| 437 | Ga0207659_10010401 | 3300025926 | Bacteria | 5848 |
| 438 | Ga0207659_10025052 | 3300025926 | Bacteria | 4005 |
| 439 | Ga0207687_10006270 | 3300025927 | Bacteria | 7868 |
| 440 | Ga0207700_10000120 | 3300025928 | Bacteria | 46325 |
| 441 | Ga0207700_10042935 | 3300025928 | Bacteria | 3318 |
| 442 | Ga0207700_10080174 | 3300025928 | Bacteria | 2545 |
| 443 | Ga0207700_10083234 | 3300025928 | Bacteria | 2504 |
| 444 | Ga0207664_10002996 | 3300025929 | Bacteria | 11219 |
| 445 | Ga0207664_10038069 | 3300025929 | Bacteria | 3727 |
| 446 | Ga0207664_10076114 | 3300025929 | Bacteria | 2715 |
| 447 | Ga0207644_10003463 | 3300025931 | Bacteria | 10198 |
| 448 | Ga0207644_10005068 | 3300025931 | Bacteria | 8599 |
| 449 | Ga0207644_10096470 | 3300025931 | Bacteria | 2213 |
| 450 | Ga0207644_10109199 | 3300025931 | Bacteria | 2090 |
| 451 | Ga0207644_10183705 | 3300025931 | Bacteria | 1640 |
| 452 | Ga0207644_10275831 | 3300025931 | Bacteria | 1349 |
| 453 | Ga0207690_10001354 | 3300025932 | Bacteria | 15380 |
| 454 | Ga0207690_10004135 | 3300025932 | Bacteria | 8575 |
| 455 | Ga0207690_10073730 | 3300025932 | Bacteria | 2362 |
| 456 | Ga0207690_10262516 | 3300025932 | Bacteria | 1338 |
| 457 | Ga0207690_10307624 | 3300025932 | Bacteria | 1242 |
| 458 | Ga0207690_10372730 | 3300025932 | Bacteria | 1133 |
| 459 | Ga0207706_10000133 | 3300025933 | Bacteria | 80935 |
| 460 | Ga0207706_10012488 | 3300025933 | Bacteria | 7739 |
| 461 | Ga0207706_10144761 | 3300025933 | Bacteria | 2091 |
| 462 | Ga0207706_10203781 | 3300025933 | Bacteria | 1735 |
| 463 | Ga0207706_10347311 | 3300025933 | Bacteria | 1290 |
| 464 | Ga0207686_10003125 | 3300025934 | Bacteria | 8907 |
| 465 | Ga0207686_10117516 | 3300025934 | Bacteria | 1804 |
| 466 | Ga0207670_10011023 | 3300025936 | Bacteria | 5228 |
| 467 | Ga0207669_10007186 | 3300025937 | Bacteria | 5128 |
| 468 | Ga0207669_10021653 | 3300025937 | Bacteria | 3399 |
| 469 | Ga0207669_10062882 | 3300025937 | Bacteria | 2288 |
| 470 | Ga0207669_10159484 | 3300025937 | Bacteria | 1591 |
| 471 | Ga0207669_10160125 | 3300025937 | Bacteria | 1589 |
| 472 | Ga0207704_10256256 | 3300025938 | Bacteria | 1316 |
| 473 | Ga0207704_10308065 | 3300025938 | Bacteria | 1216 |
| 474 | Ga0207665_10053124 | 3300025939 | Bacteria | 2731 |
| 475 | Ga0207665_10159377 | 3300025939 | Bacteria | 1622 |
| 476 | Ga0207691_10000170 | 3300025940 | Bacteria | 60463 |
| 477 | Ga0207691_10000282 | 3300025940 | Bacteria | 50196 |
| 478 | Ga0207691_10001454 | 3300025940 | Bacteria | 23591 |
| 479 | Ga0207691_10079879 | 3300025940 | Bacteria | 2943 |
| 480 | Ga0207691_10107741 | 3300025940 | Bacteria | 2480 |
| 481 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 482 | Ga0207711_10016910 | 3300025941 | Bacteria | 6059 |
| 483 | Ga0207711_10053481 | 3300025941 | Bacteria | 3463 |
| 484 | Ga0207711_10079496 | 3300025941 | Bacteria | 2862 |
| 485 | Ga0207711_10162236 | 3300025941 | Bacteria | 2024 |
| 486 | Ga0207711_10330269 | 3300025941 | Bacteria | 1410 |
| 487 | Ga0207689_10010112 | 3300025942 | Bacteria | 8136 |
| 488 | Ga0207689_10019564 | 3300025942 | Bacteria | 5705 |
| 489 | Ga0207689_10021123 | 3300025942 | Bacteria | 5472 |
| 490 | Ga0207689_10038725 | 3300025942 | Bacteria | 3947 |
| 491 | Ga0207689_10049651 | 3300025942 | Bacteria | 3461 |
| 492 | Ga0207661_10012274 | 3300025944 | Bacteria | 6222 |
| 493 | Ga0207661_10370111 | 3300025944 | Bacteria | 1295 |
| 494 | Ga0207679_10003266 | 3300025945 | Bacteria | 10015 |
| 495 | Ga0207679_10005340 | 3300025945 | Bacteria | 8055 |
| 496 | Ga0207679_10011079 | 3300025945 | Bacteria | 5822 |
| 497 | Ga0207679_10090603 | 3300025945 | Bacteria | 2364 |
| 498 | Ga0207679_10119664 | 3300025945 | Bacteria | 2094 |
| 499 | Ga0207679_10128937 | 3300025945 | Bacteria | 2026 |
| 500 | Ga0207667_10000842 | 3300025949 | Bacteria | 39549 |
| 501 | Ga0207667_10005196 | 3300025949 | Bacteria | 15889 |
| 502 | Ga0207667_10010385 | 3300025949 | Bacteria | 10882 |
| 503 | Ga0207667_10051082 | 3300025949 | Bacteria | 4359 |
| 504 | Ga0207667_10073498 | 3300025949 | Bacteria | 3552 |
| 505 | Ga0207667_10114040 | 3300025949 | Bacteria | 2786 |
| 506 | Ga0207667_10170799 | 3300025949 | Bacteria | 2235 |
| 507 | Ga0207667_10269321 | 3300025949 | Bacteria | 1741 |
| 508 | Ga0207667_10270212 | 3300025949 | Bacteria | 1738 |
| 509 | Ga0207651_10008341 | 3300025960 | Bacteria | 5590 |
| 510 | Ga0207651_10024981 | 3300025960 | Bacteria | 3706 |
| 511 | Ga0207651_10063177 | 3300025960 | Bacteria | 2584 |
| 512 | Ga0207651_10063771 | 3300025960 | Bacteria | 2575 |
| 513 | Ga0207651_10173617 | 3300025960 | Bacteria | 1702 |
| 514 | Ga0207712_10112632 | 3300025961 | Bacteria | 2043 |
| 515 | Ga0207668_10006170 | 3300025972 | Bacteria | 7070 |
| 516 | Ga0207668_10045956 | 3300025972 | Bacteria | 2980 |
| 517 | Ga0207668_10303046 | 3300025972 | Bacteria | 1319 |
| 518 | Ga0207668_10433410 | 3300025972 | Bacteria | 1118 |
| 519 | Ga0207640_10037178 | 3300025981 | Bacteria | 3061 |
| 520 | Ga0207640_10053421 | 3300025981 | Bacteria | 2637 |
| 521 | Ga0207640_10301188 | 3300025981 | Bacteria | 1268 |
| 522 | Ga0207658_10003932 | 3300025986 | Bacteria | 10446 |
| 523 | Ga0207658_10019214 | 3300025986 | Bacteria | 4725 |
| 524 | Ga0207658_10025921 | 3300025986 | Bacteria | 4107 |
| 525 | Ga0207658_10032868 | 3300025986 | Bacteria | 3696 |
| 526 | Ga0207658_10105264 | 3300025986 | Bacteria | 2218 |
| 527 | Ga0207658_10395095 | 3300025986 | Bacteria | 1214 |
| 528 | Ga0207677_10000188 | 3300026023 | Bacteria | 49751 |
| 529 | Ga0207677_10030318 | 3300026023 | Bacteria | 3450 |
| 530 | Ga0207677_10128029 | 3300026023 | Bacteria | 1922 |
| 531 | Ga0207677_10290777 | 3300026023 | Bacteria | 1346 |
| 532 | Ga0207703_10000806 | 3300026035 | Bacteria | 30873 |
| 533 | Ga0207703_10048664 | 3300026035 | Bacteria | 3423 |
| 534 | Ga0207703_10084450 | 3300026035 | Bacteria | 2655 |
| 535 | Ga0207703_10265382 | 3300026035 | Bacteria | 1553 |
| 536 | Ga0207703_10319164 | 3300026035 | Bacteria | 1422 |
| 537 | Ga0207639_10006373 | 3300026041 | Bacteria | 8016 |
| 538 | Ga0207639_10042654 | 3300026041 | Bacteria | 3401 |
| 539 | Ga0207639_10244849 | 3300026041 | Bacteria | 1561 |
| 540 | Ga0207678_10002750 | 3300026067 | Bacteria | 15930 |
| 541 | Ga0207678_10005798 | 3300026067 | Bacteria | 11009 |
| 542 | Ga0207678_10009500 | 3300026067 | Bacteria | 8556 |
| 543 | Ga0207708_10007278 | 3300026075 | Bacteria | 8183 |
| 544 | Ga0207708_10019956 | 3300026075 | Bacteria | 5053 |
| 545 | Ga0207702_10005844 | 3300026078 | Bacteria | 10700 |
| 546 | Ga0207702_10010663 | 3300026078 | Bacteria | 7678 |
| 547 | Ga0207702_10014222 | 3300026078 | Bacteria | 6609 |
| 548 | Ga0207702_10089675 | 3300026078 | Bacteria | 2689 |
| 549 | Ga0207702_10293779 | 3300026078 | Bacteria | 1540 |
| 550 | Ga0207641_10004545 | 3300026088 | Bacteria | 11992 |
| 551 | Ga0207641_10004745 | 3300026088 | Bacteria | 11717 |
| 552 | Ga0207641_10020334 | 3300026088 | Bacteria | 5452 |
| 553 | Ga0207641_10022283 | 3300026088 | Bacteria | 5213 |
| 554 | Ga0207641_10233487 | 3300026088 | Bacteria | 1710 |
| 555 | Ga0207641_10374249 | 3300026088 | Bacteria | 1362 |
| 556 | Ga0207648_10000203 | 3300026089 | Bacteria | 63192 |
| 557 | Ga0207648_10000605 | 3300026089 | Bacteria | 40285 |
| 558 | Ga0207648_10007681 | 3300026089 | Bacteria | 10551 |
| 559 | Ga0207648_10014175 | 3300026089 | Bacteria | 7371 |
| 560 | Ga0207648_10063485 | 3300026089 | Bacteria | 3219 |
| 561 | Ga0207648_10082574 | 3300026089 | Bacteria | 2802 |
| 562 | Ga0207676_10000230 | 3300026095 | Bacteria | 48620 |
| 563 | Ga0207676_10021161 | 3300026095 | Bacteria | 4770 |
| 564 | Ga0207676_10025352 | 3300026095 | Bacteria | 4399 |
| 565 | Ga0207676_10037003 | 3300026095 | Bacteria | 3716 |
| 566 | Ga0207676_10145613 | 3300026095 | Bacteria | 2034 |
| 567 | Ga0207676_10331704 | 3300026095 | Bacteria | 1400 |
| 568 | Ga0207674_10000182 | 3300026116 | Bacteria | 77228 |
| 569 | Ga0207674_10001017 | 3300026116 | Bacteria | 36653 |
| 570 | Ga0207674_10066702 | 3300026116 | Bacteria | 3624 |
| 571 | Ga0207674_10101644 | 3300026116 | Bacteria | 2855 |
| 572 | Ga0207674_10383496 | 3300026116 | Bacteria | 1359 |
| 573 | Ga0207675_100004007 | 3300026118 | Bacteria | 14287 |
| 574 | Ga0207675_100023790 | 3300026118 | Bacteria | 5700 |
| 575 | Ga0207675_100042323 | 3300026118 | Bacteria | 4252 |
| 576 | Ga0207675_100244321 | 3300026118 | Bacteria | 1735 |
| 577 | Ga0207675_100505670 | 3300026118 | Bacteria | 1203 |
| 578 | Ga0207683_10000005 | 3300026121 | Bacteria | 187889 |
| 579 | Ga0207683_10000428 | 3300026121 | Bacteria | 38922 |
| 580 | Ga0207683_10001896 | 3300026121 | Bacteria | 18497 |
| 581 | Ga0207683_10016709 | 3300026121 | Bacteria | 6244 |
| 582 | Ga0207683_10036191 | 3300026121 | Bacteria | 4297 |
| 583 | Ga0207698_10012386 | 3300026142 | Bacteria | 5578 |
| 584 | Ga0207698_10033201 | 3300026142 | Bacteria | 3748 |
| 585 | Ga0207698_10297203 | 3300026142 | Bacteria | 1501 |
| 586 | Ga0207698_10398588 | 3300026142 | Bacteria | 1314 |
| 587 | Ga0209995_1002546 | 3300027471 | Bacteria | 2885 |
| 588 | Ga0209999_1022905 | 3300027543 | Bacteria | 1150 |
| 589 | Ga0210002_1003431 | 3300027617 | Bacteria | 2333 |
| 590 | Ga0209983_1008024 | 3300027665 | Bacteria | 2159 |
| 591 | Ga0209983_1014414 | 3300027665 | Bacteria | 1629 |
| 592 | Ga0209966_1002402 | 3300027695 | Bacteria | 3122 |
| 593 | Ga0209974_10000182 | 3300027876 | Bacteria | 19774 |
| 594 | Ga0268266_10002847 | 3300028379 | Bacteria | 18027 |
| 595 | Ga0268266_10014515 | 3300028379 | Bacteria | 6771 |
| 596 | Ga0268266_10041686 | 3300028379 | Bacteria | 3918 |
| 597 | Ga0268266_10129956 | 3300028379 | Bacteria | 2252 |
| 598 | Ga0268266_10305396 | 3300028379 | Bacteria | 1485 |
| 599 | Ga0268265_10051850 | 3300028380 | Bacteria | 3099 |
| 600 | Ga0268264_10003573 | 3300028381 | Bacteria | 13392 |
| 601 | Ga0268264_10004111 | 3300028381 | Bacteria | 12447 |
| 602 | Ga0268264_10018697 | 3300028381 | Bacteria | 5665 |
| 603 | Ga0268264_10144070 | 3300028381 | Bacteria | 2128 |
| 604 | Ga0265330_10002416 | 3300031235 | Bacteria | 10192 |
| 605 | Ga0265332_10001887 | 3300031238 | Bacteria | 11124 |
| 606 | Ga0265332_10005275 | 3300031238 | Bacteria | 5977 |
| 607 | Ga0265328_10072397 | 3300031239 | Bacteria | 1267 |
| 608 | Ga0265325_10008462 | 3300031241 | Bacteria | 6070 |
| 609 | Ga0265329_10007419 | 3300031242 | Bacteria | 4242 |
| 610 | Ga0265340_10118569 | 3300031247 | Bacteria | 1219 |
| 611 | Ga0265339_10078477 | 3300031249 | Bacteria | 1748 |
| 612 | Ga0265327_10008924 | 3300031251 | Bacteria | 7355 |
| 613 | Ga0265316_10005364 | 3300031344 | Bacteria | 12477 |
| 614 | Ga0265316_10006826 | 3300031344 | Bacteria | 10852 |
| 615 | Ga0265316_10038818 | 3300031344 | Bacteria | 3831 |
| 616 | Ga0265316_10049415 | 3300031344 | Bacteria | 3314 |
| 617 | Ga0307408_100061939 | 3300031548 | Bacteria | 2732 |
| 618 | Ga0307508_10074857 | 3300031616 | Bacteria | 2963 |
| 619 | Ga0265314_10004158 | 3300031711 | Bacteria | 13616 |
| 620 | Ga0316576_10032447 | 3300031727 | Unclassified | 3711 |
| 621 | Ga0307410_10061384 | 3300031852 | Bacteria | 2572 |
| 622 | Ga0307406_10002618 | 3300031901 | Bacteria | 9802 |
| 623 | Ga0307407_10018772 | 3300031903 | Bacteria | 3506 |
| 624 | Ga0307412_10003937 | 3300031911 | Bacteria | 8274 |
| 625 | Ga0307416_100003856 | 3300032002 | Bacteria | 8921 |
| 626 | Ga0307411_10262094 | 3300032005 | Bacteria | 1365 |
| 627 | Ga0316580_10008663 | 3300032139 | Unclassified | 3051 |
| 628 | Ga0373944_0010957 | 3300035089 | Bacteria | 2479 |
| 629 | Ga0373923_0003154 | 3300035111 | Bacteria | 5240 |
| 630 | Ga0373954_0010837 | 3300035118 | Bacteria | 4030 |
| 631 | Ga0373956_0120799 | 3300035119 | Bacteria | 1223 |
| 632 | Ga0373957_0012504 | 3300035120 | Bacteria | 2860 |
| 633 | Ga0373943_0023834 | 3300035170 | Bacteria | 2848 |
| 634 | Ga0373943_0064831 | 3300035170 | Bacteria | 1835 |
| 635 | Ga0373955_0032052 | 3300035172 | Bacteria | 2756 |
| 636 | Ga0373955_0056781 | 3300035172 | Bacteria | 2148 |
| 637 | Ga0316574_0012312 | 3300035398 | Bacteria | 4891 |
| 638 | Ga0373931_0047422 | 3300035691 | Bacteria | 2274 |
| 639 | Ga0373931_0133733 | 3300035691 | Bacteria | 1430 |
| 640 | Ga0373935_0014086 | 3300035692 | Bacteria | 4828 |
| 641 | Ga0373935_0154971 | 3300035692 | Bacteria | 1557 |
| 642 | Ga0373935_0217193 | 3300035692 | Bacteria | 1327 |
| 643 | Ga0373927_0028723 | 3300035695 | Bacteria | 3628 |
| 644 | Ga0373933_0015768 | 3300035724 | Bacteria | 4215 |
| 645 | Ga0373947_0024324 | 3300035725 | Bacteria | 3529 |
| 646 | Ga0373947_0184992 | 3300035725 | Bacteria | 1358 |
| 647 | Ga0373937_0011991 | 3300036401 | Bacteria | 7609 |
| 648 | Ga0373937_0050883 | 3300036401 | Bacteria | 3796 |
| 649 | Ga0373937_0062330 | 3300036401 | Bacteria | 3428 |
| 650 | Ga0373937_0248276 | 3300036401 | Bacteria | 1677 |
| 651 | Ga0316582_0006939 | 3300036647 | Bacteria | 5992 |
| 652 | Ga0373925_0049596 | 3300037068 | Bacteria | 3129 |
| 653 | Ga0395900_0036984 | 3300037418 | Bacteria | 5033 |
| 654 | Ga0395898_0238826 | 3300037466 | Bacteria | 1733 |
| 655 | Ga0395901_0191131 | 3300038443 | Bacteria | 2147 |
| 656 | Ga0451853_2406494 | 3300041512 | Bacteria | 1924 |
| 657 | Ga0451577_0010511 | 3300042876 | Bacteria | 8838 |
| 658 | Ga0453683_0190070 | 3300044673 | Bacteria | 1303 |
| 659 | Ga0466963_0104459 | 3300044694 | Bacteria | 1941 |
| 660 | Ga0453684_0001170 | 3300044712 | Bacteria | 81366 |
| 661 | Ga0453684_0023499 | 3300044712 | Bacteria | 9071 |
| 662 | Ga0453684_0291070 | 3300044712 | Bacteria | 1860 |
| 663 | Ga0451576_0001376 | 3300045051 | Bacteria | 41779 |
| 664 | Ga0451576_0032733 | 3300045051 | Bacteria | 5530 |
| 665 | Ga0466958_0188359 | 3300045836 | Bacteria | 1311 |
| 666 | Ga0466967_0336022 | 3300045976 | Bacteria | 1460 |
| 667 | Ga0495629_0032236 | 3300046459 | Bacteria | 3710 |
| 668 | Ga0495580_0078401 | 3300046472 | Bacteria | 2304 |
| 669 | Ga0495580_0112981 | 3300046472 | Bacteria | 1886 |
| 670 | Ga0495582_0038857 | 3300046473 | Bacteria | 2619 |
| 671 | Ga0495664_0014729 | 3300046477 | Bacteria | 4437 |
| 672 | Ga0495642_0065953 | 3300046528 | Bacteria | 1508 |
| 673 | Ga0495645_0105370 | 3300046543 | Bacteria | 2001 |
| 674 | Ga0495635_0064143 | 3300046663 | Bacteria | 2522 |
| 675 | Ga0495647_0005212 | 3300046681 | Bacteria | 4258 |
| 676 | Ga0495658_0124126 | 3300046683 | Bacteria | 1565 |
| 677 | Ga0495613_0025522 | 3300046689 | Bacteria | 4403 |
| 678 | Ga0495581_0004852 | 3300047315 | Bacteria | 7781 |
| 679 | Ga0495684_0012214 | 3300047471 | Bacteria | 6626 |
| 680 | Ga0495684_0143901 | 3300047471 | Bacteria | 1786 |
| 681 | Ga0495684_0297646 | 3300047471 | Bacteria | 1160 |
| 682 | Ga0496100_0025658 | 3300048903 | Bacteria | 3606 |
| 683 | Ga0496101_0069996 | 3300048904 | Bacteria | 2568 |
| 684 | Ga0496101_0133793 | 3300048904 | Bacteria | 1885 |
| 685 | Ga0496102_0068728 | 3300048905 | Bacteria | 3251 |
| 686 | Ga0496102_0185283 | 3300048905 | Bacteria | 1962 |
| 687 | Ga0496103_0062904 | 3300048906 | Bacteria | 2311 |
| 688 | Ga0496104_0024227 | 3300048907 | Bacteria | 5582 |
| 689 | Ga0496104_0217342 | 3300048907 | Bacteria | 1823 |
| 690 | Ga0496105_0016623 | 3300048908 | Bacteria | 5875 |
| 691 | Ga0496106_0000821 | 3300048909 | Bacteria | 22535 |
| 692 | Ga0496106_0325054 | 3300048909 | Bacteria | 1235 |
| 693 | Ga0496107_0097488 | 3300048910 | Bacteria | 2153 |
| 694 | Ga0496107_0173569 | 3300048910 | Bacteria | 1600 |
| 695 | Ga0496108_0017349 | 3300048911 | Bacteria | 5889 |
| 696 | Ga0496108_0226665 | 3300048911 | Bacteria | 1624 |
| 697 | Ga0496109_0034784 | 3300048912 | Bacteria | 4541 |
| 698 | Ga0496109_0038858 | 3300048912 | Bacteria | 4305 |
| 699 | Ga0496109_0056893 | 3300048912 | Bacteria | 3568 |
| 700 | Ga0496109_0487298 | 3300048912 | Bacteria | 1164 |
| 701 | Ga0496110_0082967 | 3300048913 | Bacteria | 2859 |
| 702 | Ga0496112_0031287 | 3300048915 | Bacteria | 5160 |
| 703 | Ga0496113_0519905 | 3300048916 | Bacteria | 955 |
| 704 | Ga0496114_0142042 | 3300048917 | Bacteria | 2079 |
| 705 | nmdc:mga0k408_72027_c1 | 3300050493 | Bacteria | 2018 |
| 706 | nmdc:mga05p37_57695_c1 | 3300050507 | Bacteria | 4781 |
| 707 | nmdc:mga0n895_182014_c1 | 3300050512 | Bacteria | 2133 |
| 708 | nmdc:mga0n895_94823_c1 | 3300050512 | Bacteria | 2988 |
| 709 | nmdc:mga0rr50_129280_c1 | 3300050513 | Bacteria | 2020 |
| 710 | nmdc:mga0rr50_316546_c1 | 3300050513 | Bacteria | 1307 |
| 711 | nmdc:mga0rr50_442489_c1 | 3300050513 | Bacteria | 1101 |
| 712 | nmdc:mga08x19_26694_c1 | 3300050514 | Bacteria | 3604 |
| 713 | nmdc:mga08x19_46304_c1 | 3300050514 | Bacteria | 2781 |
| 714 | nmdc:mga0a205_180331_c1 | 3300050515 | Bacteria | 2006 |
| 715 | nmdc:mga0a205_9988_c1 | 3300050515 | Bacteria | 8710 |
| 716 | Ga0495601_0207454 | 3300053077 | Bacteria | 1280 |
| 717 | Ga0495612_0057663 | 3300053078 | Bacteria | 1604 |
| 718 | Ga0495619_0044721 | 3300053085 | Bacteria | 2907 |
| 719 | Ga0495619_0049784 | 3300053085 | Bacteria | 2764 |
| 720 | Ga0495619_0095902 | 3300053085 | Bacteria | 2013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027617 | Ga0210002_1003431 | Ga0210002_10034312 | 236 |
| 2 | 3300035692 | Ga0373935_0014086 | Ga0373935_0014086_3324_4259 | 237 |
| 3 | 3300013296 | Ga0157374_10424998 | Ga0157374_104249981 | 239 |
| 4 | 3300048916 | Ga0496113_0519905 | Ga0496113_0519905_12_848 | 239 |
| 5 | 3300006844 | Ga0075428_100488200 | Ga0075428_1004882001 | 241 |
| 6 | 3300031616 | Ga0307508_10074857 | Ga0307508_100748572 | 242 |
| 7 | 3300005329 | Ga0070683_100001287 | Ga0070683_10000128710 | 243 |
| 8 | 3300005339 | Ga0070660_100005619 | Ga0070660_1000056197 | 243 |
| 9 | 3300005344 | Ga0070661_100007248 | Ga0070661_1000072484 | 243 |
| 10 | 3300005366 | Ga0070659_100029207 | Ga0070659_1000292072 | 243 |
| 11 | 3300005435 | Ga0070714_100005782 | Ga0070714_1000057822 | 243 |
| 12 | 3300005436 | Ga0070713_100137683 | Ga0070713_1001376832 | 243 |
| 13 | 3300005458 | Ga0070681_10006907 | Ga0070681_100069073 | 243 |
| 14 | 3300005535 | Ga0070684_100001168 | Ga0070684_1000011688 | 243 |
| 15 | 3300005539 | Ga0068853_100016992 | Ga0068853_1000169927 | 243 |
| 16 | 3300005563 | Ga0068855_100030425 | Ga0068855_1000304254 | 243 |
| 17 | 3300005564 | Ga0070664_100000572 | Ga0070664_10000057223 | 243 |
| 18 | 3300005577 | Ga0068857_100000465 | Ga0068857_1000004654 | 243 |
| 19 | 3300005578 | Ga0068854_100008411 | Ga0068854_1000084116 | 243 |
| 20 | 3300005614 | Ga0068856_100000962 | Ga0068856_10000096220 | 243 |
| 21 | 3300009093 | Ga0105240_10010941 | Ga0105240_100109413 | 243 |
| 22 | 3300009174 | Ga0105241_10367499 | Ga0105241_103674992 | 243 |
| 23 | 3300009551 | Ga0105238_10000817 | Ga0105238_100008178 | 243 |
| 24 | 3300013105 | Ga0157369_10009759 | Ga0157369_100097599 | 243 |
| 25 | 3300013307 | Ga0157372_10009688 | Ga0157372_100096882 | 243 |
| 26 | 3300025911 | Ga0207654_10175524 | Ga0207654_101755242 | 243 |
| 27 | 3300025912 | Ga0207707_10048067 | Ga0207707_100480673 | 243 |
| 28 | 3300025913 | Ga0207695_10019928 | Ga0207695_100199283 | 243 |
| 29 | 3300025919 | Ga0207657_10015277 | Ga0207657_100152774 | 243 |
| 30 | 3300025920 | Ga0207649_10011058 | Ga0207649_100110584 | 243 |
| 31 | 3300025924 | Ga0207694_10002353 | Ga0207694_1000235316 | 243 |
| 32 | 3300025929 | Ga0207664_10038069 | Ga0207664_100380692 | 243 |
| 33 | 3300025932 | Ga0207690_10004135 | Ga0207690_100041356 | 243 |
| 34 | 3300025944 | Ga0207661_10012274 | Ga0207661_100122743 | 243 |
| 35 | 3300025945 | Ga0207679_10003266 | Ga0207679_100032668 | 243 |
| 36 | 3300025949 | Ga0207667_10000842 | Ga0207667_1000084215 | 243 |
| 37 | 3300025981 | Ga0207640_10037178 | Ga0207640_100371784 | 243 |
| 38 | 3300026041 | Ga0207639_10042654 | Ga0207639_100426542 | 243 |
| 39 | 3300026078 | Ga0207702_10010663 | Ga0207702_100106635 | 243 |
| 40 | 3300026116 | Ga0207674_10000182 | Ga0207674_1000018251 | 243 |
| 41 | 3300031344 | Ga0265316_10038818 | Ga0265316_100388184 | 243 |
| 42 | 3300045051 | Ga0451576_0001376 | Ga0451576_0001376_29532_30452 | 243 |
| 43 | 3300005366 | Ga0070659_100248779 | Ga0070659_1002487792 | 244 |
| 44 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003975 | 244 |
| 45 | 3300006175 | Ga0070712_100178923 | Ga0070712_1001789232 | 244 |
| 46 | 3300013307 | Ga0157372_10161335 | Ga0157372_101613352 | 244 |
| 47 | 3300025928 | Ga0207700_10000120 | Ga0207700_1000012039 | 244 |
| 48 | 3300025932 | Ga0207690_10307624 | Ga0207690_103076242 | 244 |
| 49 | 3300025945 | Ga0207679_10011079 | Ga0207679_100110793 | 244 |
| 50 | 3300031344 | Ga0265316_10006826 | Ga0265316_1000682610 | 244 |
| 51 | 3300031344 | Ga0265316_10049415 | Ga0265316_100494152 | 244 |
| 52 | 3300045051 | Ga0451576_0032733 | Ga0451576_0032733_2753_3643 | 244 |
| 53 | 3300027665 | Ga0209983_1008024 | Ga0209983_10080242 | 245 |
| 54 | 3300042876 | Ga0451577_0010511 | Ga0451577_0010511_1023_1913 | 245 |
| 55 | 3300005518 | Ga0070699_100173937 | Ga0070699_1001739372 | 246 |
| 56 | 3300005530 | Ga0070679_100262724 | Ga0070679_1002627242 | 246 |
| 57 | 3300005546 | Ga0070696_100105940 | Ga0070696_1001059402 | 246 |
| 58 | 3300009174 | Ga0105241_10285681 | Ga0105241_102856811 | 246 |
| 59 | 3300025917 | Ga0207660_10014493 | Ga0207660_100144933 | 246 |
| 60 | 3300025981 | Ga0207640_10053421 | Ga0207640_100534212 | 246 |
| 61 | 3300044712 | Ga0453684_0001170 | Ga0453684_0001170_42859_43761 | 246 |
| 62 | 3300048905 | Ga0496102_0068728 | Ga0496102_0068728_1505_2422 | 246 |
| 63 | 3300005440 | Ga0070705_100087597 | Ga0070705_1000875972 | 247 |
| 64 | 3300005539 | Ga0068853_100343645 | Ga0068853_1003436452 | 247 |
| 65 | 3300005841 | Ga0068863_100528265 | Ga0068863_1005282652 | 247 |
| 66 | 3300005843 | Ga0068860_100023819 | Ga0068860_1000238197 | 247 |
| 67 | 3300013306 | Ga0163162_10496920 | Ga0163162_104969202 | 247 |
| 68 | 3300044712 | Ga0453684_0023499 | Ga0453684_0023499_5799_6683 | 247 |
| 69 | 3300005338 | Ga0068868_100065551 | Ga0068868_1000655512 | 248 |
| 70 | 3300005344 | Ga0070661_100331356 | Ga0070661_1003313562 | 248 |
| 71 | 3300025933 | Ga0207706_10144761 | Ga0207706_101447612 | 248 |
| 72 | 3300031727 | Ga0316576_10032447 | Ga0316576_100324471 | 248 |
| 73 | 3300032139 | Ga0316580_10008663 | Ga0316580_100086635 | 248 |
| 74 | 3300035398 | Ga0316574_0012312 | Ga0316574_0012312_1665_2519 | 248 |
| 75 | 3300036647 | Ga0316582_0006939 | Ga0316582_0006939_1866_2720 | 248 |
| 76 | 3300044673 | Ga0453683_0190070 | Ga0453683_0190070_338_1186 | 249 |
| 77 | 3300048911 | Ga0496108_0226665 | Ga0496108_0226665_234_1130 | 249 |
| 78 | 3300048912 | Ga0496109_0487298 | Ga0496109_0487298_202_1098 | 249 |
| 79 | 3300036401 | Ga0373937_0248276 | Ga0373937_0248276_797_1666 | 250 |
| 80 | 3300005335 | Ga0070666_10041436 | Ga0070666_100414363 | 251 |
| 81 | 3300005344 | Ga0070661_100254188 | Ga0070661_1002541881 | 251 |
| 82 | 3300005355 | Ga0070671_100236187 | Ga0070671_1002361872 | 251 |
| 83 | 3300005364 | Ga0070673_100012948 | Ga0070673_1000129483 | 251 |
| 84 | 3300005564 | Ga0070664_100101744 | Ga0070664_1001017442 | 251 |
| 85 | 3300025920 | Ga0207649_10060934 | Ga0207649_100609343 | 251 |
| 86 | 3300025931 | Ga0207644_10275831 | Ga0207644_102758312 | 251 |
| 87 | 3300025933 | Ga0207706_10347311 | Ga0207706_103473111 | 251 |
| 88 | 3300025945 | Ga0207679_10128937 | Ga0207679_101289372 | 251 |
| 89 | 3300026142 | Ga0207698_10398588 | Ga0207698_103985882 | 251 |
| 90 | 3300035725 | Ga0373947_0184992 | Ga0373947_0184992_321_1244 | 251 |
| 91 | 3300005539 | Ga0068853_100247661 | Ga0068853_1002476612 | 252 |
| 92 | 3300009147 | Ga0114129_10064248 | Ga0114129_100642484 | 252 |
| 93 | 3300031238 | Ga0265332_10005275 | Ga0265332_100052758 | 252 |
| 94 | 3300035172 | Ga0373955_0032052 | Ga0373955_0032052_1423_2313 | 252 |
| 95 | 3300036401 | Ga0373937_0062330 | Ga0373937_0062330_646_1539 | 252 |
| 96 | 3300046683 | Ga0495658_0124126 | Ga0495658_0124126_550_1524 | 252 |
| 97 | 3300050507 | nmdc:mga05p37_57695_c1 | nmdc:mga05p37_57695_c1_1337_2266 | 252 |
| 98 | 3300050512 | nmdc:mga0n895_94823_c1 | nmdc:mga0n895_94823_c1_1898_2779 | 252 |
| 99 | 3300053085 | Ga0495619_0049784 | Ga0495619_0049784_1385_2278 | 252 |
| 100 | 3300005366 | Ga0070659_100182219 | Ga0070659_1001822191 | 253 |
| 101 | 3300005563 | Ga0068855_100183612 | Ga0068855_1001836122 | 253 |
| 102 | 3300005564 | Ga0070664_100136900 | Ga0070664_1001369002 | 253 |
| 103 | 3300006237 | Ga0097621_100127121 | Ga0097621_1001271212 | 253 |
| 104 | 3300013105 | Ga0157369_10112711 | Ga0157369_101127114 | 253 |
| 105 | 3300013296 | Ga0157374_10114068 | Ga0157374_101140682 | 253 |
| 106 | 3300025932 | Ga0207690_10073730 | Ga0207690_100737302 | 253 |
| 107 | 3300025945 | Ga0207679_10119664 | Ga0207679_101196641 | 253 |
| 108 | 3300025949 | Ga0207667_10170799 | Ga0207667_101707992 | 253 |
| 109 | 3300026041 | Ga0207639_10244849 | Ga0207639_102448492 | 253 |
| 110 | 3300041512 | Ga0451853_2406494 | Ga0451853_2406494_788_1681 | 253 |
| 111 | 3300044694 | Ga0466963_0104459 | Ga0466963_0104459_76_966 | 254 |
| 112 | 3300045976 | Ga0466967_0336022 | Ga0466967_0336022_512_1402 | 254 |
| 113 | iso_pu_bacteria | 2526164512 | 2526213365 | 254 |
| 114 | 3300006195 | Ga0075366_10009362 | Ga0075366_100093627 | 255 |
| 115 | 3300013307 | Ga0157372_10646756 | Ga0157372_106467562 | 255 |
| 116 | 3300050493 | nmdc:mga0k408_72027_c1 | nmdc:mga0k408_72027_c1_794_1684 | 255 |
| 117 | 3300005328 | Ga0070676_10006266 | Ga0070676_100062664 | 256 |
| 118 | 3300005331 | Ga0070670_100011090 | Ga0070670_1000110908 | 256 |
| 119 | 3300005344 | Ga0070661_100010193 | Ga0070661_1000101931 | 256 |
| 120 | 3300005364 | Ga0070673_100049248 | Ga0070673_1000492482 | 256 |
| 121 | 3300005366 | Ga0070659_100005062 | Ga0070659_1000050623 | 256 |
| 122 | 3300005366 | Ga0070659_100163033 | Ga0070659_1001630332 | 256 |
| 123 | 3300005457 | Ga0070662_100000554 | Ga0070662_10000055412 | 256 |
| 124 | 3300005458 | Ga0070681_10017021 | Ga0070681_100170212 | 256 |
| 125 | 3300005539 | Ga0068853_100013365 | Ga0068853_1000133657 | 256 |
| 126 | 3300005563 | Ga0068855_100030945 | Ga0068855_1000309456 | 256 |
| 127 | 3300005564 | Ga0070664_100029911 | Ga0070664_1000299112 | 256 |
| 128 | 3300005564 | Ga0070664_100132311 | Ga0070664_1001323112 | 256 |
| 129 | 3300005578 | Ga0068854_100100406 | Ga0068854_1001004062 | 256 |
| 130 | 3300005614 | Ga0068856_100001205 | Ga0068856_1000012059 | 256 |
| 131 | 3300005614 | Ga0068856_100003469 | Ga0068856_1000034696 | 256 |
| 132 | 3300005616 | Ga0068852_100022082 | Ga0068852_1000220825 | 256 |
| 133 | 3300013100 | Ga0157373_10005680 | Ga0157373_100056804 | 256 |
| 134 | 3300013307 | Ga0157372_10002230 | Ga0157372_100022308 | 256 |
| 135 | 3300013307 | Ga0157372_10039603 | Ga0157372_100396032 | 256 |
| 136 | 3300025315 | Ga0207697_10034310 | Ga0207697_100343102 | 256 |
| 137 | 3300025907 | Ga0207645_10010911 | Ga0207645_100109113 | 256 |
| 138 | 3300025912 | Ga0207707_10024845 | Ga0207707_100248452 | 256 |
| 139 | 3300025912 | Ga0207707_10103171 | Ga0207707_101031712 | 256 |
| 140 | 3300025917 | Ga0207660_10157034 | Ga0207660_101570342 | 256 |
| 141 | 3300025920 | Ga0207649_10039155 | Ga0207649_100391551 | 256 |
| 142 | 3300025921 | Ga0207652_10132418 | Ga0207652_101324181 | 256 |
| 143 | 3300025932 | Ga0207690_10001354 | Ga0207690_1000135415 | 256 |
| 144 | 3300025932 | Ga0207690_10262516 | Ga0207690_102625162 | 256 |
| 145 | 3300025933 | Ga0207706_10000133 | Ga0207706_1000013352 | 256 |
| 146 | 3300025945 | Ga0207679_10090603 | Ga0207679_100906031 | 256 |
| 147 | 3300025949 | Ga0207667_10114040 | Ga0207667_101140401 | 256 |
| 148 | 3300025960 | Ga0207651_10063177 | Ga0207651_100631772 | 256 |
| 149 | 3300026078 | Ga0207702_10005844 | Ga0207702_1000584410 | 256 |
| 150 | 3300026116 | Ga0207674_10383496 | Ga0207674_103834962 | 256 |
| 151 | 3300026142 | Ga0207698_10012386 | Ga0207698_100123863 | 256 |
| 152 | 3300031548 | Ga0307408_100061939 | Ga0307408_1000619393 | 256 |
| 153 | 3300031852 | Ga0307410_10061384 | Ga0307410_100613841 | 256 |
| 154 | 3300031901 | Ga0307406_10002618 | Ga0307406_100026184 | 256 |
| 155 | 3300031903 | Ga0307407_10018772 | Ga0307407_100187724 | 256 |
| 156 | 3300031911 | Ga0307412_10003937 | Ga0307412_100039373 | 256 |
| 157 | 3300032002 | Ga0307416_100003856 | Ga0307416_1000038568 | 256 |
| 158 | 3300032005 | Ga0307411_10262094 | Ga0307411_102620942 | 256 |
| 159 | 3300037418 | Ga0395900_0036984 | Ga0395900_0036984_1190_2083 | 256 |
| 160 | 3300037466 | Ga0395898_0238826 | Ga0395898_0238826_532_1425 | 256 |
| 161 | 3300048909 | Ga0496106_0000821 | Ga0496106_0000821_16521_17414 | 256 |
| 162 | 3300005339 | Ga0070660_100001693 | Ga0070660_1000016937 | 257 |
| 163 | 3300005355 | Ga0070671_100050634 | Ga0070671_1000506342 | 257 |
| 164 | 3300005455 | Ga0070663_100060337 | Ga0070663_1000603374 | 257 |
| 165 | 3300005563 | Ga0068855_100007680 | Ga0068855_1000076804 | 257 |
| 166 | 3300005564 | Ga0070664_100004095 | Ga0070664_1000040954 | 257 |
| 167 | 3300013105 | Ga0157369_10095343 | Ga0157369_100953432 | 257 |
| 168 | 3300025919 | Ga0207657_10003687 | Ga0207657_100036873 | 257 |
| 169 | 3300025931 | Ga0207644_10183705 | Ga0207644_101837052 | 257 |
| 170 | 3300025945 | Ga0207679_10005340 | Ga0207679_100053409 | 257 |
| 171 | 3300025949 | Ga0207667_10005196 | Ga0207667_100051968 | 257 |
| 172 | 3300027543 | Ga0209999_1022905 | Ga0209999_10229052 | 257 |
| 173 | 3300035691 | Ga0373931_0047422 | Ga0373931_0047422_456_1349 | 257 |
| 174 | 3300048904 | Ga0496101_0133793 | Ga0496101_0133793_243_1136 | 257 |
| 175 | 3300005344 | Ga0070661_100116454 | Ga0070661_1001164542 | 258 |
| 176 | 3300005353 | Ga0070669_100051735 | Ga0070669_1000517353 | 258 |
| 177 | 3300005354 | Ga0070675_100026358 | Ga0070675_1000263584 | 258 |
| 178 | 3300005355 | Ga0070671_100118520 | Ga0070671_1001185202 | 258 |
| 179 | 3300005367 | Ga0070667_100027551 | Ga0070667_1000275513 | 258 |
| 180 | 3300005434 | Ga0070709_10017844 | Ga0070709_100178442 | 258 |
| 181 | 3300005436 | Ga0070713_100170134 | Ga0070713_1001701342 | 258 |
| 182 | 3300005439 | Ga0070711_100043761 | Ga0070711_1000437615 | 258 |
| 183 | 3300005459 | Ga0068867_100049466 | Ga0068867_1000494662 | 258 |
| 184 | 3300005518 | Ga0070699_100050548 | Ga0070699_1000505483 | 258 |
| 185 | 3300005530 | Ga0070679_100274174 | Ga0070679_1002741742 | 258 |
| 186 | 3300005543 | Ga0070672_100000853 | Ga0070672_10000085315 | 258 |
| 187 | 3300005543 | Ga0070672_100021220 | Ga0070672_1000212206 | 258 |
| 188 | 3300005546 | Ga0070696_100002477 | Ga0070696_1000024776 | 258 |
| 189 | 3300005563 | Ga0068855_100328741 | Ga0068855_1003287412 | 258 |
| 190 | 3300005578 | Ga0068854_100311438 | Ga0068854_1003114382 | 258 |
| 191 | 3300005618 | Ga0068864_100082286 | Ga0068864_1000822863 | 258 |
| 192 | 3300005719 | Ga0068861_100024274 | Ga0068861_1000242742 | 258 |
| 193 | 3300005843 | Ga0068860_100005292 | Ga0068860_1000052928 | 258 |
| 194 | 3300009177 | Ga0105248_10019862 | Ga0105248_100198629 | 258 |
| 195 | 3300009177 | Ga0105248_10047229 | Ga0105248_100472296 | 258 |
| 196 | 3300013105 | Ga0157369_10445662 | Ga0157369_104456621 | 258 |
| 197 | 3300013296 | Ga0157374_10722622 | Ga0157374_107226221 | 258 |
| 198 | 3300013306 | Ga0163162_10326385 | Ga0163162_103263852 | 258 |
| 199 | 3300013308 | Ga0157375_10006293 | Ga0157375_100062933 | 258 |
| 200 | 3300014969 | Ga0157376_10403759 | Ga0157376_104037592 | 258 |
| 201 | 3300025893 | Ga0207682_10029387 | Ga0207682_100293872 | 258 |
| 202 | 3300025903 | Ga0207680_10064584 | Ga0207680_100645843 | 258 |
| 203 | 3300025913 | Ga0207695_10023248 | Ga0207695_100232487 | 258 |
| 204 | 3300025923 | Ga0207681_10026284 | Ga0207681_100262842 | 258 |
| 205 | 3300025925 | Ga0207650_10149330 | Ga0207650_101493302 | 258 |
| 206 | 3300025928 | Ga0207700_10083234 | Ga0207700_100832342 | 258 |
| 207 | 3300025929 | Ga0207664_10076114 | Ga0207664_100761142 | 258 |
| 208 | 3300025931 | Ga0207644_10096470 | Ga0207644_100964702 | 258 |
| 209 | 3300025940 | Ga0207691_10001454 | Ga0207691_100014547 | 258 |
| 210 | 3300025940 | Ga0207691_10079879 | Ga0207691_100798795 | 258 |
| 211 | 3300025941 | Ga0207711_10016910 | Ga0207711_100169108 | 258 |
| 212 | 3300025941 | Ga0207711_10162236 | Ga0207711_101622362 | 258 |
| 213 | 3300025949 | Ga0207667_10073498 | Ga0207667_100734982 | 258 |
| 214 | 3300025960 | Ga0207651_10024981 | Ga0207651_100249811 | 258 |
| 215 | 3300025960 | Ga0207651_10173617 | Ga0207651_101736172 | 258 |
| 216 | 3300025972 | Ga0207668_10433410 | Ga0207668_104334101 | 258 |
| 217 | 3300025986 | Ga0207658_10019214 | Ga0207658_100192144 | 258 |
| 218 | 3300026095 | Ga0207676_10037003 | Ga0207676_100370034 | 258 |
| 219 | 3300026118 | Ga0207675_100023790 | Ga0207675_1000237905 | 258 |
| 220 | 3300027471 | Ga0209995_1002546 | Ga0209995_10025462 | 258 |
| 221 | 3300027665 | Ga0209983_1014414 | Ga0209983_10144142 | 258 |
| 222 | 3300027695 | Ga0209966_1002402 | Ga0209966_10024022 | 258 |
| 223 | 3300027876 | Ga0209974_10000182 | Ga0209974_100001827 | 258 |
| 224 | 3300028381 | Ga0268264_10004111 | Ga0268264_100041118 | 258 |
| 225 | 3300044712 | Ga0453684_0291070 | Ga0453684_0291070_506_1399 | 258 |
| 226 | 3300005328 | Ga0070676_10000862 | Ga0070676_1000086214 | 259 |
| 227 | 3300005328 | Ga0070676_10001774 | Ga0070676_100017747 | 259 |
| 228 | 3300005333 | Ga0070677_10000268 | Ga0070677_1000026812 | 259 |
| 229 | 3300005334 | Ga0068869_100158086 | Ga0068869_1001580862 | 259 |
| 230 | 3300005335 | Ga0070666_10000839 | Ga0070666_1000083916 | 259 |
| 231 | 3300005335 | Ga0070666_10005531 | Ga0070666_100055313 | 259 |
| 232 | 3300005338 | Ga0068868_100008483 | Ga0068868_1000084833 | 259 |
| 233 | 3300005341 | Ga0070691_10010280 | Ga0070691_100102804 | 259 |
| 234 | 3300005347 | Ga0070668_100003003 | Ga0070668_1000030033 | 259 |
| 235 | 3300005347 | Ga0070668_100008937 | Ga0070668_1000089372 | 259 |
| 236 | 3300005353 | Ga0070669_100001156 | Ga0070669_10000115613 | 259 |
| 237 | 3300005354 | Ga0070675_100006504 | Ga0070675_1000065046 | 259 |
| 238 | 3300005354 | Ga0070675_100047016 | Ga0070675_1000470163 | 259 |
| 239 | 3300005355 | Ga0070671_100031187 | Ga0070671_1000311873 | 259 |
| 240 | 3300005355 | Ga0070671_100046272 | Ga0070671_1000462724 | 259 |
| 241 | 3300005356 | Ga0070674_100001276 | Ga0070674_10000127610 | 259 |
| 242 | 3300005356 | Ga0070674_100074111 | Ga0070674_1000741112 | 259 |
| 243 | 3300005364 | Ga0070673_100001215 | Ga0070673_10000121513 | 259 |
| 244 | 3300005364 | Ga0070673_100002411 | Ga0070673_1000024118 | 259 |
| 245 | 3300005365 | Ga0070688_100023500 | Ga0070688_1000235003 | 259 |
| 246 | 3300005367 | Ga0070667_100003294 | Ga0070667_1000032945 | 259 |
| 247 | 3300005367 | Ga0070667_100005512 | Ga0070667_10000551211 | 259 |
| 248 | 3300005455 | Ga0070663_100027376 | Ga0070663_1000273763 | 259 |
| 249 | 3300005455 | Ga0070663_100475851 | Ga0070663_1004758511 | 259 |
| 250 | 3300005456 | Ga0070678_100000169 | Ga0070678_10000016917 | 259 |
| 251 | 3300005456 | Ga0070678_100003566 | Ga0070678_1000035663 | 259 |
| 252 | 3300005459 | Ga0068867_100001033 | Ga0068867_1000010334 | 259 |
| 253 | 3300005459 | Ga0068867_100002460 | Ga0068867_1000024603 | 259 |
| 254 | 3300005466 | Ga0070685_10046834 | Ga0070685_100468342 | 259 |
| 255 | 3300005539 | Ga0068853_100009737 | Ga0068853_1000097376 | 259 |
| 256 | 3300005543 | Ga0070672_100005197 | Ga0070672_1000051973 | 259 |
| 257 | 3300005543 | Ga0070672_100072600 | Ga0070672_1000726002 | 259 |
| 258 | 3300005548 | Ga0070665_100001395 | Ga0070665_10000139529 | 259 |
| 259 | 3300005548 | Ga0070665_100003175 | Ga0070665_1000031758 | 259 |
| 260 | 3300005578 | Ga0068854_100045389 | Ga0068854_1000453893 | 259 |
| 261 | 3300005615 | Ga0070702_100242044 | Ga0070702_1002420442 | 259 |
| 262 | 3300005616 | Ga0068852_100059049 | Ga0068852_1000590493 | 259 |
| 263 | 3300005617 | Ga0068859_100028321 | Ga0068859_1000283215 | 259 |
| 264 | 3300005617 | Ga0068859_100159151 | Ga0068859_1001591513 | 259 |
| 265 | 3300005618 | Ga0068864_100007835 | Ga0068864_1000078353 | 259 |
| 266 | 3300005618 | Ga0068864_100036849 | Ga0068864_1000368492 | 259 |
| 267 | 3300005719 | Ga0068861_100218085 | Ga0068861_1002180852 | 259 |
| 268 | 3300005841 | Ga0068863_100240337 | Ga0068863_1002403372 | 259 |
| 269 | 3300005842 | Ga0068858_100006556 | Ga0068858_1000065563 | 259 |
| 270 | 3300005843 | Ga0068860_100012285 | Ga0068860_1000122852 | 259 |
| 271 | 3300005843 | Ga0068860_100030713 | Ga0068860_1000307133 | 259 |
| 272 | 3300005985 | Ga0081539_10085150 | Ga0081539_100851502 | 259 |
| 273 | 3300006237 | Ga0097621_100007062 | Ga0097621_1000070622 | 259 |
| 274 | 3300006358 | Ga0068871_100003622 | Ga0068871_1000036224 | 259 |
| 275 | 3300006358 | Ga0068871_100009799 | Ga0068871_1000097997 | 259 |
| 276 | 3300006881 | Ga0068865_100030540 | Ga0068865_1000305405 | 259 |
| 277 | 3300006931 | Ga0097620_100028318 | Ga0097620_1000283185 | 259 |
| 278 | 3300006931 | Ga0097620_100159153 | Ga0097620_1001591533 | 259 |
| 279 | 3300009177 | Ga0105248_10007610 | Ga0105248_100076103 | 259 |
| 280 | 3300009177 | Ga0105248_10091786 | Ga0105248_100917864 | 259 |
| 281 | 3300009177 | Ga0105248_10508095 | Ga0105248_105080952 | 259 |
| 282 | 3300009553 | Ga0105249_10175248 | Ga0105249_101752482 | 259 |
| 283 | 3300013296 | Ga0157374_10008326 | Ga0157374_100083263 | 259 |
| 284 | 3300013306 | Ga0163162_10004211 | Ga0163162_1000421112 | 259 |
| 285 | 3300013306 | Ga0163162_10038651 | Ga0163162_100386513 | 259 |
| 286 | 3300013308 | Ga0157375_10002925 | Ga0157375_100029259 | 259 |
| 287 | 3300013308 | Ga0157375_10246814 | Ga0157375_102468142 | 259 |
| 288 | 3300014325 | Ga0163163_10128098 | Ga0163163_101280982 | 259 |
| 289 | 3300014745 | Ga0157377_10135002 | Ga0157377_101350022 | 259 |
| 290 | 3300014968 | Ga0157379_10141967 | Ga0157379_101419672 | 259 |
| 291 | 3300014969 | Ga0157376_10259253 | Ga0157376_102592532 | 259 |
| 292 | 3300025315 | Ga0207697_10003677 | Ga0207697_100036774 | 259 |
| 293 | 3300025893 | Ga0207682_10000483 | Ga0207682_100004836 | 259 |
| 294 | 3300025893 | Ga0207682_10019839 | Ga0207682_100198392 | 259 |
| 295 | 3300025903 | Ga0207680_10063053 | Ga0207680_100630532 | 259 |
| 296 | 3300025907 | Ga0207645_10000617 | Ga0207645_1000061713 | 259 |
| 297 | 3300025907 | Ga0207645_10009628 | Ga0207645_100096283 | 259 |
| 298 | 3300025908 | Ga0207643_10022770 | Ga0207643_100227702 | 259 |
| 299 | 3300025909 | Ga0207705_10227912 | Ga0207705_102279122 | 259 |
| 300 | 3300025923 | Ga0207681_10004220 | Ga0207681_1000422010 | 259 |
| 301 | 3300025925 | Ga0207650_10068939 | Ga0207650_100689393 | 259 |
| 302 | 3300025926 | Ga0207659_10010401 | Ga0207659_100104015 | 259 |
| 303 | 3300025926 | Ga0207659_10025052 | Ga0207659_100250522 | 259 |
| 304 | 3300025931 | Ga0207644_10003463 | Ga0207644_100034634 | 259 |
| 305 | 3300025937 | Ga0207669_10062882 | Ga0207669_100628822 | 259 |
| 306 | 3300025937 | Ga0207669_10159484 | Ga0207669_101594842 | 259 |
| 307 | 3300025938 | Ga0207704_10308065 | Ga0207704_103080652 | 259 |
| 308 | 3300025940 | Ga0207691_10000170 | Ga0207691_1000017056 | 259 |
| 309 | 3300025940 | Ga0207691_10000282 | Ga0207691_1000028248 | 259 |
| 310 | 3300025941 | Ga0207711_10053481 | Ga0207711_100534814 | 259 |
| 311 | 3300025941 | Ga0207711_10079496 | Ga0207711_100794962 | 259 |
| 312 | 3300025942 | Ga0207689_10010112 | Ga0207689_100101123 | 259 |
| 313 | 3300025961 | Ga0207712_10112632 | Ga0207712_101126322 | 259 |
| 314 | 3300025972 | Ga0207668_10006170 | Ga0207668_100061703 | 259 |
| 315 | 3300025972 | Ga0207668_10045956 | Ga0207668_100459562 | 259 |
| 316 | 3300025986 | Ga0207658_10032868 | Ga0207658_100328682 | 259 |
| 317 | 3300025986 | Ga0207658_10105264 | Ga0207658_101052642 | 259 |
| 318 | 3300026023 | Ga0207677_10030318 | Ga0207677_100303184 | 259 |
| 319 | 3300026023 | Ga0207677_10128029 | Ga0207677_101280292 | 259 |
| 320 | 3300026035 | Ga0207703_10048664 | Ga0207703_100486643 | 259 |
| 321 | 3300026035 | Ga0207703_10084450 | Ga0207703_100844502 | 259 |
| 322 | 3300026041 | Ga0207639_10006373 | Ga0207639_100063731 | 259 |
| 323 | 3300026067 | Ga0207678_10009500 | Ga0207678_100095003 | 259 |
| 324 | 3300026088 | Ga0207641_10004545 | Ga0207641_100045453 | 259 |
| 325 | 3300026088 | Ga0207641_10020334 | Ga0207641_100203343 | 259 |
| 326 | 3300026089 | Ga0207648_10000203 | Ga0207648_100002039 | 259 |
| 327 | 3300026089 | Ga0207648_10000605 | Ga0207648_1000060531 | 259 |
| 328 | 3300026095 | Ga0207676_10021161 | Ga0207676_100211612 | 259 |
| 329 | 3300026118 | Ga0207675_100244321 | Ga0207675_1002443212 | 259 |
| 330 | 3300026118 | Ga0207675_100505670 | Ga0207675_1005056702 | 259 |
| 331 | 3300026121 | Ga0207683_10000005 | Ga0207683_10000005121 | 259 |
| 332 | 3300026121 | Ga0207683_10000428 | Ga0207683_1000042836 | 259 |
| 333 | 3300028379 | Ga0268266_10002847 | Ga0268266_1000284714 | 259 |
| 334 | 3300028379 | Ga0268266_10014515 | Ga0268266_100145152 | 259 |
| 335 | 3300028381 | Ga0268264_10018697 | Ga0268264_100186974 | 259 |
| 336 | 3300048910 | Ga0496107_0173569 | Ga0496107_0173569_626_1513 | 259 |
| 337 | 3300048912 | Ga0496109_0034784 | Ga0496109_0034784_2419_3306 | 259 |
| 338 | 3300053085 | Ga0495619_0095902 | Ga0495619_0095902_742_1647 | 259 |
| 339 | 3300005328 | Ga0070676_10088404 | Ga0070676_100884042 | 260 |
| 340 | 3300005331 | Ga0070670_100075314 | Ga0070670_1000753144 | 260 |
| 341 | 3300005334 | Ga0068869_100000717 | Ga0068869_10000071714 | 260 |
| 342 | 3300005338 | Ga0068868_100414566 | Ga0068868_1004145662 | 260 |
| 343 | 3300005340 | Ga0070689_100005991 | Ga0070689_1000059913 | 260 |
| 344 | 3300005354 | Ga0070675_100016281 | Ga0070675_1000162813 | 260 |
| 345 | 3300005354 | Ga0070675_100482173 | Ga0070675_1004821731 | 260 |
| 346 | 3300005355 | Ga0070671_100015546 | Ga0070671_1000155462 | 260 |
| 347 | 3300005364 | Ga0070673_100005120 | Ga0070673_1000051208 | 260 |
| 348 | 3300005364 | Ga0070673_100091103 | Ga0070673_1000911032 | 260 |
| 349 | 3300005365 | Ga0070688_100074221 | Ga0070688_1000742212 | 260 |
| 350 | 3300005365 | Ga0070688_100082898 | Ga0070688_1000828982 | 260 |
| 351 | 3300005445 | Ga0070708_100001846 | Ga0070708_1000018468 | 260 |
| 352 | 3300005456 | Ga0070678_100008313 | Ga0070678_1000083133 | 260 |
| 353 | 3300005459 | Ga0068867_100011620 | Ga0068867_1000116203 | 260 |
| 354 | 3300005543 | Ga0070672_100045668 | Ga0070672_1000456683 | 260 |
| 355 | 3300005548 | Ga0070665_100066705 | Ga0070665_1000667052 | 260 |
| 356 | 3300005617 | Ga0068859_100243831 | Ga0068859_1002438312 | 260 |
| 357 | 3300005618 | Ga0068864_100003838 | Ga0068864_1000038382 | 260 |
| 358 | 3300005618 | Ga0068864_100017807 | Ga0068864_1000178072 | 260 |
| 359 | 3300005618 | Ga0068864_100033445 | Ga0068864_1000334454 | 260 |
| 360 | 3300005840 | Ga0068870_10006880 | Ga0068870_100068803 | 260 |
| 361 | 3300005841 | Ga0068863_100004444 | Ga0068863_10000444411 | 260 |
| 362 | 3300005841 | Ga0068863_100089700 | Ga0068863_1000897002 | 260 |
| 363 | 3300005841 | Ga0068863_100414764 | Ga0068863_1004147642 | 260 |
| 364 | 3300005843 | Ga0068860_100008429 | Ga0068860_1000084297 | 260 |
| 365 | 3300005844 | Ga0068862_100028779 | Ga0068862_1000287793 | 260 |
| 366 | 3300006237 | Ga0097621_100057224 | Ga0097621_1000572242 | 260 |
| 367 | 3300006237 | Ga0097621_100074891 | Ga0097621_1000748911 | 260 |
| 368 | 3300006358 | Ga0068871_100300825 | Ga0068871_1003008251 | 260 |
| 369 | 3300006358 | Ga0068871_100400965 | Ga0068871_1004009652 | 260 |
| 370 | 3300006931 | Ga0097620_100243837 | Ga0097620_1002438372 | 260 |
| 371 | 3300009148 | Ga0105243_10108611 | Ga0105243_101086112 | 260 |
| 372 | 3300009177 | Ga0105248_10064781 | Ga0105248_100647814 | 260 |
| 373 | 3300009177 | Ga0105248_10222372 | Ga0105248_102223722 | 260 |
| 374 | 3300009553 | Ga0105249_10214776 | Ga0105249_102147762 | 260 |
| 375 | 3300013306 | Ga0163162_10149177 | Ga0163162_101491772 | 260 |
| 376 | 3300013308 | Ga0157375_10030861 | Ga0157375_100308613 | 260 |
| 377 | 3300014325 | Ga0163163_10019983 | Ga0163163_100199832 | 260 |
| 378 | 3300014325 | Ga0163163_10056449 | Ga0163163_100564494 | 260 |
| 379 | 3300014326 | Ga0157380_10054683 | Ga0157380_100546832 | 260 |
| 380 | 3300014968 | Ga0157379_10408444 | Ga0157379_104084441 | 260 |
| 381 | 3300014969 | Ga0157376_10110923 | Ga0157376_101109232 | 260 |
| 382 | 3300017792 | Ga0163161_10086797 | Ga0163161_100867972 | 260 |
| 383 | 3300017792 | Ga0163161_10453601 | Ga0163161_104536012 | 260 |
| 384 | 3300025907 | Ga0207645_10027594 | Ga0207645_100275942 | 260 |
| 385 | 3300025908 | Ga0207643_10004283 | Ga0207643_100042835 | 260 |
| 386 | 3300025923 | Ga0207681_10100216 | Ga0207681_101002162 | 260 |
| 387 | 3300025931 | Ga0207644_10109199 | Ga0207644_101091991 | 260 |
| 388 | 3300025937 | Ga0207669_10160125 | Ga0207669_101601252 | 260 |
| 389 | 3300025938 | Ga0207704_10256256 | Ga0207704_102562562 | 260 |
| 390 | 3300025941 | Ga0207711_10330269 | Ga0207711_103302692 | 260 |
| 391 | 3300025942 | Ga0207689_10021123 | Ga0207689_100211232 | 260 |
| 392 | 3300025960 | Ga0207651_10063771 | Ga0207651_100637712 | 260 |
| 393 | 3300025986 | Ga0207658_10395095 | Ga0207658_103950952 | 260 |
| 394 | 3300026035 | Ga0207703_10319164 | Ga0207703_103191642 | 260 |
| 395 | 3300026075 | Ga0207708_10007278 | Ga0207708_100072787 | 260 |
| 396 | 3300026088 | Ga0207641_10022283 | Ga0207641_100222832 | 260 |
| 397 | 3300026088 | Ga0207641_10374249 | Ga0207641_103742491 | 260 |
| 398 | 3300026089 | Ga0207648_10007681 | Ga0207648_100076819 | 260 |
| 399 | 3300026095 | Ga0207676_10025352 | Ga0207676_100253522 | 260 |
| 400 | 3300026095 | Ga0207676_10145613 | Ga0207676_101456132 | 260 |
| 401 | 3300026118 | Ga0207675_100042323 | Ga0207675_1000423234 | 260 |
| 402 | 3300026121 | Ga0207683_10036191 | Ga0207683_100361913 | 260 |
| 403 | 3300028379 | Ga0268266_10129956 | Ga0268266_101299562 | 260 |
| 404 | 3300028380 | Ga0268265_10051850 | Ga0268265_100518503 | 260 |
| 405 | 3300048906 | Ga0496103_0062904 | Ga0496103_0062904_1162_2043 | 260 |
| 406 | 3300050514 | nmdc:mga08x19_26694_c1 | nmdc:mga08x19_26694_c1_683_1582 | 260 |
| 407 | 3300005333 | Ga0070677_10013475 | Ga0070677_100134753 | 261 |
| 408 | 3300005456 | Ga0070678_100006666 | Ga0070678_1000066663 | 261 |
| 409 | 3300005459 | Ga0068867_100047216 | Ga0068867_1000472162 | 261 |
| 410 | 3300005548 | Ga0070665_100003807 | Ga0070665_1000038078 | 261 |
| 411 | 3300005577 | Ga0068857_100360528 | Ga0068857_1003605282 | 261 |
| 412 | 3300005615 | Ga0070702_100032385 | Ga0070702_1000323851 | 261 |
| 413 | 3300005937 | Ga0081455_10219774 | Ga0081455_102197742 | 261 |
| 414 | 3300006237 | Ga0097621_100226331 | Ga0097621_1002263312 | 261 |
| 415 | 3300013306 | Ga0163162_10332843 | Ga0163162_103328432 | 261 |
| 416 | 3300013308 | Ga0157375_10228450 | Ga0157375_102284502 | 261 |
| 417 | 3300014745 | Ga0157377_10040366 | Ga0157377_100403664 | 261 |
| 418 | 3300014968 | Ga0157379_10295898 | Ga0157379_102958982 | 261 |
| 419 | 3300014968 | Ga0157379_10435052 | Ga0157379_104350522 | 261 |
| 420 | 3300025315 | Ga0207697_10028744 | Ga0207697_100287442 | 261 |
| 421 | 3300025321 | Ga0207656_10017284 | Ga0207656_100172842 | 261 |
| 422 | 3300025893 | Ga0207682_10000010 | Ga0207682_1000001047 | 261 |
| 423 | 3300025901 | Ga0207688_10012323 | Ga0207688_100123233 | 261 |
| 424 | 3300025908 | Ga0207643_10000339 | Ga0207643_1000033934 | 261 |
| 425 | 3300025923 | Ga0207681_10360033 | Ga0207681_103600332 | 261 |
| 426 | 3300025925 | Ga0207650_10378751 | Ga0207650_103787511 | 261 |
| 427 | 3300025942 | Ga0207689_10019564 | Ga0207689_100195642 | 261 |
| 428 | 3300025972 | Ga0207668_10303046 | Ga0207668_103030462 | 261 |
| 429 | 3300026035 | Ga0207703_10265382 | Ga0207703_102653821 | 261 |
| 430 | 3300026067 | Ga0207678_10002750 | Ga0207678_100027502 | 261 |
| 431 | 3300026089 | Ga0207648_10063485 | Ga0207648_100634853 | 261 |
| 432 | 3300026116 | Ga0207674_10066702 | Ga0207674_100667022 | 261 |
| 433 | 3300026118 | Ga0207675_100004007 | Ga0207675_10000400710 | 261 |
| 434 | 3300026121 | Ga0207683_10016709 | Ga0207683_100167094 | 261 |
| 435 | 3300028379 | Ga0268266_10305396 | Ga0268266_103053962 | 261 |
| 436 | 3300031235 | Ga0265330_10002416 | Ga0265330_100024164 | 261 |
| 437 | 3300031238 | Ga0265332_10001887 | Ga0265332_100018877 | 261 |
| 438 | 3300031242 | Ga0265329_10007419 | Ga0265329_100074192 | 261 |
| 439 | 3300031247 | Ga0265340_10118569 | Ga0265340_101185692 | 261 |
| 440 | 3300031249 | Ga0265339_10078477 | Ga0265339_100784772 | 261 |
| 441 | 3300031251 | Ga0265327_10008924 | Ga0265327_100089244 | 261 |
| 442 | 3300031344 | Ga0265316_10005364 | Ga0265316_100053647 | 261 |
| 443 | 3300031711 | Ga0265314_10004158 | Ga0265314_100041588 | 261 |
| 444 | 3300046528 | Ga0495642_0065953 | Ga0495642_0065953_301_1185 | 261 |
| 445 | 3300048905 | Ga0496102_0185283 | Ga0496102_0185283_42_926 | 261 |
| 446 | 3300048907 | Ga0496104_0217342 | Ga0496104_0217342_659_1543 | 261 |
| 447 | 3300048910 | Ga0496107_0097488 | Ga0496107_0097488_245_1129 | 261 |
| 448 | 3300048911 | Ga0496108_0017349 | Ga0496108_0017349_3687_4571 | 261 |
| 449 | 3300048912 | Ga0496109_0038858 | Ga0496109_0038858_2114_2998 | 261 |
| 450 | 3300048913 | Ga0496110_0082967 | Ga0496110_0082967_1793_2677 | 261 |
| 451 | 3300048917 | Ga0496114_0142042 | Ga0496114_0142042_1009_1893 | 261 |
| 452 | 3300005344 | Ga0070661_100159511 | Ga0070661_1001595112 | 262 |
| 453 | 3300005530 | Ga0070679_100411152 | Ga0070679_1004111521 | 262 |
| 454 | 3300005563 | Ga0068855_100045063 | Ga0068855_1000450632 | 262 |
| 455 | 3300005614 | Ga0068856_100143504 | Ga0068856_1001435042 | 262 |
| 456 | 3300013104 | Ga0157370_10213273 | Ga0157370_102132732 | 262 |
| 457 | 3300025919 | Ga0207657_10008004 | Ga0207657_100080043 | 262 |
| 458 | 3300025949 | Ga0207667_10010385 | Ga0207667_100103859 | 262 |
| 459 | 3300031239 | Ga0265328_10072397 | Ga0265328_100723972 | 262 |
| 460 | 3300031241 | Ga0265325_10008462 | Ga0265325_100084626 | 262 |
| 461 | 3300035691 | Ga0373931_0133733 | Ga0373931_0133733_268_1161 | 262 |
| 462 | 3300045836 | Ga0466958_0188359 | Ga0466958_0188359_102_992 | 262 |
| 463 | 3300047471 | Ga0495684_0297646 | Ga0495684_0297646_208_1113 | 262 |
| 464 | 3300005330 | Ga0070690_100018654 | Ga0070690_1000186543 | 263 |
| 465 | 3300005331 | Ga0070670_100017466 | Ga0070670_1000174664 | 263 |
| 466 | 3300005331 | Ga0070670_100065429 | Ga0070670_1000654292 | 263 |
| 467 | 3300005334 | Ga0068869_100042456 | Ga0068869_1000424562 | 263 |
| 468 | 3300005334 | Ga0068869_100163024 | Ga0068869_1001630242 | 263 |
| 469 | 3300005335 | Ga0070666_10013780 | Ga0070666_100137804 | 263 |
| 470 | 3300005336 | Ga0070680_100186305 | Ga0070680_1001863052 | 263 |
| 471 | 3300005338 | Ga0068868_100004519 | Ga0068868_1000045194 | 263 |
| 472 | 3300005338 | Ga0068868_100128144 | Ga0068868_1001281442 | 263 |
| 473 | 3300005338 | Ga0068868_100392221 | Ga0068868_1003922212 | 263 |
| 474 | 3300005340 | Ga0070689_100027510 | Ga0070689_1000275102 | 263 |
| 475 | 3300005344 | Ga0070661_100042872 | Ga0070661_1000428723 | 263 |
| 476 | 3300005344 | Ga0070661_100056525 | Ga0070661_1000565252 | 263 |
| 477 | 3300005345 | Ga0070692_10090302 | Ga0070692_100903022 | 263 |
| 478 | 3300005355 | Ga0070671_100073970 | Ga0070671_1000739702 | 263 |
| 479 | 3300005356 | Ga0070674_100154130 | Ga0070674_1001541302 | 263 |
| 480 | 3300005364 | Ga0070673_100002612 | Ga0070673_1000026124 | 263 |
| 481 | 3300005365 | Ga0070688_100000814 | Ga0070688_1000008149 | 263 |
| 482 | 3300005366 | Ga0070659_100091196 | Ga0070659_1000911962 | 263 |
| 483 | 3300005367 | Ga0070667_100013573 | Ga0070667_1000135733 | 263 |
| 484 | 3300005406 | Ga0070703_10040643 | Ga0070703_100406432 | 263 |
| 485 | 3300005434 | Ga0070709_10006696 | Ga0070709_100066963 | 263 |
| 486 | 3300005435 | Ga0070714_100007012 | Ga0070714_1000070124 | 263 |
| 487 | 3300005436 | Ga0070713_100003066 | Ga0070713_1000030664 | 263 |
| 488 | 3300005436 | Ga0070713_100114842 | Ga0070713_1001148422 | 263 |
| 489 | 3300005437 | Ga0070710_10012321 | Ga0070710_100123212 | 263 |
| 490 | 3300005437 | Ga0070710_10065753 | Ga0070710_100657532 | 263 |
| 491 | 3300005438 | Ga0070701_10015768 | Ga0070701_100157683 | 263 |
| 492 | 3300005438 | Ga0070701_10120267 | Ga0070701_101202672 | 263 |
| 493 | 3300005439 | Ga0070711_100006625 | Ga0070711_1000066253 | 263 |
| 494 | 3300005439 | Ga0070711_100211393 | Ga0070711_1002113932 | 263 |
| 495 | 3300005441 | Ga0070700_100131634 | Ga0070700_1001316342 | 263 |
| 496 | 3300005444 | Ga0070694_100026753 | Ga0070694_1000267532 | 263 |
| 497 | 3300005445 | Ga0070708_100151044 | Ga0070708_1001510442 | 263 |
| 498 | 3300005445 | Ga0070708_100185275 | Ga0070708_1001852752 | 263 |
| 499 | 3300005456 | Ga0070678_100005090 | Ga0070678_1000050903 | 263 |
| 500 | 3300005456 | Ga0070678_100140767 | Ga0070678_1001407672 | 263 |
| 501 | 3300005457 | Ga0070662_100030069 | Ga0070662_1000300694 | 263 |
| 502 | 3300005457 | Ga0070662_100303593 | Ga0070662_1003035932 | 263 |
| 503 | 3300005459 | Ga0068867_100052758 | Ga0068867_1000527582 | 263 |
| 504 | 3300005466 | Ga0070685_10000622 | Ga0070685_100006224 | 263 |
| 505 | 3300005467 | Ga0070706_100018202 | Ga0070706_1000182023 | 263 |
| 506 | 3300005467 | Ga0070706_100082137 | Ga0070706_1000821374 | 263 |
| 507 | 3300005471 | Ga0070698_100129941 | Ga0070698_1001299411 | 263 |
| 508 | 3300005471 | Ga0070698_100156180 | Ga0070698_1001561802 | 263 |
| 509 | 3300005535 | Ga0070684_100338663 | Ga0070684_1003386631 | 263 |
| 510 | 3300005536 | Ga0070697_100063348 | Ga0070697_1000633482 | 263 |
| 511 | 3300005539 | Ga0068853_100197559 | Ga0068853_1001975592 | 263 |
| 512 | 3300005543 | Ga0070672_100206712 | Ga0070672_1002067122 | 263 |
| 513 | 3300005544 | Ga0070686_100039973 | Ga0070686_1000399733 | 263 |
| 514 | 3300005547 | Ga0070693_100002942 | Ga0070693_1000029426 | 263 |
| 515 | 3300005548 | Ga0070665_100061175 | Ga0070665_1000611752 | 263 |
| 516 | 3300005549 | Ga0070704_100034064 | Ga0070704_1000340643 | 263 |
| 517 | 3300005549 | Ga0070704_100048997 | Ga0070704_1000489974 | 263 |
| 518 | 3300005564 | Ga0070664_100141451 | Ga0070664_1001414512 | 263 |
| 519 | 3300005564 | Ga0070664_100281639 | Ga0070664_1002816392 | 263 |
| 520 | 3300005578 | Ga0068854_100024306 | Ga0068854_1000243062 | 263 |
| 521 | 3300005578 | Ga0068854_100042845 | Ga0068854_1000428452 | 263 |
| 522 | 3300005614 | Ga0068856_100045436 | Ga0068856_1000454363 | 263 |
| 523 | 3300005616 | Ga0068852_100086600 | Ga0068852_1000866002 | 263 |
| 524 | 3300005616 | Ga0068852_100289191 | Ga0068852_1002891912 | 263 |
| 525 | 3300005617 | Ga0068859_100003107 | Ga0068859_1000031075 | 263 |
| 526 | 3300005618 | Ga0068864_100000836 | Ga0068864_10000083610 | 263 |
| 527 | 3300005718 | Ga0068866_10013319 | Ga0068866_100133193 | 263 |
| 528 | 3300005718 | Ga0068866_10036721 | Ga0068866_100367212 | 263 |
| 529 | 3300005834 | Ga0068851_10024479 | Ga0068851_100244792 | 263 |
| 530 | 3300005840 | Ga0068870_10011964 | Ga0068870_100119643 | 263 |
| 531 | 3300005840 | Ga0068870_10023079 | Ga0068870_100230792 | 263 |
| 532 | 3300005841 | Ga0068863_100021653 | Ga0068863_1000216534 | 263 |
| 533 | 3300005842 | Ga0068858_100002758 | Ga0068858_1000027588 | 263 |
| 534 | 3300006163 | Ga0070715_10037871 | Ga0070715_100378712 | 263 |
| 535 | 3300006173 | Ga0070716_100050375 | Ga0070716_1000503753 | 263 |
| 536 | 3300006173 | Ga0070716_100133010 | Ga0070716_1001330102 | 263 |
| 537 | 3300006175 | Ga0070712_100002822 | Ga0070712_1000028223 | 263 |
| 538 | 3300006237 | Ga0097621_100104172 | Ga0097621_1001041722 | 263 |
| 539 | 3300006852 | Ga0075433_10024408 | Ga0075433_100244087 | 263 |
| 540 | 3300006852 | Ga0075433_10086669 | Ga0075433_100866694 | 263 |
| 541 | 3300006871 | Ga0075434_100171298 | Ga0075434_1001712983 | 263 |
| 542 | 3300006881 | Ga0068865_100015911 | Ga0068865_1000159112 | 263 |
| 543 | 3300006881 | Ga0068865_100122854 | Ga0068865_1001228542 | 263 |
| 544 | 3300006914 | Ga0075436_100040081 | Ga0075436_1000400813 | 263 |
| 545 | 3300006914 | Ga0075436_100091240 | Ga0075436_1000912402 | 263 |
| 546 | 3300006931 | Ga0097620_100003107 | Ga0097620_10000310711 | 263 |
| 547 | 3300007076 | Ga0075435_100058306 | Ga0075435_1000583063 | 263 |
| 548 | 3300007076 | Ga0075435_100157679 | Ga0075435_1001576792 | 263 |
| 549 | 3300007076 | Ga0075435_100169732 | Ga0075435_1001697322 | 263 |
| 550 | 3300009093 | Ga0105240_10288021 | Ga0105240_102880212 | 263 |
| 551 | 3300009094 | Ga0111539_10051311 | Ga0111539_100513111 | 263 |
| 552 | 3300009098 | Ga0105245_10026765 | Ga0105245_100267654 | 263 |
| 553 | 3300009098 | Ga0105245_10263450 | Ga0105245_102634502 | 263 |
| 554 | 3300009174 | Ga0105241_10295943 | Ga0105241_102959432 | 263 |
| 555 | 3300009176 | Ga0105242_10059031 | Ga0105242_100590312 | 263 |
| 556 | 3300009177 | Ga0105248_10048455 | Ga0105248_100484552 | 263 |
| 557 | 3300009545 | Ga0105237_10241390 | Ga0105237_102413902 | 263 |
| 558 | 3300009551 | Ga0105238_10180310 | Ga0105238_101803102 | 263 |
| 559 | 3300010375 | Ga0105239_10331116 | Ga0105239_103311162 | 263 |
| 560 | 3300013104 | Ga0157370_10011500 | Ga0157370_100115002 | 263 |
| 561 | 3300013104 | Ga0157370_10040922 | Ga0157370_100409223 | 263 |
| 562 | 3300013105 | Ga0157369_10100523 | Ga0157369_101005233 | 263 |
| 563 | 3300013296 | Ga0157374_10003153 | Ga0157374_100031533 | 263 |
| 564 | 3300013296 | Ga0157374_10107749 | Ga0157374_101077493 | 263 |
| 565 | 3300013297 | Ga0157378_10061343 | Ga0157378_100613433 | 263 |
| 566 | 3300013297 | Ga0157378_10082858 | Ga0157378_100828583 | 263 |
| 567 | 3300013297 | Ga0157378_10089570 | Ga0157378_100895702 | 263 |
| 568 | 3300013306 | Ga0163162_10033285 | Ga0163162_100332854 | 263 |
| 569 | 3300013308 | Ga0157375_10004445 | Ga0157375_100044454 | 263 |
| 570 | 3300013308 | Ga0157375_10372750 | Ga0157375_103727501 | 263 |
| 571 | 3300014325 | Ga0163163_10001349 | Ga0163163_1000134919 | 263 |
| 572 | 3300014326 | Ga0157380_10228374 | Ga0157380_102283742 | 263 |
| 573 | 3300014968 | Ga0157379_10001289 | Ga0157379_100012894 | 263 |
| 574 | 3300014969 | Ga0157376_10020955 | Ga0157376_100209554 | 263 |
| 575 | 3300014969 | Ga0157376_10469363 | Ga0157376_104693631 | 263 |
| 576 | 3300017792 | Ga0163161_10020325 | Ga0163161_100203253 | 263 |
| 577 | 3300025898 | Ga0207692_10007307 | Ga0207692_100073073 | 263 |
| 578 | 3300025903 | Ga0207680_10007835 | Ga0207680_100078352 | 263 |
| 579 | 3300025905 | Ga0207685_10012197 | Ga0207685_100121972 | 263 |
| 580 | 3300025906 | Ga0207699_10005093 | Ga0207699_100050934 | 263 |
| 581 | 3300025906 | Ga0207699_10261451 | Ga0207699_102614512 | 263 |
| 582 | 3300025907 | Ga0207645_10006124 | Ga0207645_100061243 | 263 |
| 583 | 3300025907 | Ga0207645_10148079 | Ga0207645_101480792 | 263 |
| 584 | 3300025908 | Ga0207643_10033369 | Ga0207643_100333693 | 263 |
| 585 | 3300025910 | Ga0207684_10014702 | Ga0207684_100147024 | 263 |
| 586 | 3300025915 | Ga0207693_10003564 | Ga0207693_100035648 | 263 |
| 587 | 3300025915 | Ga0207693_10017562 | Ga0207693_100175623 | 263 |
| 588 | 3300025916 | Ga0207663_10018700 | Ga0207663_100187002 | 263 |
| 589 | 3300025918 | Ga0207662_10047986 | Ga0207662_100479862 | 263 |
| 590 | 3300025919 | Ga0207657_10002457 | Ga0207657_1000245716 | 263 |
| 591 | 3300025921 | Ga0207652_10197046 | Ga0207652_101970462 | 263 |
| 592 | 3300025922 | Ga0207646_10449050 | Ga0207646_104490502 | 263 |
| 593 | 3300025925 | Ga0207650_10017431 | Ga0207650_100174314 | 263 |
| 594 | 3300025927 | Ga0207687_10006270 | Ga0207687_100062705 | 263 |
| 595 | 3300025928 | Ga0207700_10042935 | Ga0207700_100429354 | 263 |
| 596 | 3300025928 | Ga0207700_10080174 | Ga0207700_100801744 | 263 |
| 597 | 3300025929 | Ga0207664_10002996 | Ga0207664_100029966 | 263 |
| 598 | 3300025931 | Ga0207644_10005068 | Ga0207644_100050688 | 263 |
| 599 | 3300025932 | Ga0207690_10372730 | Ga0207690_103727301 | 263 |
| 600 | 3300025933 | Ga0207706_10012488 | Ga0207706_100124883 | 263 |
| 601 | 3300025933 | Ga0207706_10203781 | Ga0207706_102037812 | 263 |
| 602 | 3300025934 | Ga0207686_10003125 | Ga0207686_100031255 | 263 |
| 603 | 3300025934 | Ga0207686_10117516 | Ga0207686_101175162 | 263 |
| 604 | 3300025936 | Ga0207670_10011023 | Ga0207670_100110233 | 263 |
| 605 | 3300025937 | Ga0207669_10007186 | Ga0207669_100071863 | 263 |
| 606 | 3300025937 | Ga0207669_10021653 | Ga0207669_100216533 | 263 |
| 607 | 3300025939 | Ga0207665_10053124 | Ga0207665_100531242 | 263 |
| 608 | 3300025939 | Ga0207665_10159377 | Ga0207665_101593772 | 263 |
| 609 | 3300025940 | Ga0207691_10107741 | Ga0207691_101077412 | 263 |
| 610 | 3300025941 | Ga0207711_10000116 | Ga0207711_1000011611 | 263 |
| 611 | 3300025942 | Ga0207689_10038725 | Ga0207689_100387254 | 263 |
| 612 | 3300025942 | Ga0207689_10049651 | Ga0207689_100496513 | 263 |
| 613 | 3300025949 | Ga0207667_10269321 | Ga0207667_102693212 | 263 |
| 614 | 3300025960 | Ga0207651_10008341 | Ga0207651_100083412 | 263 |
| 615 | 3300025986 | Ga0207658_10003932 | Ga0207658_100039327 | 263 |
| 616 | 3300025986 | Ga0207658_10025921 | Ga0207658_100259214 | 263 |
| 617 | 3300026023 | Ga0207677_10000188 | Ga0207677_1000018821 | 263 |
| 618 | 3300026023 | Ga0207677_10290777 | Ga0207677_102907772 | 263 |
| 619 | 3300026035 | Ga0207703_10000806 | Ga0207703_1000080621 | 263 |
| 620 | 3300026075 | Ga0207708_10019956 | Ga0207708_100199562 | 263 |
| 621 | 3300026078 | Ga0207702_10014222 | Ga0207702_100142224 | 263 |
| 622 | 3300026078 | Ga0207702_10089675 | Ga0207702_100896753 | 263 |
| 623 | 3300026088 | Ga0207641_10004745 | Ga0207641_100047459 | 263 |
| 624 | 3300026088 | Ga0207641_10233487 | Ga0207641_102334872 | 263 |
| 625 | 3300026089 | Ga0207648_10014175 | Ga0207648_100141759 | 263 |
| 626 | 3300026089 | Ga0207648_10082574 | Ga0207648_100825742 | 263 |
| 627 | 3300026095 | Ga0207676_10000230 | Ga0207676_1000023023 | 263 |
| 628 | 3300026095 | Ga0207676_10331704 | Ga0207676_103317042 | 263 |
| 629 | 3300026116 | Ga0207674_10101644 | Ga0207674_101016442 | 263 |
| 630 | 3300026121 | Ga0207683_10001896 | Ga0207683_100018963 | 263 |
| 631 | 3300026142 | Ga0207698_10033201 | Ga0207698_100332013 | 263 |
| 632 | 3300026142 | Ga0207698_10297203 | Ga0207698_102972032 | 263 |
| 633 | 3300028379 | Ga0268266_10041686 | Ga0268266_100416864 | 263 |
| 634 | 3300028381 | Ga0268264_10003573 | Ga0268264_100035734 | 263 |
| 635 | 3300028381 | Ga0268264_10144070 | Ga0268264_101440702 | 263 |
| 636 | 3300035089 | Ga0373944_0010957 | Ga0373944_0010957_893_1810 | 263 |
| 637 | 3300035111 | Ga0373923_0003154 | Ga0373923_0003154_2665_3582 | 263 |
| 638 | 3300035118 | Ga0373954_0010837 | Ga0373954_0010837_223_1140 | 263 |
| 639 | 3300035119 | Ga0373956_0120799 | Ga0373956_0120799_222_1139 | 263 |
| 640 | 3300035120 | Ga0373957_0012504 | Ga0373957_0012504_1275_2192 | 263 |
| 641 | 3300035170 | Ga0373943_0023834 | Ga0373943_0023834_25_942 | 263 |
| 642 | 3300035170 | Ga0373943_0064831 | Ga0373943_0064831_795_1712 | 263 |
| 643 | 3300035172 | Ga0373955_0056781 | Ga0373955_0056781_1101_2018 | 263 |
| 644 | 3300035692 | Ga0373935_0154971 | Ga0373935_0154971_459_1376 | 263 |
| 645 | 3300035692 | Ga0373935_0217193 | Ga0373935_0217193_194_1102 | 263 |
| 646 | 3300035695 | Ga0373927_0028723 | Ga0373927_0028723_908_1825 | 263 |
| 647 | 3300035724 | Ga0373933_0015768 | Ga0373933_0015768_1753_2670 | 263 |
| 648 | 3300035725 | Ga0373947_0024324 | Ga0373947_0024324_2092_3009 | 263 |
| 649 | 3300036401 | Ga0373937_0011991 | Ga0373937_0011991_230_1174 | 263 |
| 650 | 3300036401 | Ga0373937_0050883 | Ga0373937_0050883_1127_2044 | 263 |
| 651 | 3300037068 | Ga0373925_0049596 | Ga0373925_0049596_736_1653 | 263 |
| 652 | 3300046459 | Ga0495629_0032236 | Ga0495629_0032236_747_1664 | 263 |
| 653 | 3300046472 | Ga0495580_0078401 | Ga0495580_0078401_575_1483 | 263 |
| 654 | 3300046472 | Ga0495580_0112981 | Ga0495580_0112981_27_944 | 263 |
| 655 | 3300046473 | Ga0495582_0038857 | Ga0495582_0038857_624_1541 | 263 |
| 656 | 3300046477 | Ga0495664_0014729 | Ga0495664_0014729_2089_3006 | 263 |
| 657 | 3300046543 | Ga0495645_0105370 | Ga0495645_0105370_43_960 | 263 |
| 658 | 3300046663 | Ga0495635_0064143 | Ga0495635_0064143_878_1795 | 263 |
| 659 | 3300046681 | Ga0495647_0005212 | Ga0495647_0005212_2112_3029 | 263 |
| 660 | 3300046689 | Ga0495613_0025522 | Ga0495613_0025522_1200_2117 | 263 |
| 661 | 3300047315 | Ga0495581_0004852 | Ga0495581_0004852_6094_7011 | 263 |
| 662 | 3300047471 | Ga0495684_0012214 | Ga0495684_0012214_5146_6063 | 263 |
| 663 | 3300047471 | Ga0495684_0143901 | Ga0495684_0143901_817_1734 | 263 |
| 664 | 3300048903 | Ga0496100_0025658 | Ga0496100_0025658_2002_2919 | 263 |
| 665 | 3300048904 | Ga0496101_0069996 | Ga0496101_0069996_650_1567 | 263 |
| 666 | 3300048907 | Ga0496104_0024227 | Ga0496104_0024227_3731_4648 | 263 |
| 667 | 3300048908 | Ga0496105_0016623 | Ga0496105_0016623_1254_2171 | 263 |
| 668 | 3300048912 | Ga0496109_0056893 | Ga0496109_0056893_2641_3558 | 263 |
| 669 | 3300048915 | Ga0496112_0031287 | Ga0496112_0031287_833_1750 | 263 |
| 670 | 3300050512 | nmdc:mga0n895_182014_c1 | nmdc:mga0n895_182014_c1_1064_1972 | 263 |
| 671 | 3300050513 | nmdc:mga0rr50_129280_c1 | nmdc:mga0rr50_129280_c1_146_1054 | 263 |
| 672 | 3300050513 | nmdc:mga0rr50_316546_c1 | nmdc:mga0rr50_316546_c1_205_1104 | 263 |
| 673 | 3300050513 | nmdc:mga0rr50_442489_c1 | nmdc:mga0rr50_442489_c1_131_1048 | 263 |
| 674 | 3300050514 | nmdc:mga08x19_46304_c1 | nmdc:mga08x19_46304_c1_802_1710 | 263 |
| 675 | 3300050515 | nmdc:mga0a205_180331_c1 | nmdc:mga0a205_180331_c1_686_1594 | 263 |
| 676 | 3300050515 | nmdc:mga0a205_9988_c1 | nmdc:mga0a205_9988_c1_3717_4625 | 263 |
| 677 | 3300053077 | Ga0495601_0207454 | Ga0495601_0207454_96_1013 | 263 |
| 678 | 3300053078 | Ga0495612_0057663 | Ga0495612_0057663_201_1118 | 263 |
| 679 | 3300053085 | Ga0495619_0044721 | Ga0495619_0044721_807_1724 | 263 |
| 680 | 3300005327 | Ga0070658_10058655 | Ga0070658_100586552 | 264 |
| 681 | 3300005329 | Ga0070683_100068000 | Ga0070683_1000680003 | 264 |
| 682 | 3300005339 | Ga0070660_100050027 | Ga0070660_1000500272 | 264 |
| 683 | 3300005344 | Ga0070661_100139946 | Ga0070661_1001399462 | 264 |
| 684 | 3300005366 | Ga0070659_100084993 | Ga0070659_1000849933 | 264 |
| 685 | 3300005366 | Ga0070659_100120959 | Ga0070659_1001209592 | 264 |
| 686 | 3300005366 | Ga0070659_100305378 | Ga0070659_1003053781 | 264 |
| 687 | 3300005435 | Ga0070714_100085264 | Ga0070714_1000852642 | 264 |
| 688 | 3300005455 | Ga0070663_100052938 | Ga0070663_1000529382 | 264 |
| 689 | 3300005535 | Ga0070684_100025993 | Ga0070684_1000259935 | 264 |
| 690 | 3300005539 | Ga0068853_100096733 | Ga0068853_1000967332 | 264 |
| 691 | 3300005563 | Ga0068855_100129444 | Ga0068855_1001294444 | 264 |
| 692 | 3300005564 | Ga0070664_100084109 | Ga0070664_1000841093 | 264 |
| 693 | 3300005578 | Ga0068854_100026753 | Ga0068854_1000267535 | 264 |
| 694 | 3300005614 | Ga0068856_100295722 | Ga0068856_1002957221 | 264 |
| 695 | 3300005616 | Ga0068852_100233925 | Ga0068852_1002339252 | 264 |
| 696 | 3300005834 | Ga0068851_10003303 | Ga0068851_100033032 | 264 |
| 697 | 3300009093 | Ga0105240_10148561 | Ga0105240_101485614 | 264 |
| 698 | 3300009174 | Ga0105241_10295580 | Ga0105241_102955801 | 264 |
| 699 | 3300009545 | Ga0105237_10151393 | Ga0105237_101513932 | 264 |
| 700 | 3300009551 | Ga0105238_10050122 | Ga0105238_100501225 | 264 |
| 701 | 3300013100 | Ga0157373_10008074 | Ga0157373_100080743 | 264 |
| 702 | 3300013102 | Ga0157371_10056803 | Ga0157371_100568033 | 264 |
| 703 | 3300013105 | Ga0157369_10049473 | Ga0157369_100494735 | 264 |
| 704 | 3300013307 | Ga0157372_10524910 | Ga0157372_105249102 | 264 |
| 705 | 3300025911 | Ga0207654_10052805 | Ga0207654_100528052 | 264 |
| 706 | 3300025912 | Ga0207707_10143861 | Ga0207707_101438612 | 264 |
| 707 | 3300025913 | Ga0207695_10065559 | Ga0207695_100655592 | 264 |
| 708 | 3300025917 | Ga0207660_10073160 | Ga0207660_100731602 | 264 |
| 709 | 3300025919 | Ga0207657_10000329 | Ga0207657_1000032937 | 264 |
| 710 | 3300025919 | Ga0207657_10099847 | Ga0207657_100998472 | 264 |
| 711 | 3300025921 | Ga0207652_10005308 | Ga0207652_100053082 | 264 |
| 712 | 3300025924 | Ga0207694_10020347 | Ga0207694_100203475 | 264 |
| 713 | 3300025944 | Ga0207661_10370111 | Ga0207661_103701111 | 264 |
| 714 | 3300025949 | Ga0207667_10051082 | Ga0207667_100510825 | 264 |
| 715 | 3300025949 | Ga0207667_10270212 | Ga0207667_102702122 | 264 |
| 716 | 3300025981 | Ga0207640_10301188 | Ga0207640_103011882 | 264 |
| 717 | 3300026067 | Ga0207678_10005798 | Ga0207678_100057987 | 264 |
| 718 | 3300026078 | Ga0207702_10293779 | Ga0207702_102937792 | 264 |
| 719 | 3300026116 | Ga0207674_10001017 | Ga0207674_1000101727 | 264 |
| 720 | 3300038443 | Ga0395901_0191131 | Ga0395901_0191131_1092_1985 | 264 |
| 721 | 3300048909 | Ga0496106_0325054 | Ga0496106_0325054_164_1084 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bgw-assembly1.cif.gz_B | xpf from aeropyrum pernix, complex with dna | 0.6824 | 100 | 169 |
| 6t8g-assembly1.cif.gz_F | stalled ftsk motor domain bound to dsdna | 0.6735 | 74 | 179 |
| 3io5-assembly1.cif.gz_A | crystal structure of a dimeric form of the uvsx recombinase core domain from enterobacteria phage t4 | 0.6645 | 65 | 170 |
| 2qp9-assembly1.cif.gz_X | crystal structure of s.cerevisiae vps4 | 0.6588 | 44 | 182 |
| 6hqu-assembly5.cif.gz_E | humanised rada mutant humrada22 in complex with a recombined brc repeat 8-2 | 0.6516 | 73 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58294_3_157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7838 | 45 | 181 | 3.40.50.300 |
| 3eieA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7558 | 40 | 182 | 3.40.50.300 |
| 2v1uA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7405 | 49 | 171 | 3.40.50.300 |
| af_Q9W102_1_216_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.731 | 49 | 178 | 3.40.50.300 |
| af_Q54RM2_213_419_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.731 | 44 | 176 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537EAG2-F1-model_v4 | DUF815 domain-containing protein | 0.9638 | 59 | 173 |
|
| AF-A0A7S1DKY2-F1-model_v4 | AAA+ ATPase domain-containing protein | 0.9629 | 27 | 136 |
|
| AF-A0A3D0FJ67-F1-model_v4 | deleted | 0.9511 | 17 | 148 |
|
| AF-A0A3C0IHF1-F1-model_v4 | deleted | 0.9504 | 17 | 134 |
|
| AF-A0A6P1B0P3-F1-model_v4 | deleted | 0.9482 | 67 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar