F477222

General Info

Members Datasets Scaffolds Average Seq Length
719 262 1438 142

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100803938|Ga0070708_1008039382
Length 145
Sequence MLAMSPPGKDACRAWQLLMKFFFAQRAHLPSGARSDLSPIQCHVLHLIEPARPLPMSRLADTLSCDASNVTGLVDRLESRGLVRRRSSPQDRRVKVLQLTPAGARLRTRLLRQMTGGSFPLSRLSLDQQRTLVNILEELVDEKPT

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 3.62
Rhizosphere 93.46
Stem 0
Stem Tuber 0
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100803938 3300005445 Bacteria 884
2 JGI24034J26672_10122898 3300002239 Unclassified 503
3 Ga0058862_12063970 3300004803 Unclassified 863
4 Ga0065712_10400689 3300005290 Unclassified 720
5 Ga0065715_10151115 3300005293 Unclassified 1728
6 Ga0065707_10447865 3300005295 Unclassified 803
7 Ga0070676_10468652 3300005328 Bacteria 889
8 Ga0070683_100024471 3300005329 Bacteria 5409
9 Ga0070683_100188733 3300005329 Bacteria 1957
10 Ga0070690_100222246 3300005330 Bacteria 1324
11 Ga0070690_100256176 3300005330 Bacteria 1240
12 Ga0070670_100169090 3300005331 Bacteria 1896
13 Ga0068869_100476979 3300005334 Unclassified 1038
14 Ga0068869_101826513 3300005334 Bacteria 544
15 Ga0070666_10009138 3300005335 Bacteria 6179
16 Ga0070666_10085454 3300005335 Bacteria 2161
17 Ga0070666_10096794 3300005335 Bacteria 2032
18 Ga0070666_10251937 3300005335 Bacteria 1250
19 Ga0070666_10270896 3300005335 Bacteria 1205
20 Ga0070680_100034696 3300005336 Bacteria 4068
21 Ga0070682_101446242 3300005337 Bacteria 589
22 Ga0068868_100008309 3300005338 Bacteria 7430
23 Ga0068868_100032608 3300005338 Bacteria 4009
24 Ga0068868_100074233 3300005338 Bacteria 2716
25 Ga0068868_100157475 3300005338 Unclassified 1874
26 Ga0068868_100218673 3300005338 Unclassified 1594
27 Ga0068868_101526477 3300005338 Bacteria 626
28 Ga0070660_100360577 3300005339 Unclassified 1198
29 Ga0070689_100091180 3300005340 Bacteria 2402
30 Ga0070689_100678783 3300005340 Bacteria 898
31 Ga0070691_10317717 3300005341 Unclassified 856
32 Ga0070687_100017247 3300005343 Bacteria 3315
33 Ga0070687_100148139 3300005343 Bacteria 1375
34 Ga0070661_100324340 3300005344 Bacteria 1203
35 Ga0070692_10219573 3300005345 Bacteria 1123
36 Ga0070668_100267918 3300005347 Unclassified 1423
37 Ga0070668_100347650 3300005347 Bacteria 1254
38 Ga0070668_100971459 3300005347 Bacteria 762
39 Ga0070668_101779398 3300005347 Bacteria 566
40 Ga0070669_100123212 3300005353 Bacteria 1981
41 Ga0070669_100238790 3300005353 Bacteria 1443
42 Ga0070669_100417939 3300005353 Bacteria 1100
43 Ga0070669_100685935 3300005353 Bacteria 864
44 Ga0070675_100000592 3300005354 Bacteria 24826
45 Ga0070675_100004841 3300005354 Bacteria 10271
46 Ga0070675_100163824 3300005354 Unclassified 1914
47 Ga0070675_100407046 3300005354 Bacteria 1214
48 Ga0070675_101201258 3300005354 Bacteria 698
49 Ga0070675_101709316 3300005354 Unclassified 581
50 Ga0070671_100174385 3300005355 Bacteria 1819
51 Ga0070671_100327259 3300005355 Bacteria 1306
52 Ga0070674_100068289 3300005356 Bacteria 2503
53 Ga0070673_100101444 3300005364 Bacteria 2371
54 Ga0070673_100113229 3300005364 Unclassified 2253
55 Ga0070673_100362943 3300005364 Unclassified 1288
56 Ga0070673_100715686 3300005364 Bacteria 920
57 Ga0070688_100076196 3300005365 Bacteria 2158
58 Ga0070688_100174366 3300005365 Bacteria 1487
59 Ga0070667_100068847 3300005367 Bacteria 3012
60 Ga0070667_100397401 3300005367 Bacteria 1254
61 Ga0070667_100557869 3300005367 Bacteria 1053
62 Ga0070713_100011637 3300005436 Bacteria 6418
63 Ga0070710_10767186 3300005437 Bacteria 686
64 Ga0070701_10031641 3300005438 Bacteria 2626
65 Ga0070701_10133241 3300005438 Bacteria 1414
66 Ga0070701_10234324 3300005438 Unclassified 1101
67 Ga0070711_100329464 3300005439 Bacteria 1222
68 Ga0070705_100057384 3300005440 Bacteria 2297
69 Ga0070705_101569253 3300005440 Unclassified 553
70 Ga0070700_100040069 3300005441 Bacteria 2866
71 Ga0070700_100641300 3300005441 Bacteria 838
72 Ga0070694_100190396 3300005444 Bacteria 1523
73 Ga0070694_100278239 3300005444 Bacteria 1275
74 Ga0070708_100072612 3300005445 Bacteria 3100
75 Ga0070708_100187730 3300005445 Bacteria 1933
76 Ga0070663_100158504 3300005455 Bacteria 1741
77 Ga0070678_100006462 3300005456 Bacteria 6883
78 Ga0070678_100215649 3300005456 Bacteria 1593
79 Ga0070678_100270764 3300005456 Bacteria 1432
80 Ga0070678_100390556 3300005456 Bacteria 1206
81 Ga0070662_100250069 3300005457 Bacteria 1425
82 Ga0070662_100449802 3300005457 Bacteria 1069
83 Ga0070662_100562853 3300005457 Bacteria 956
84 Ga0070681_10008390 3300005458 Bacteria 10117
85 Ga0070681_11223767 3300005458 Bacteria 673
86 Ga0068867_100012670 3300005459 Bacteria 5963
87 Ga0068867_100020140 3300005459 Bacteria 4752
88 Ga0068867_100189899 3300005459 Bacteria 1639
89 Ga0068867_100250206 3300005459 Bacteria 1441
90 Ga0068867_100691921 3300005459 Bacteria 899
91 Ga0070685_10077977 3300005466 Bacteria 1980
92 Ga0070685_10328389 3300005466 Bacteria 1039
93 Ga0070685_10378107 3300005466 Bacteria 975
94 Ga0070706_100022939 3300005467 Bacteria 5748
95 Ga0070706_100088894 3300005467 Bacteria 2864
96 Ga0070706_100580443 3300005467 Bacteria 1042
97 Ga0070706_100583664 3300005467 Bacteria 1039
98 Ga0070706_100684788 3300005467 Bacteria 951
99 Ga0070707_100002713 3300005468 Bacteria 16847
100 Ga0070707_100032924 3300005468 Bacteria 4940
101 Ga0070707_100042822 3300005468 Bacteria 4335
102 Ga0070707_100132329 3300005468 Bacteria 2426
103 Ga0070707_100672623 3300005468 Unclassified 998
104 Ga0070707_101631153 3300005468 Bacteria 612
105 Ga0070707_102001132 3300005468 Unclassified 547
106 Ga0070698_100023398 3300005471 Bacteria 6457
107 Ga0070698_100457186 3300005471 Bacteria 1212
108 Ga0070698_100845554 3300005471 Bacteria 860
109 Ga0070698_100880232 3300005471 Unclassified 841
110 Ga0070698_101153921 3300005471 Bacteria 724
111 Ga0070699_100767467 3300005518 Unclassified 882
112 Ga0070684_100319075 3300005535 Bacteria 1427
113 Ga0070697_100051099 3300005536 Bacteria 3358
114 Ga0070697_100107204 3300005536 Unclassified 2324
115 Ga0070697_100323116 3300005536 Bacteria 1329
116 Ga0070697_100394254 3300005536 Bacteria 1200
117 Ga0068853_100125987 3300005539 Bacteria 2288
118 Ga0068853_101023712 3300005539 Unclassified 795
119 Ga0070672_100227454 3300005543 Bacteria 1566
120 Ga0070672_101014579 3300005543 Bacteria 736
121 Ga0070686_100001743 3300005544 Bacteria 12171
122 Ga0070686_100127344 3300005544 Bacteria 1756
123 Ga0070686_100127628 3300005544 Bacteria 1755
124 Ga0070686_100891314 3300005544 Bacteria 723
125 Ga0070695_100174750 3300005545 Bacteria 1518
126 Ga0070695_100528934 3300005545 Bacteria 916
127 Ga0070696_100032653 3300005546 Bacteria 3572
128 Ga0070696_100475501 3300005546 Unclassified 990
129 Ga0070665_100000621 3300005548 Bacteria 48400
130 Ga0070665_100004858 3300005548 Bacteria 13967
131 Ga0070665_100018748 3300005548 Bacteria 6937
132 Ga0070665_100139947 3300005548 Bacteria 2424
133 Ga0070665_100142964 3300005548 Bacteria 2396
134 Ga0070665_100205151 3300005548 Bacteria 1972
135 Ga0070665_100557518 3300005548 Bacteria 1158
136 Ga0070665_101589106 3300005548 Bacteria 662
137 Ga0070704_100247604 3300005549 Bacteria 1462
138 Ga0070704_100312690 3300005549 Unclassified 1313
139 Ga0070704_100376307 3300005549 Bacteria 1205
140 Ga0068855_101213597 3300005563 Bacteria 784
141 Ga0070664_100392113 3300005564 Bacteria 1269
142 Ga0070664_100668436 3300005564 Bacteria 966
143 Ga0070664_101229528 3300005564 Unclassified 707
144 Ga0068854_100108639 3300005578 Bacteria 2089
145 Ga0068854_100641530 3300005578 Bacteria 911
146 Ga0068854_100656494 3300005578 Bacteria 901
147 Ga0068854_100816146 3300005578 Unclassified 814
148 Ga0068852_102170829 3300005616 Bacteria 577
149 Ga0068859_100141533 3300005617 Bacteria 2479
150 Ga0068859_100206839 3300005617 Bacteria 2048
151 Ga0068859_100228473 3300005617 Bacteria 1949
152 Ga0068859_100581868 3300005617 Bacteria 1213
153 Ga0068859_100662786 3300005617 Bacteria 1135
154 Ga0068859_100753156 3300005617 Bacteria 1063
155 Ga0068859_100918140 3300005617 Bacteria 960
156 Ga0068864_100380764 3300005618 Bacteria 1337
157 Ga0068864_100435878 3300005618 Bacteria 1251
158 Ga0068864_100558513 3300005618 Bacteria 1107
159 Ga0068864_100856411 3300005618 Bacteria 896
160 Ga0068866_10017925 3300005718 Bacteria 3194
161 Ga0068866_10046188 3300005718 Bacteria 2189
162 Ga0068866_10948235 3300005718 Bacteria 608
163 Ga0068866_11350450 3300005718 Unclassified 519
164 Ga0068866_11463543 3300005718 Unclassified 501
165 Ga0068861_100025520 3300005719 Bacteria 4287
166 Ga0068861_100465426 3300005719 Bacteria 1136
167 Ga0068861_100765083 3300005719 Bacteria 903
168 Ga0068861_102116092 3300005719 Bacteria 563
169 Ga0068870_10335098 3300005840 Bacteria 966
170 Ga0068870_10489631 3300005840 Unclassified 818
171 Ga0068863_100061314 3300005841 Unclassified 3556
172 Ga0068863_100071951 3300005841 Bacteria 3272
173 Ga0068863_100293587 3300005841 Bacteria 1576
174 Ga0068863_100651888 3300005841 Bacteria 1044
175 Ga0068863_102176032 3300005841 Bacteria 565
176 Ga0068858_100006135 3300005842 Bacteria 11721
177 Ga0068858_100041962 3300005842 Bacteria 4242
178 Ga0068858_100091993 3300005842 Bacteria 2823
179 Ga0068858_100145708 3300005842 Unclassified 2224
180 Ga0068858_100242174 3300005842 Bacteria 1712
181 Ga0068858_100267748 3300005842 Bacteria 1625
182 Ga0068858_100339433 3300005842 Bacteria 1438
183 Ga0068858_100503736 3300005842 Bacteria 1170
184 Ga0068858_100873248 3300005842 Unclassified 879
185 Ga0068858_101013887 3300005842 Unclassified 814
186 Ga0068860_100091913 3300005843 Bacteria 2891
187 Ga0068860_100102653 3300005843 Bacteria 2729
188 Ga0068860_100192653 3300005843 Bacteria 1973
189 Ga0068860_100209371 3300005843 Bacteria 1891
190 Ga0068860_100432814 3300005843 Bacteria 1306
191 Ga0068860_100512171 3300005843 Bacteria 1199
192 Ga0068860_100529427 3300005843 Bacteria 1179
193 Ga0068860_100757240 3300005843 Bacteria 983
194 Ga0068860_100808143 3300005843 Unclassified 951
195 Ga0068860_100928752 3300005843 Bacteria 887
196 Ga0068860_101304806 3300005843 Bacteria 747
197 Ga0068860_101357061 3300005843 Bacteria 732
198 Ga0068862_100059338 3300005844 Bacteria 3285
199 Ga0068862_100066577 3300005844 Bacteria 3104
200 Ga0068862_101221305 3300005844 Bacteria 751
201 Ga0075365_10016108 3300006038 Bacteria 4538
202 Ga0075364_10234841 3300006051 Unclassified 1245
203 Ga0075364_11047585 3300006051 Bacteria 554
204 Ga0070715_10071264 3300006163 Bacteria 1553
205 Ga0075362_10152496 3300006177 Unclassified 1109
206 Ga0075367_10088162 3300006178 Bacteria 1885
207 Ga0075367_10150143 3300006178 Bacteria 1446
208 Ga0075366_10000097 3300006195 Bacteria 35368
209 Ga0075366_10055850 3300006195 Bacteria 2345
210 Ga0097621_100002929 3300006237 Bacteria 11735
211 Ga0097621_100012191 3300006237 Bacteria 6360
212 Ga0097621_100064190 3300006237 Bacteria 3019
213 Ga0097621_100634858 3300006237 Bacteria 979
214 Ga0097621_101244652 3300006237 Unclassified 702
215 Ga0075370_10226336 3300006353 Bacteria 1106
216 Ga0068871_100002896 3300006358 Bacteria 11775
217 Ga0068871_100108781 3300006358 Bacteria 2330
218 Ga0068871_100168511 3300006358 Bacteria 1876
219 Ga0068871_100172004 3300006358 Bacteria 1857
220 Ga0068871_100180881 3300006358 Bacteria 1812
221 Ga0068871_100536984 3300006358 Bacteria 1058
222 Ga0068871_100561782 3300006358 Bacteria 1034
223 Ga0068871_101207460 3300006358 Bacteria 709
224 Ga0075428_100224043 3300006844 Bacteria 2030
225 Ga0075428_100656471 3300006844 Bacteria 1118
226 Ga0075430_100297974 3300006846 Unclassified 1334
227 Ga0075431_100001434 3300006847 Bacteria 21940
228 Ga0075431_100014423 3300006847 Bacteria 7994
229 Ga0075431_100120608 3300006847 Bacteria 2706
230 Ga0075433_10044120 3300006852 Bacteria 3873
231 Ga0075433_10170968 3300006852 Bacteria 1934
232 Ga0075433_10767203 3300006852 Bacteria 843
233 Ga0075434_100063199 3300006871 Bacteria 3684
234 Ga0075434_100213491 3300006871 Bacteria 1950
235 Ga0075434_100223408 3300006871 Bacteria 1903
236 Ga0075434_101114622 3300006871 Bacteria 802
237 Ga0075429_100010279 3300006880 Bacteria 8097
238 Ga0075429_100103151 3300006880 Bacteria 2491
239 Ga0075429_100606331 3300006880 Bacteria 959
240 Ga0068865_100003401 3300006881 Bacteria 9522
241 Ga0068865_100009239 3300006881 Bacteria 6104
242 Ga0068865_100011343 3300006881 Bacteria 5573
243 Ga0068865_100013766 3300006881 Bacteria 5124
244 Ga0068865_101316434 3300006881 Unclassified 643
245 Ga0075436_100090730 3300006914 Bacteria 2124
246 Ga0097620_100141539 3300006931 Bacteria 2479
247 Ga0097620_100206849 3300006931 Bacteria 2048
248 Ga0097620_100228482 3300006931 Bacteria 1949
249 Ga0097620_100581973 3300006931 Bacteria 1213
250 Ga0097620_100662772 3300006931 Bacteria 1135
251 Ga0097620_100753094 3300006931 Bacteria 1063
252 Ga0097620_100918256 3300006931 Bacteria 960
253 Ga0075435_100000288 3300007076 Bacteria 31268
254 Ga0075435_100076322 3300007076 Bacteria 2746
255 Ga0075435_100222942 3300007076 Bacteria 1601
256 Ga0075435_100364302 3300007076 Bacteria 1240
257 Ga0075435_101057469 3300007076 Bacteria 709
258 Ga0105250_10180555 3300009092 Unclassified 885
259 Ga0105240_10006633 3300009093 Bacteria 16988
260 Ga0105240_11531881 3300009093 Archaea 699
261 Ga0111539_10000298 3300009094 Bacteria 60092
262 Ga0111539_10064452 3300009094 Bacteria 4334
263 Ga0111539_10118705 3300009094 Bacteria 3100
264 Ga0111539_10170432 3300009094 Bacteria 2543
265 Ga0111539_10312103 3300009094 Bacteria 1830
266 Ga0111539_10678765 3300009094 Bacteria 1199
267 Ga0111539_11237155 3300009094 Unclassified 867
268 Ga0105245_10091033 3300009098 Bacteria 2807
269 Ga0105245_10119692 3300009098 Bacteria 2458
270 Ga0105245_10198324 3300009098 Bacteria 1926
271 Ga0105245_11409126 3300009098 Bacteria 747
272 Ga0105245_11484527 3300009098 Unclassified 729
273 Ga0105247_10381352 3300009101 Bacteria 1000
274 Ga0105247_10453881 3300009101 Bacteria 925
275 Ga0114129_10094037 3300009147 Bacteria 4152
276 Ga0114129_10099636 3300009147 Bacteria 4022
277 Ga0114129_10622934 3300009147 Bacteria 1395
278 Ga0114129_10779851 3300009147 Bacteria 1221
279 Ga0105243_10050204 3300009148 Bacteria 3295
280 Ga0105243_10549985 3300009148 Bacteria 1103
281 Ga0105243_11706919 3300009148 Bacteria 659
282 Ga0105241_10074342 3300009174 Bacteria 2646
283 Ga0105241_10173040 3300009174 Bacteria 1785
284 Ga0105241_11323032 3300009174 Bacteria 687
285 Ga0105242_10001789 3300009176 Bacteria 16958
286 Ga0105242_10005888 3300009176 Bacteria 9451
287 Ga0105242_10032681 3300009176 Bacteria 4162
288 Ga0105242_10035071 3300009176 Bacteria 4023
289 Ga0105242_10351289 3300009176 Bacteria 1362
290 Ga0105242_10598718 3300009176 Bacteria 1064
291 Ga0105242_12119324 3300009176 Unclassified 606
292 Ga0105248_10053464 3300009177 Bacteria 4532
293 Ga0105248_10061790 3300009177 Bacteria 4207
294 Ga0105248_10065128 3300009177 Bacteria 4091
295 Ga0105248_10076962 3300009177 Bacteria 3750
296 Ga0105248_10099847 3300009177 Bacteria 3271
297 Ga0105248_10113604 3300009177 Bacteria 3054
298 Ga0105248_10134703 3300009177 Bacteria 2787
299 Ga0105248_10156213 3300009177 Bacteria 2574
300 Ga0105248_10202915 3300009177 Bacteria 2234
301 Ga0105248_10345577 3300009177 Bacteria 1675
302 Ga0105248_10449052 3300009177 Bacteria 1453
303 Ga0105248_10513002 3300009177 Bacteria 1352
304 Ga0105248_10623423 3300009177 Bacteria 1217
305 Ga0105248_10792503 3300009177 Bacteria 1069
306 Ga0105248_12525203 3300009177 Unclassified 586
307 Ga0105238_10366391 3300009551 Unclassified 1431
308 Ga0105249_10104836 3300009553 Bacteria 2665
309 Ga0105249_10141670 3300009553 Bacteria 2306
310 Ga0105249_10230445 3300009553 Bacteria 1827
311 Ga0105249_12182516 3300009553 Bacteria 627
312 Ga0105239_10473441 3300010375 Bacteria 1422
313 Ga0105239_11720125 3300010375 Bacteria 726
314 Ga0105239_13328485 3300010375 Bacteria 523
315 Ga0157374_10131827 3300013296 Bacteria 2419
316 Ga0157374_10144144 3300013296 Bacteria 2313
317 Ga0157374_10425375 3300013296 Bacteria 1327
318 Ga0157374_10808444 3300013296 Unclassified 953
319 Ga0157378_10325130 3300013297 Bacteria 1495
320 Ga0157378_10649600 3300013297 Unclassified 1070
321 Ga0163162_10010669 3300013306 Bacteria 8934
322 Ga0163162_10118177 3300013306 Bacteria 2753
323 Ga0163162_10827394 3300013306 Unclassified 1042
324 Ga0163162_11173171 3300013306 Bacteria 871
325 Ga0163162_11794527 3300013306 Bacteria 701
326 Ga0157375_10096114 3300013308 Bacteria 3035
327 Ga0157375_10117580 3300013308 Bacteria 2764
328 Ga0157375_10273078 3300013308 Bacteria 1853
329 Ga0157375_10835987 3300013308 Bacteria 1068
330 Ga0157375_11340069 3300013308 Bacteria 842
331 Ga0157375_11450574 3300013308 Bacteria 809
332 Ga0163163_10370583 3300014325 Bacteria 1489
333 Ga0163163_10469853 3300014325 Bacteria 1318
334 Ga0163163_10551145 3300014325 Bacteria 1215
335 Ga0163163_11634890 3300014325 Bacteria 705
336 Ga0157380_10006238 3300014326 Bacteria 8375
337 Ga0157380_10014213 3300014326 Bacteria 5821
338 Ga0157380_10101294 3300014326 Bacteria 2399
339 Ga0157380_10115100 3300014326 Bacteria 2267
340 Ga0157380_10160833 3300014326 Bacteria 1952
341 Ga0157380_10184908 3300014326 Bacteria 1834
342 Ga0157380_11017724 3300014326 Unclassified 863
343 Ga0157380_12338775 3300014326 Bacteria 599
344 Ga0157380_12374419 3300014326 Bacteria 595
345 Ga0157380_12490602 3300014326 Unclassified 583
346 Ga0157377_10298317 3300014745 Bacteria 1062
347 Ga0157379_10023333 3300014968 Bacteria 5490
348 Ga0157379_10150917 3300014968 Bacteria 2096
349 Ga0157379_10207788 3300014968 Bacteria 1772
350 Ga0157379_10504421 3300014968 Bacteria 1122
351 Ga0157379_10522386 3300014968 Unclassified 1102
352 Ga0157379_10867328 3300014968 Bacteria 855
353 Ga0157379_11009288 3300014968 Bacteria 794
354 Ga0157379_11348828 3300014968 Bacteria 690
355 Ga0157376_10004354 3300014969 Bacteria 9846
356 Ga0157376_10012057 3300014969 Bacteria 6399
357 Ga0157376_10149657 3300014969 Bacteria 2104
358 Ga0157376_10593540 3300014969 Bacteria 1101
359 Ga0182007_10186867 3300015262 Unclassified 719
360 Ga0163161_10439319 3300017792 Bacteria 1053
361 Ga0163161_11082893 3300017792 Unclassified 688
362 Ga0207692_10305146 3300025898 Bacteria 970
363 Ga0207680_10041338 3300025903 Bacteria 2689
364 Ga0207680_10077187 3300025903 Bacteria 2083
365 Ga0207680_10178261 3300025903 Bacteria 1435
366 Ga0207680_10276611 3300025903 Bacteria 1165
367 Ga0207680_10309232 3300025903 Unclassified 1103
368 Ga0207685_10152983 3300025905 Unclassified 1046
369 Ga0207685_10403377 3300025905 Bacteria 701
370 Ga0207645_10321985 3300025907 Bacteria 1031
371 Ga0207643_10300212 3300025908 Bacteria 999
372 Ga0207684_10341074 3300025910 Bacteria 1290
373 Ga0207654_10058632 3300025911 Bacteria 2242
374 Ga0207707_10299685 3300025912 Unclassified 1390
375 Ga0207695_10169455 3300025913 Bacteria 2110
376 Ga0207693_10574773 3300025915 Bacteria 878
377 Ga0207660_10059473 3300025917 Bacteria 2743
378 Ga0207657_10190902 3300025919 Unclassified 1653
379 Ga0207646_10003369 3300025922 Bacteria 18100
380 Ga0207646_10053316 3300025922 Bacteria 3618
381 Ga0207681_10005701 3300025923 Bacteria 7644
382 Ga0207681_10008528 3300025923 Bacteria 6259
383 Ga0207681_10598865 3300025923 Bacteria 911
384 Ga0207681_11117141 3300025923 Bacteria 662
385 Ga0207681_11471445 3300025923 Unclassified 571
386 Ga0207650_10091815 3300025925 Bacteria 2321
387 Ga0207650_10112124 3300025925 Bacteria 2113
388 Ga0207650_10673300 3300025925 Bacteria 873
389 Ga0207659_10002837 3300025926 Bacteria 10341
390 Ga0207659_10005128 3300025926 Bacteria 7943
391 Ga0207659_10061067 3300025926 Bacteria 2715
392 Ga0207659_10083794 3300025926 Bacteria 2364
393 Ga0207659_10150778 3300025926 Bacteria 1815
394 Ga0207659_10204730 3300025926 Unclassified 1578
395 Ga0207687_10012986 3300025927 Bacteria 5442
396 Ga0207687_10023051 3300025927 Bacteria 4146
397 Ga0207687_10163592 3300025927 Bacteria 1710
398 Ga0207687_10290671 3300025927 Bacteria 1313
399 Ga0207687_10512652 3300025927 Unclassified 1002
400 Ga0207700_10004573 3300025928 Bacteria 8183
401 Ga0207644_10116192 3300025931 Bacteria 2030
402 Ga0207644_10314597 3300025931 Bacteria 1265
403 Ga0207690_10103376 3300025932 Bacteria 2039
404 Ga0207706_10171773 3300025933 Bacteria 1905
405 Ga0207706_10260161 3300025933 Bacteria 1515
406 Ga0207706_10535629 3300025933 Bacteria 1009
407 Ga0207686_10013980 3300025934 Bacteria 4456
408 Ga0207686_10018772 3300025934 Bacteria 3920
409 Ga0207686_10033652 3300025934 Bacteria 3061
410 Ga0207686_10042725 3300025934 Bacteria 2773
411 Ga0207686_10199078 3300025934 Bacteria 1433
412 Ga0207709_10339593 3300025935 Bacteria 1130
413 Ga0207709_10870528 3300025935 Bacteria 731
414 Ga0207709_11033770 3300025935 Bacteria 672
415 Ga0207709_11655716 3300025935 Unclassified 532
416 Ga0207670_10037614 3300025936 Bacteria 3155
417 Ga0207670_10062951 3300025936 Bacteria 2537
418 Ga0207670_10071557 3300025936 Bacteria 2398
419 Ga0207670_11814587 3300025936 Bacteria 519
420 Ga0207704_10013635 3300025938 Bacteria 4076
421 Ga0207704_10033489 3300025938 Bacteria 2922
422 Ga0207704_10078829 3300025938 Bacteria 2120
423 Ga0207704_10403454 3300025938 Bacteria 1079
424 Ga0207704_11828054 3300025938 Bacteria 522
425 Ga0207665_10175473 3300025939 Bacteria 1550
426 Ga0207691_10021481 3300025940 Bacteria 6094
427 Ga0207691_10049414 3300025940 Bacteria 3854
428 Ga0207691_10074756 3300025940 Bacteria 3056
429 Ga0207691_10847781 3300025940 Bacteria 766
430 Ga0207711_10044091 3300025941 Bacteria 3806
431 Ga0207711_10069450 3300025941 Bacteria 3054
432 Ga0207711_10104327 3300025941 Bacteria 2512
433 Ga0207711_10106213 3300025941 Bacteria 2491
434 Ga0207711_10133512 3300025941 Bacteria 2227
435 Ga0207711_10141532 3300025941 Bacteria 2165
436 Ga0207711_10158805 3300025941 Bacteria 2045
437 Ga0207711_10203406 3300025941 Bacteria 1808
438 Ga0207711_10225424 3300025941 Bacteria 1715
439 Ga0207711_10345435 3300025941 Bacteria 1377
440 Ga0207711_10993095 3300025941 Bacteria 779
441 Ga0207689_10191240 3300025942 Bacteria 1688
442 Ga0207689_10670966 3300025942 Unclassified 874
443 Ga0207689_10682343 3300025942 Unclassified 866
444 Ga0207689_10915406 3300025942 Bacteria 740
445 Ga0207661_10152280 3300025944 Bacteria 2000
446 Ga0207679_10075907 3300025945 Unclassified 2552
447 Ga0207679_10213481 3300025945 Bacteria 1620
448 Ga0207679_10449637 3300025945 Bacteria 1142
449 Ga0207679_10455941 3300025945 Bacteria 1135
450 Ga0207667_11184481 3300025949 Unclassified 744
451 Ga0207651_10352849 3300025960 Bacteria 1239
452 Ga0207651_10353895 3300025960 Bacteria 1237
453 Ga0207651_10909399 3300025960 Unclassified 784
454 Ga0207651_11025184 3300025960 Bacteria 738
455 Ga0207712_10495774 3300025961 Bacteria 1043
456 Ga0207712_11491620 3300025961 Unclassified 606
457 Ga0207668_10249272 3300025972 Unclassified 1441
458 Ga0207668_10653852 3300025972 Bacteria 920
459 Ga0207668_10723589 3300025972 Bacteria 876
460 Ga0207668_11588264 3300025972 Bacteria 590
461 Ga0207640_10100765 3300025981 Bacteria 2025
462 Ga0207640_10202083 3300025981 Unclassified 1507
463 Ga0207640_10429693 3300025981 Bacteria 1083
464 Ga0207640_10515502 3300025981 Unclassified 998
465 Ga0207640_10687654 3300025981 Bacteria 876
466 Ga0207640_10827475 3300025981 Bacteria 804
467 Ga0207658_10165321 3300025986 Bacteria 1817
468 Ga0207658_10296623 3300025986 Unclassified 1391
469 Ga0207658_10463174 3300025986 Bacteria 1124
470 Ga0207658_10528741 3300025986 Bacteria 1053
471 Ga0207677_10020134 3300026023 Bacteria 4046
472 Ga0207677_10034480 3300026023 Bacteria 3278
473 Ga0207677_10052180 3300026023 Unclassified 2777
474 Ga0207677_10195141 3300026023 Bacteria 1605
475 Ga0207677_10372469 3300026023 Bacteria 1203
476 Ga0207677_10421680 3300026023 Bacteria 1137
477 Ga0207677_10472520 3300026023 Bacteria 1079
478 Ga0207677_10733830 3300026023 Bacteria 879
479 Ga0207677_11180377 3300026023 Bacteria 700
480 Ga0207677_11721034 3300026023 Bacteria 581
481 Ga0207703_10006659 3300026035 Bacteria 9216
482 Ga0207703_10046873 3300026035 Bacteria 3483
483 Ga0207703_10046887 3300026035 Unclassified 3483
484 Ga0207703_10097914 3300026035 Bacteria 2479
485 Ga0207703_10100512 3300026035 Bacteria 2451
486 Ga0207703_10107382 3300026035 Bacteria 2376
487 Ga0207703_10411699 3300026035 Unclassified 1256
488 Ga0207703_10551574 3300026035 Bacteria 1087
489 Ga0207703_10865717 3300026035 Unclassified 864
490 Ga0207703_11191500 3300026035 Bacteria 732
491 Ga0207703_11223149 3300026035 Unclassified 722
492 Ga0207639_10448129 3300026041 Bacteria 1171
493 Ga0207639_10884040 3300026041 Bacteria 835
494 Ga0207639_11559461 3300026041 Unclassified 620
495 Ga0207678_10263104 3300026067 Bacteria 1478
496 Ga0207678_10302559 3300026067 Bacteria 1374
497 Ga0207708_10003563 3300026075 Bacteria 11478
498 Ga0207708_11034913 3300026075 Bacteria 714
499 Ga0207641_10102298 3300026088 Bacteria 2526
500 Ga0207641_10186329 3300026088 Unclassified 1904
501 Ga0207641_10314032 3300026088 Bacteria 1484
502 Ga0207641_10722087 3300026088 Bacteria 982
503 Ga0207641_10912265 3300026088 Unclassified 873
504 Ga0207641_11834628 3300026088 Bacteria 608
505 Ga0207648_10026508 3300026089 Bacteria 5149
506 Ga0207648_10070025 3300026089 Bacteria 3057
507 Ga0207648_10136709 3300026089 Bacteria 2159
508 Ga0207648_10142188 3300026089 Bacteria 2115
509 Ga0207648_10181067 3300026089 Bacteria 1865
510 Ga0207648_10423484 3300026089 Unclassified 1209
511 Ga0207648_11223250 3300026089 Bacteria 706
512 Ga0207676_10164539 3300026095 Bacteria 1926
513 Ga0207676_10871500 3300026095 Unclassified 882
514 Ga0207676_11150725 3300026095 Bacteria 768
515 Ga0207676_11412783 3300026095 Unclassified 692
516 Ga0207675_100039571 3300026118 Bacteria 4400
517 Ga0207675_100125756 3300026118 Bacteria 2428
518 Ga0207675_100267880 3300026118 Bacteria 1657
519 Ga0207675_100963219 3300026118 Bacteria 871
520 Ga0207675_102109891 3300026118 Unclassified 580
521 Ga0207683_10042889 3300026121 Bacteria 3951
522 Ga0207683_10331842 3300026121 Bacteria 1394
523 Ga0207698_12110332 3300026142 Unclassified 577
524 Ga0209974_10140407 3300027876 Bacteria 866
525 Ga0207428_10000151 3300027907 Bacteria 94421
526 Ga0207428_10049146 3300027907 Bacteria 3381
527 Ga0268266_10011623 3300028379 Bacteria 7643
528 Ga0268266_10017882 3300028379 Bacteria 6041
529 Ga0268266_10026737 3300028379 Bacteria 4910
530 Ga0268266_10227439 3300028379 Bacteria 1717
531 Ga0268266_10473085 3300028379 Bacteria 1194
532 Ga0268266_10493256 3300028379 Bacteria 1169
533 Ga0268266_10669597 3300028379 Unclassified 999
534 Ga0268265_10065776 3300028380 Bacteria 2800
535 Ga0268265_10067150 3300028380 Bacteria 2775
536 Ga0268265_10128784 3300028380 Bacteria 2099
537 Ga0268265_11094799 3300028380 Bacteria 791
538 Ga0268265_11132348 3300028380 Bacteria 778
539 Ga0268265_11734721 3300028380 Bacteria 630
540 Ga0268264_10082139 3300028381 Bacteria 2757
541 Ga0268264_10158070 3300028381 Bacteria 2039
542 Ga0268264_10163287 3300028381 Unclassified 2009
543 Ga0268264_10319410 3300028381 Bacteria 1468
544 Ga0268264_10480112 3300028381 Bacteria 1209
545 Ga0268264_10502829 3300028381 Unclassified 1182
546 Ga0268264_10901385 3300028381 Bacteria 887
547 Ga0268264_11089811 3300028381 Bacteria 807
548 Ga0268264_11187913 3300028381 Bacteria 772
549 Ga0307415_100532431 3300032126 Bacteria 1033
550 Ga0373930_0000174 3300034816 Bacteria 7558
551 Ga0373948_0030475 3300034817 Bacteria 1084
552 Ga0373950_0012498 3300034818 Bacteria 1402
553 Ga0373958_0000577 3300034819 Bacteria 4545
554 Ga0373958_0016895 3300034819 Bacteria 1305
555 Ga0373959_0053931 3300034820 Bacteria 874
556 Ga0373938_0004965 3300034957 Bacteria 2243
557 Ga0373929_0000226 3300035085 Bacteria 10233
558 Ga0373934_0254474 3300035086 Bacteria 726
559 Ga0373940_0002431 3300035088 Bacteria 3619
560 Ga0373944_0383663 3300035089 Bacteria 539
561 Ga0373949_0000501 3300035090 Bacteria 13086
562 Ga0373949_0056728 3300035090 Bacteria 999
563 Ga0373951_0001704 3300035091 Bacteria 5742
564 Ga0373952_0007177 3300035092 Bacteria 2081
565 Ga0373923_0033312 3300035111 Bacteria 2086
566 Ga0373932_0000500 3300035112 Bacteria 12060
567 Ga0373932_0425685 3300035112 Archaea 517
568 Ga0373936_0126121 3300035113 Bacteria 1097
569 Ga0373939_0001005 3300035114 Bacteria 6975
570 Ga0373941_0126091 3300035115 Bacteria 917
571 Ga0373945_0129011 3300035116 Bacteria 1012
572 Ga0373945_0174683 3300035116 Bacteria 882
573 Ga0373953_0099862 3300035117 Bacteria 1221
574 Ga0373960_0023399 3300035121 Bacteria 1663
575 Ga0373943_0328890 3300035170 Bacteria 872
576 Ga0373943_0343822 3300035170 Bacteria 854
577 Ga0373946_0030670 3300035171 Unclassified 2148
578 Ga0373955_0051078 3300035172 Bacteria 2251
579 Ga0373955_0095704 3300035172 Unclassified 1699
580 Ga0373955_0135755 3300035172 Bacteria 1439
581 Ga0373942_0000157 3300035207 Bacteria 16407
582 Ga0373942_0334166 3300035207 Unclassified 532
583 Ga0373961_0002280 3300035241 Bacteria 5021
584 Ga0373962_0009901 3300035242 Bacteria 2368
585 Ga0373931_0024828 3300035691 Bacteria 3040
586 Ga0373931_0121420 3300035691 Bacteria 1494
587 Ga0373935_0047452 3300035692 Bacteria 2716
588 Ga0373935_0757612 3300035692 Unclassified 716
589 Ga0373935_1114204 3300035692 Bacteria 588
590 Ga0373927_0315827 3300035695 Bacteria 1029
591 Ga0373933_0327890 3300035724 Bacteria 993
592 Ga0373947_0213870 3300035725 Bacteria 1265
593 Ga0373937_0160453 3300036401 Bacteria 2108
594 Ga0373937_0325750 3300036401 Bacteria 1454
595 Ga0373937_0356359 3300036401 Bacteria 1386
596 Ga0373937_0499315 3300036401 Unclassified 1156
597 Ga0373937_0853944 3300036401 Bacteria 859
598 Ga0373937_0952252 3300036401 Unclassified 807
599 Ga0373937_1449310 3300036401 Bacteria 634
600 Ga0373925_0020135 3300037068 Bacteria 4855
601 Ga0373925_0738793 3300037068 Bacteria 811
602 Ga0373925_0746159 3300037068 Unclassified 807
603 Ga0373925_0845980 3300037068 Bacteria 754
604 Ga0451855_1884471 3300041511 Unclassified 552
605 Ga0451853_2826286 3300041512 Unclassified 876
606 Ga0451576_0003205 3300045051 Bacteria 22820
607 Ga0451576_0127243 3300045051 Bacteria 2654
608 Ga0451576_0179789 3300045051 Bacteria 2209
609 Ga0451576_0742229 3300045051 Bacteria 1031
610 Ga0495592_0558408 3300046454 Bacteria 703
611 Ga0495629_0380920 3300046459 Bacteria 960
612 Ga0495629_0654587 3300046459 Unclassified 700
613 Ga0495641_0243117 3300046461 Bacteria 809
614 Ga0495651_0458339 3300046462 Unclassified 823
615 Ga0495580_0625294 3300046472 Bacteria 710
616 Ga0495582_0354247 3300046473 Bacteria 845
617 Ga0495639_0371339 3300046475 Bacteria 720
618 Ga0495639_0751287 3300046475 Bacteria 505
619 Ga0495662_0396367 3300046476 Bacteria 678
620 Ga0495608_0041443 3300046511 Bacteria 3081
621 Ga0495608_0345949 3300046511 Unclassified 916
622 Ga0495628_0075165 3300046516 Bacteria 2631
623 Ga0495630_0106910 3300046517 Bacteria 2119
624 Ga0495665_0093838 3300046531 Bacteria 1577
625 Ga0495640_0119971 3300046533 Bacteria 1711
626 Ga0495598_0100663 3300046537 Unclassified 956
627 Ga0495598_0204372 3300046537 Bacteria 715
628 Ga0495645_0216760 3300046543 Bacteria 1289
629 Ga0495656_0414819 3300046615 Unclassified 706
630 Ga0495634_0035939 3300046642 Bacteria 3390
631 Ga0495635_0613511 3300046663 Bacteria 710
632 Ga0495659_0348397 3300046664 Unclassified 633
633 Ga0495623_0090810 3300046679 Bacteria 1875
634 Ga0495647_0420031 3300046681 Bacteria 616
635 Ga0495647_0487341 3300046681 Unclassified 573
636 Ga0495658_0021544 3300046683 Bacteria 3398
637 Ga0495658_0299333 3300046683 Bacteria 1017
638 Ga0495658_0434547 3300046683 Unclassified 838
639 Ga0495669_0134641 3300046684 Bacteria 1164
640 Ga0495669_0338703 3300046684 Unclassified 727
641 Ga0495613_0006594 3300046689 Bacteria 8676
642 Ga0495613_0467658 3300046689 Unclassified 853
643 Ga0495600_0202817 3300046809 Bacteria 1273
644 Ga0495600_0342214 3300046809 Unclassified 938
645 Ga0495604_0310885 3300047317 Bacteria 1056
646 Ga0495604_0323347 3300047317 Bacteria 1030
647 Ga0495675_0201616 3300047444 Unclassified 1211
648 Ga0495684_0003091 3300047471 Bacteria 13079
649 Ga0496100_0008205 3300048903 Bacteria 5816
650 Ga0496100_1470412 3300048903 Bacteria 538
651 Ga0496101_0000588 3300048904 Bacteria 22146
652 Ga0496103_0459843 3300048906 Bacteria 816
653 Ga0496104_0062587 3300048907 Bacteria 3528
654 Ga0496104_0203278 3300048907 Bacteria 1893
655 Ga0496104_0414524 3300048907 Bacteria 1259
656 Ga0496104_0752549 3300048907 Unclassified 881
657 Ga0496104_1463820 3300048907 Bacteria 586
658 Ga0496104_1685564 3300048907 Archaea 536
659 Ga0496105_0039898 3300048908 Bacteria 3871
660 Ga0496105_0069519 3300048908 Bacteria 2910
661 Ga0496105_0162795 3300048908 Bacteria 1831
662 Ga0496105_0290375 3300048908 Bacteria 1317
663 Ga0496106_0093777 3300048909 Bacteria 2320
664 Ga0496106_0330758 3300048909 Bacteria 1223
665 Ga0496107_0201381 3300048910 Bacteria 1480
666 Ga0496108_0241642 3300048911 Bacteria 1571
667 Ga0496109_0194476 3300048912 Bacteria 1906
668 Ga0496109_1958526 3300048912 Unclassified 518
669 Ga0496111_0434577 3300048914 Bacteria 969
670 Ga0496112_0121607 3300048915 Bacteria 2581
671 Ga0496112_0442844 3300048915 Bacteria 1237
672 Ga0496114_0014814 3300048917 Bacteria 6266
673 Ga0496114_0343516 3300048917 Bacteria 1320
674 Ga0496115_0081719 3300048918 Bacteria 2632
675 Ga0501072_1021239 3300049588 Bacteria 644
676 nmdc:mga03683_15077_c1 3300050489 Unclassified 2876
677 nmdc:mga03683_59180_c1 3300050489 Bacteria 1616
678 nmdc:mga00v17_39762_c1 3300050491 Bacteria 2818
679 nmdc:mga0yw44_115661_c1 3300050492 Unclassified 1723
680 nmdc:mga0yw44_45928_c1 3300050492 Bacteria 2621
681 nmdc:mga0k408_223712_c1 3300050493 Bacteria 1123
682 nmdc:mga06z11_177480_c1 3300050494 Bacteria 1226
683 nmdc:mga06z11_5126_c1 3300050494 Bacteria 5224
684 nmdc:mga07m45_59326_c1 3300050496 Bacteria 2165
685 nmdc:mga05p37_450588_c1 3300050507 Bacteria 1490
686 nmdc:mga05p37_944473_c1 3300050507 Bacteria 924
687 nmdc:mga09592_158571_c1 3300050508 Bacteria 1954
688 nmdc:mga09592_570542_c1 3300050508 Bacteria 971
689 nmdc:mga0qj67_173794_c1 3300050509 Bacteria 1749
690 nmdc:mga0qj67_407262_c1 3300050509 Unclassified 1097
691 nmdc:mga06r32_5144_c1 3300050510 Bacteria 11767
692 nmdc:mga06r32_587104_c1 3300050510 Bacteria 1086
693 nmdc:mga08y16_1135352_c1 3300050511 Bacteria 755
694 nmdc:mga08y16_227561_c1 3300050511 Bacteria 1929
695 nmdc:mga08y16_526083_c1 3300050511 Bacteria 1199
696 nmdc:mga08y16_8546_c1 3300050511 Bacteria 10727
697 nmdc:mga08y16_967_c1 3300050511 Bacteria 27943
698 nmdc:mga0n895_240217_c1 3300050512 Bacteria 1838
699 nmdc:mga0n895_86676_c1 3300050512 Bacteria 3128
700 nmdc:mga0rr50_12645_c1 3300050513 Bacteria 5464
701 nmdc:mga0rr50_198023_c1 3300050513 Unclassified 1650
702 nmdc:mga0rr50_2720_c1 3300050513 Bacteria 10028
703 nmdc:mga0rr50_333396_c1 3300050513 Bacteria 1274
704 nmdc:mga0rr50_541944_c1 3300050513 Bacteria 991
705 nmdc:mga08x19_105406_c1 3300050514 Bacteria 1875
706 nmdc:mga08x19_85026_c1 3300050514 Bacteria 2082
707 nmdc:mga0a205_102602_c1 3300050515 Bacteria 2759
708 nmdc:mga0a205_1314063_c1 3300050515 Bacteria 571
709 nmdc:mga0a205_1426012_c1 3300050515 Unclassified 540
710 nmdc:mga0a205_693669_c1 3300050515 Bacteria 868
711 nmdc:mga0a205_96426_c1 3300050515 Bacteria 2856
712 Ga0495601_0027835 3300053077 Bacteria 3497
713 Ga0495601_0051459 3300053077 Bacteria 2599
714 Ga0495601_0193924 3300053077 Bacteria 1328
715 Ga0495619_0000702 3300053085 Bacteria 21903
716 Ga0495619_0131527 3300053085 Bacteria 1720
717 Ga0495619_0268064 3300053085 Unclassified 1183
718 Ga0495619_0309494 3300053085 Bacteria 1094
719 Ga0500556_0041888 3300053104 Bacteria 1617
720 Ga0070708_100803938
721 JGI24034J26672_10122898
722 Ga0058862_12063970
723 Ga0065712_10400689
724 Ga0065715_10151115
725 Ga0065707_10447865
726 Ga0070676_10468652
727 Ga0070683_100024471
728 Ga0070683_100188733
729 Ga0070690_100222246
730 Ga0070690_100256176
731 Ga0070670_100169090
732 Ga0068869_100476979
733 Ga0068869_101826513
734 Ga0070666_10009138
735 Ga0070666_10085454
736 Ga0070666_10096794
737 Ga0070666_10251937
738 Ga0070666_10270896
739 Ga0070680_100034696
740 Ga0070682_101446242
741 Ga0068868_100008309
742 Ga0068868_100032608
743 Ga0068868_100074233
744 Ga0068868_100157475
745 Ga0068868_100218673
746 Ga0068868_101526477
747 Ga0070660_100360577
748 Ga0070689_100091180
749 Ga0070689_100678783
750 Ga0070691_10317717
751 Ga0070687_100017247
752 Ga0070687_100148139
753 Ga0070661_100324340
754 Ga0070692_10219573
755 Ga0070668_100267918
756 Ga0070668_100347650
757 Ga0070668_100971459
758 Ga0070668_101779398
759 Ga0070669_100123212
760 Ga0070669_100238790
761 Ga0070669_100417939
762 Ga0070669_100685935
763 Ga0070675_100000592
764 Ga0070675_100004841
765 Ga0070675_100163824
766 Ga0070675_100407046
767 Ga0070675_101201258
768 Ga0070675_101709316
769 Ga0070671_100174385
770 Ga0070671_100327259
771 Ga0070674_100068289
772 Ga0070673_100101444
773 Ga0070673_100113229
774 Ga0070673_100362943
775 Ga0070673_100715686
776 Ga0070688_100076196
777 Ga0070688_100174366
778 Ga0070667_100068847
779 Ga0070667_100397401
780 Ga0070667_100557869
781 Ga0070713_100011637
782 Ga0070710_10767186
783 Ga0070701_10031641
784 Ga0070701_10133241
785 Ga0070701_10234324
786 Ga0070711_100329464
787 Ga0070705_100057384
788 Ga0070705_101569253
789 Ga0070700_100040069
790 Ga0070700_100641300
791 Ga0070694_100190396
792 Ga0070694_100278239
793 Ga0070708_100072612
794 Ga0070708_100187730
795 Ga0070663_100158504
796 Ga0070678_100006462
797 Ga0070678_100215649
798 Ga0070678_100270764
799 Ga0070678_100390556
800 Ga0070662_100250069
801 Ga0070662_100449802
802 Ga0070662_100562853
803 Ga0070681_10008390
804 Ga0070681_11223767
805 Ga0068867_100012670
806 Ga0068867_100020140
807 Ga0068867_100189899
808 Ga0068867_100250206
809 Ga0068867_100691921
810 Ga0070685_10077977
811 Ga0070685_10328389
812 Ga0070685_10378107
813 Ga0070706_100022939
814 Ga0070706_100088894
815 Ga0070706_100580443
816 Ga0070706_100583664
817 Ga0070706_100684788
818 Ga0070707_100002713
819 Ga0070707_100032924
820 Ga0070707_100042822
821 Ga0070707_100132329
822 Ga0070707_100672623
823 Ga0070707_101631153
824 Ga0070707_102001132
825 Ga0070698_100023398
826 Ga0070698_100457186
827 Ga0070698_100845554
828 Ga0070698_100880232
829 Ga0070698_101153921
830 Ga0070699_100767467
831 Ga0070684_100319075
832 Ga0070697_100051099
833 Ga0070697_100107204
834 Ga0070697_100323116
835 Ga0070697_100394254
836 Ga0068853_100125987
837 Ga0068853_101023712
838 Ga0070672_100227454
839 Ga0070672_101014579
840 Ga0070686_100001743
841 Ga0070686_100127344
842 Ga0070686_100127628
843 Ga0070686_100891314
844 Ga0070695_100174750
845 Ga0070695_100528934
846 Ga0070696_100032653
847 Ga0070696_100475501
848 Ga0070665_100000621
849 Ga0070665_100004858
850 Ga0070665_100018748
851 Ga0070665_100139947
852 Ga0070665_100142964
853 Ga0070665_100205151
854 Ga0070665_100557518
855 Ga0070665_101589106
856 Ga0070704_100247604
857 Ga0070704_100312690
858 Ga0070704_100376307
859 Ga0068855_101213597
860 Ga0070664_100392113
861 Ga0070664_100668436
862 Ga0070664_101229528
863 Ga0068854_100108639
864 Ga0068854_100641530
865 Ga0068854_100656494
866 Ga0068854_100816146
867 Ga0068852_102170829
868 Ga0068859_100141533
869 Ga0068859_100206839
870 Ga0068859_100228473
871 Ga0068859_100581868
872 Ga0068859_100662786
873 Ga0068859_100753156
874 Ga0068859_100918140
875 Ga0068864_100380764
876 Ga0068864_100435878
877 Ga0068864_100558513
878 Ga0068864_100856411
879 Ga0068866_10017925
880 Ga0068866_10046188
881 Ga0068866_10948235
882 Ga0068866_11350450
883 Ga0068866_11463543
884 Ga0068861_100025520
885 Ga0068861_100465426
886 Ga0068861_100765083
887 Ga0068861_102116092
888 Ga0068870_10335098
889 Ga0068870_10489631
890 Ga0068863_100061314
891 Ga0068863_100071951
892 Ga0068863_100293587
893 Ga0068863_100651888
894 Ga0068863_102176032
895 Ga0068858_100006135
896 Ga0068858_100041962
897 Ga0068858_100091993
898 Ga0068858_100145708
899 Ga0068858_100242174
900 Ga0068858_100267748
901 Ga0068858_100339433
902 Ga0068858_100503736
903 Ga0068858_100873248
904 Ga0068858_101013887
905 Ga0068860_100091913
906 Ga0068860_100102653
907 Ga0068860_100192653
908 Ga0068860_100209371
909 Ga0068860_100432814
910 Ga0068860_100512171
911 Ga0068860_100529427
912 Ga0068860_100757240
913 Ga0068860_100808143
914 Ga0068860_100928752
915 Ga0068860_101304806
916 Ga0068860_101357061
917 Ga0068862_100059338
918 Ga0068862_100066577
919 Ga0068862_101221305
920 Ga0075365_10016108
921 Ga0075364_10234841
922 Ga0075364_11047585
923 Ga0070715_10071264
924 Ga0075362_10152496
925 Ga0075367_10088162
926 Ga0075367_10150143
927 Ga0075366_10000097
928 Ga0075366_10055850
929 Ga0097621_100002929
930 Ga0097621_100012191
931 Ga0097621_100064190
932 Ga0097621_100634858
933 Ga0097621_101244652
934 Ga0075370_10226336
935 Ga0068871_100002896
936 Ga0068871_100108781
937 Ga0068871_100168511
938 Ga0068871_100172004
939 Ga0068871_100180881
940 Ga0068871_100536984
941 Ga0068871_100561782
942 Ga0068871_101207460
943 Ga0075428_100224043
944 Ga0075428_100656471
945 Ga0075430_100297974
946 Ga0075431_100001434
947 Ga0075431_100014423
948 Ga0075431_100120608
949 Ga0075433_10044120
950 Ga0075433_10170968
951 Ga0075433_10767203
952 Ga0075434_100063199
953 Ga0075434_100213491
954 Ga0075434_100223408
955 Ga0075434_101114622
956 Ga0075429_100010279
957 Ga0075429_100103151
958 Ga0075429_100606331
959 Ga0068865_100003401
960 Ga0068865_100009239
961 Ga0068865_100011343
962 Ga0068865_100013766
963 Ga0068865_101316434
964 Ga0075436_100090730
965 Ga0097620_100141539
966 Ga0097620_100206849
967 Ga0097620_100228482
968 Ga0097620_100581973
969 Ga0097620_100662772
970 Ga0097620_100753094
971 Ga0097620_100918256
972 Ga0075435_100000288
973 Ga0075435_100076322
974 Ga0075435_100222942
975 Ga0075435_100364302
976 Ga0075435_101057469
977 Ga0105250_10180555
978 Ga0105240_10006633
979 Ga0105240_11531881
980 Ga0111539_10000298
981 Ga0111539_10064452
982 Ga0111539_10118705
983 Ga0111539_10170432
984 Ga0111539_10312103
985 Ga0111539_10678765
986 Ga0111539_11237155
987 Ga0105245_10091033
988 Ga0105245_10119692
989 Ga0105245_10198324
990 Ga0105245_11409126
991 Ga0105245_11484527
992 Ga0105247_10381352
993 Ga0105247_10453881
994 Ga0114129_10094037
995 Ga0114129_10099636
996 Ga0114129_10622934
997 Ga0114129_10779851
998 Ga0105243_10050204
999 Ga0105243_10549985
1000 Ga0105243_11706919
1001 Ga0105241_10074342
1002 Ga0105241_10173040
1003 Ga0105241_11323032
1004 Ga0105242_10001789
1005 Ga0105242_10005888
1006 Ga0105242_10032681
1007 Ga0105242_10035071
1008 Ga0105242_10351289
1009 Ga0105242_10598718
1010 Ga0105242_12119324
1011 Ga0105248_10053464
1012 Ga0105248_10061790
1013 Ga0105248_10065128
1014 Ga0105248_10076962
1015 Ga0105248_10099847
1016 Ga0105248_10113604
1017 Ga0105248_10134703
1018 Ga0105248_10156213
1019 Ga0105248_10202915
1020 Ga0105248_10345577
1021 Ga0105248_10449052
1022 Ga0105248_10513002
1023 Ga0105248_10623423
1024 Ga0105248_10792503
1025 Ga0105248_12525203
1026 Ga0105238_10366391
1027 Ga0105249_10104836
1028 Ga0105249_10141670
1029 Ga0105249_10230445
1030 Ga0105249_12182516
1031 Ga0105239_10473441
1032 Ga0105239_11720125
1033 Ga0105239_13328485
1034 Ga0157374_10131827
1035 Ga0157374_10144144
1036 Ga0157374_10425375
1037 Ga0157374_10808444
1038 Ga0157378_10325130
1039 Ga0157378_10649600
1040 Ga0163162_10010669
1041 Ga0163162_10118177
1042 Ga0163162_10827394
1043 Ga0163162_11173171
1044 Ga0163162_11794527
1045 Ga0157375_10096114
1046 Ga0157375_10117580
1047 Ga0157375_10273078
1048 Ga0157375_10835987
1049 Ga0157375_11340069
1050 Ga0157375_11450574
1051 Ga0163163_10370583
1052 Ga0163163_10469853
1053 Ga0163163_10551145
1054 Ga0163163_11634890
1055 Ga0157380_10006238
1056 Ga0157380_10014213
1057 Ga0157380_10101294
1058 Ga0157380_10115100
1059 Ga0157380_10160833
1060 Ga0157380_10184908
1061 Ga0157380_11017724
1062 Ga0157380_12338775
1063 Ga0157380_12374419
1064 Ga0157380_12490602
1065 Ga0157377_10298317
1066 Ga0157379_10023333
1067 Ga0157379_10150917
1068 Ga0157379_10207788
1069 Ga0157379_10504421
1070 Ga0157379_10522386
1071 Ga0157379_10867328
1072 Ga0157379_11009288
1073 Ga0157379_11348828
1074 Ga0157376_10004354
1075 Ga0157376_10012057
1076 Ga0157376_10149657
1077 Ga0157376_10593540
1078 Ga0182007_10186867
1079 Ga0163161_10439319
1080 Ga0163161_11082893
1081 Ga0207692_10305146
1082 Ga0207680_10041338
1083 Ga0207680_10077187
1084 Ga0207680_10178261
1085 Ga0207680_10276611
1086 Ga0207680_10309232
1087 Ga0207685_10152983
1088 Ga0207685_10403377
1089 Ga0207645_10321985
1090 Ga0207643_10300212
1091 Ga0207684_10341074
1092 Ga0207654_10058632
1093 Ga0207707_10299685
1094 Ga0207695_10169455
1095 Ga0207693_10574773
1096 Ga0207660_10059473
1097 Ga0207657_10190902
1098 Ga0207646_10003369
1099 Ga0207646_10053316
1100 Ga0207681_10005701
1101 Ga0207681_10008528
1102 Ga0207681_10598865
1103 Ga0207681_11117141
1104 Ga0207681_11471445
1105 Ga0207650_10091815
1106 Ga0207650_10112124
1107 Ga0207650_10673300
1108 Ga0207659_10002837
1109 Ga0207659_10005128
1110 Ga0207659_10061067
1111 Ga0207659_10083794
1112 Ga0207659_10150778
1113 Ga0207659_10204730
1114 Ga0207687_10012986
1115 Ga0207687_10023051
1116 Ga0207687_10163592
1117 Ga0207687_10290671
1118 Ga0207687_10512652
1119 Ga0207700_10004573
1120 Ga0207644_10116192
1121 Ga0207644_10314597
1122 Ga0207690_10103376
1123 Ga0207706_10171773
1124 Ga0207706_10260161
1125 Ga0207706_10535629
1126 Ga0207686_10013980
1127 Ga0207686_10018772
1128 Ga0207686_10033652
1129 Ga0207686_10042725
1130 Ga0207686_10199078
1131 Ga0207709_10339593
1132 Ga0207709_10870528
1133 Ga0207709_11033770
1134 Ga0207709_11655716
1135 Ga0207670_10037614
1136 Ga0207670_10062951
1137 Ga0207670_10071557
1138 Ga0207670_11814587
1139 Ga0207704_10013635
1140 Ga0207704_10033489
1141 Ga0207704_10078829
1142 Ga0207704_10403454
1143 Ga0207704_11828054
1144 Ga0207665_10175473
1145 Ga0207691_10021481
1146 Ga0207691_10049414
1147 Ga0207691_10074756
1148 Ga0207691_10847781
1149 Ga0207711_10044091
1150 Ga0207711_10069450
1151 Ga0207711_10104327
1152 Ga0207711_10106213
1153 Ga0207711_10133512
1154 Ga0207711_10141532
1155 Ga0207711_10158805
1156 Ga0207711_10203406
1157 Ga0207711_10225424
1158 Ga0207711_10345435
1159 Ga0207711_10993095
1160 Ga0207689_10191240
1161 Ga0207689_10670966
1162 Ga0207689_10682343
1163 Ga0207689_10915406
1164 Ga0207661_10152280
1165 Ga0207679_10075907
1166 Ga0207679_10213481
1167 Ga0207679_10449637
1168 Ga0207679_10455941
1169 Ga0207667_11184481
1170 Ga0207651_10352849
1171 Ga0207651_10353895
1172 Ga0207651_10909399
1173 Ga0207651_11025184
1174 Ga0207712_10495774
1175 Ga0207712_11491620
1176 Ga0207668_10249272
1177 Ga0207668_10653852
1178 Ga0207668_10723589
1179 Ga0207668_11588264
1180 Ga0207640_10100765
1181 Ga0207640_10202083
1182 Ga0207640_10429693
1183 Ga0207640_10515502
1184 Ga0207640_10687654
1185 Ga0207640_10827475
1186 Ga0207658_10165321
1187 Ga0207658_10296623
1188 Ga0207658_10463174
1189 Ga0207658_10528741
1190 Ga0207677_10020134
1191 Ga0207677_10034480
1192 Ga0207677_10052180
1193 Ga0207677_10195141
1194 Ga0207677_10372469
1195 Ga0207677_10421680
1196 Ga0207677_10472520
1197 Ga0207677_10733830
1198 Ga0207677_11180377
1199 Ga0207677_11721034
1200 Ga0207703_10006659
1201 Ga0207703_10046873
1202 Ga0207703_10046887
1203 Ga0207703_10097914
1204 Ga0207703_10100512
1205 Ga0207703_10107382
1206 Ga0207703_10411699
1207 Ga0207703_10551574
1208 Ga0207703_10865717
1209 Ga0207703_11191500
1210 Ga0207703_11223149
1211 Ga0207639_10448129
1212 Ga0207639_10884040
1213 Ga0207639_11559461
1214 Ga0207678_10263104
1215 Ga0207678_10302559
1216 Ga0207708_10003563
1217 Ga0207708_11034913
1218 Ga0207641_10102298
1219 Ga0207641_10186329
1220 Ga0207641_10314032
1221 Ga0207641_10722087
1222 Ga0207641_10912265
1223 Ga0207641_11834628
1224 Ga0207648_10026508
1225 Ga0207648_10070025
1226 Ga0207648_10136709
1227 Ga0207648_10142188
1228 Ga0207648_10181067
1229 Ga0207648_10423484
1230 Ga0207648_11223250
1231 Ga0207676_10164539
1232 Ga0207676_10871500
1233 Ga0207676_11150725
1234 Ga0207676_11412783
1235 Ga0207675_100039571
1236 Ga0207675_100125756
1237 Ga0207675_100267880
1238 Ga0207675_100963219
1239 Ga0207675_102109891
1240 Ga0207683_10042889
1241 Ga0207683_10331842
1242 Ga0207698_12110332
1243 Ga0209974_10140407
1244 Ga0207428_10000151
1245 Ga0207428_10049146
1246 Ga0268266_10011623
1247 Ga0268266_10017882
1248 Ga0268266_10026737
1249 Ga0268266_10227439
1250 Ga0268266_10473085
1251 Ga0268266_10493256
1252 Ga0268266_10669597
1253 Ga0268265_10065776
1254 Ga0268265_10067150
1255 Ga0268265_10128784
1256 Ga0268265_11094799
1257 Ga0268265_11132348
1258 Ga0268265_11734721
1259 Ga0268264_10082139
1260 Ga0268264_10158070
1261 Ga0268264_10163287
1262 Ga0268264_10319410
1263 Ga0268264_10480112
1264 Ga0268264_10502829
1265 Ga0268264_10901385
1266 Ga0268264_11089811
1267 Ga0268264_11187913
1268 Ga0307415_100532431
1269 Ga0373930_0000174
1270 Ga0373948_0030475
1271 Ga0373950_0012498
1272 Ga0373958_0000577
1273 Ga0373958_0016895
1274 Ga0373959_0053931
1275 Ga0373938_0004965
1276 Ga0373929_0000226
1277 Ga0373934_0254474
1278 Ga0373940_0002431
1279 Ga0373944_0383663
1280 Ga0373949_0000501
1281 Ga0373949_0056728
1282 Ga0373951_0001704
1283 Ga0373952_0007177
1284 Ga0373923_0033312
1285 Ga0373932_0000500
1286 Ga0373932_0425685
1287 Ga0373936_0126121
1288 Ga0373939_0001005
1289 Ga0373941_0126091
1290 Ga0373945_0129011
1291 Ga0373945_0174683
1292 Ga0373953_0099862
1293 Ga0373960_0023399
1294 Ga0373943_0328890
1295 Ga0373943_0343822
1296 Ga0373946_0030670
1297 Ga0373955_0051078
1298 Ga0373955_0095704
1299 Ga0373955_0135755
1300 Ga0373942_0000157
1301 Ga0373942_0334166
1302 Ga0373961_0002280
1303 Ga0373962_0009901
1304 Ga0373931_0024828
1305 Ga0373931_0121420
1306 Ga0373935_0047452
1307 Ga0373935_0757612
1308 Ga0373935_1114204
1309 Ga0373927_0315827
1310 Ga0373933_0327890
1311 Ga0373947_0213870
1312 Ga0373937_0160453
1313 Ga0373937_0325750
1314 Ga0373937_0356359
1315 Ga0373937_0499315
1316 Ga0373937_0853944
1317 Ga0373937_0952252
1318 Ga0373937_1449310
1319 Ga0373925_0020135
1320 Ga0373925_0738793
1321 Ga0373925_0746159
1322 Ga0373925_0845980
1323 Ga0451855_1884471
1324 Ga0451853_2826286
1325 Ga0451576_0003205
1326 Ga0451576_0127243
1327 Ga0451576_0179789
1328 Ga0451576_0742229
1329 Ga0495592_0558408
1330 Ga0495629_0380920
1331 Ga0495629_0654587
1332 Ga0495641_0243117
1333 Ga0495651_0458339
1334 Ga0495580_0625294
1335 Ga0495582_0354247
1336 Ga0495639_0371339
1337 Ga0495639_0751287
1338 Ga0495662_0396367
1339 Ga0495608_0041443
1340 Ga0495608_0345949
1341 Ga0495628_0075165
1342 Ga0495630_0106910
1343 Ga0495665_0093838
1344 Ga0495640_0119971
1345 Ga0495598_0100663
1346 Ga0495598_0204372
1347 Ga0495645_0216760
1348 Ga0495656_0414819
1349 Ga0495634_0035939
1350 Ga0495635_0613511
1351 Ga0495659_0348397
1352 Ga0495623_0090810
1353 Ga0495647_0420031
1354 Ga0495647_0487341
1355 Ga0495658_0021544
1356 Ga0495658_0299333
1357 Ga0495658_0434547
1358 Ga0495669_0134641
1359 Ga0495669_0338703
1360 Ga0495613_0006594
1361 Ga0495613_0467658
1362 Ga0495600_0202817
1363 Ga0495600_0342214
1364 Ga0495604_0310885
1365 Ga0495604_0323347
1366 Ga0495675_0201616
1367 Ga0495684_0003091
1368 Ga0496100_0008205
1369 Ga0496100_1470412
1370 Ga0496101_0000588
1371 Ga0496103_0459843
1372 Ga0496104_0062587
1373 Ga0496104_0203278
1374 Ga0496104_0414524
1375 Ga0496104_0752549
1376 Ga0496104_1463820
1377 Ga0496104_1685564
1378 Ga0496105_0039898
1379 Ga0496105_0069519
1380 Ga0496105_0162795
1381 Ga0496105_0290375
1382 Ga0496106_0093777
1383 Ga0496106_0330758
1384 Ga0496107_0201381
1385 Ga0496108_0241642
1386 Ga0496109_0194476
1387 Ga0496109_1958526
1388 Ga0496111_0434577
1389 Ga0496112_0121607
1390 Ga0496112_0442844
1391 Ga0496114_0014814
1392 Ga0496114_0343516
1393 Ga0496115_0081719
1394 Ga0501072_1021239
1395 nmdc:mga03683_15077_c1
1396 nmdc:mga03683_59180_c1
1397 nmdc:mga00v17_39762_c1
1398 nmdc:mga0yw44_115661_c1
1399 nmdc:mga0yw44_45928_c1
1400 nmdc:mga0k408_223712_c1
1401 nmdc:mga06z11_177480_c1
1402 nmdc:mga06z11_5126_c1
1403 nmdc:mga07m45_59326_c1
1404 nmdc:mga05p37_450588_c1
1405 nmdc:mga05p37_944473_c1
1406 nmdc:mga09592_158571_c1
1407 nmdc:mga09592_570542_c1
1408 nmdc:mga0qj67_173794_c1
1409 nmdc:mga0qj67_407262_c1
1410 nmdc:mga06r32_5144_c1
1411 nmdc:mga06r32_587104_c1
1412 nmdc:mga08y16_1135352_c1
1413 nmdc:mga08y16_227561_c1
1414 nmdc:mga08y16_526083_c1
1415 nmdc:mga08y16_8546_c1
1416 nmdc:mga08y16_967_c1
1417 nmdc:mga0n895_240217_c1
1418 nmdc:mga0n895_86676_c1
1419 nmdc:mga0rr50_12645_c1
1420 nmdc:mga0rr50_198023_c1
1421 nmdc:mga0rr50_2720_c1
1422 nmdc:mga0rr50_333396_c1
1423 nmdc:mga0rr50_541944_c1
1424 nmdc:mga08x19_105406_c1
1425 nmdc:mga08x19_85026_c1
1426 nmdc:mga0a205_102602_c1
1427 nmdc:mga0a205_1314063_c1
1428 nmdc:mga0a205_1426012_c1
1429 nmdc:mga0a205_693669_c1
1430 nmdc:mga0a205_96426_c1
1431 Ga0495601_0027835
1432 Ga0495601_0051459
1433 Ga0495601_0193924
1434 Ga0495619_0000702
1435 Ga0495619_0131527
1436 Ga0495619_0268064
1437 Ga0495619_0309494
1438 Ga0500556_0041888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

35

94

0.99

PF13463

HTH_27

Winged helix DNA-binding domain

37

103

0.98

PF01047

MarR

MarR family

37

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9179 48 95
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9105 48 94
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8984 50 95
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.895 35 94
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8933 48 95
ID Description Score Start End Superfamily
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 49 79 1.10.10.10
af_Q9VG60_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9585 48 92 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9355 33 93 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9328 33 95 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9322 50 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8F2F0-F1-model_v4 MarR family transcriptional regulator 0.9275 4 136 GO:0003700
GO:0006950
AF-I8QJK1-F1-model_v4 Transcriptional regulator 0.9201 3 135 GO:0003700
GO:0006950
AF-A0A3M9MGQ4-F1-model_v4 MarR family transcriptional regulator 0.92 2 136 GO:0003700
GO:0006950
AF-A0A3D0R2T8-F1-model_v4 MarR family transcriptional regulator 0.9195 2 135 GO:0003700
GO:0006950
AF-A0A7H0IJF6-F1-model_v4 MarR family transcriptional regulator 0.9149 2 135 GO:0003700
GO:0006950

Map