F477212
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 247 | 1438 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10035423|Ga0065712_100354232 |
| Length | 129 |
| Sequence | MNNPPDVAQDSKEYEEYAHGVQKHVRGYLIVGGTLLLFTLITVALSYVDFGAILSSLFHTNLTATQGRKANIAVAVLVATFKACLVAAIFMHLAAEKRLIYRILIFTGFFVLGLFWLTLLAWYDYPVFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 194 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 195 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 196 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 197 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 198 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 199 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 200 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.12 |
| Rhizosphere | 93.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10035423 | 3300005290 | Unclassified | 1417 |
| 2 | CNXas_1000241 | 3300000545 | Bacteria | 6626 |
| 3 | JGI24743J22301_10015543 | 3300001991 | Bacteria | 1413 |
| 4 | JGI24750J21931_1026906 | 3300002070 | Bacteria | 830 |
| 5 | JGI24035J26624_1001005 | 3300002126 | Bacteria | 2666 |
| 6 | JGI25406J46586_10000002 | 3300003203 | Bacteria | 202415 |
| 7 | JGI25406J46586_10037932 | 3300003203 | Unclassified | 1732 |
| 8 | JGI25405J52794_10000285 | 3300003911 | Bacteria | 6904 |
| 9 | Ga0065703_1019283 | 3300005272 | Bacteria | 3297 |
| 10 | Ga0065714_10018687 | 3300005288 | Unclassified | 1631 |
| 11 | Ga0065704_10005500 | 3300005289 | Bacteria | 6871 |
| 12 | Ga0065704_10024776 | 3300005289 | Unclassified | 1230 |
| 13 | Ga0065704_10031018 | 3300005289 | Bacteria | 1254 |
| 14 | Ga0065704_10166899 | 3300005289 | Bacteria | 1316 |
| 15 | Ga0065704_10441436 | 3300005289 | Bacteria | 707 |
| 16 | Ga0065712_10070627 | 3300005290 | Bacteria | 5839 |
| 17 | Ga0065712_10147954 | 3300005290 | Bacteria | 1391 |
| 18 | Ga0065712_10367122 | 3300005290 | Unclassified | 768 |
| 19 | Ga0065712_10552818 | 3300005290 | Unclassified | 616 |
| 20 | Ga0065715_10003385 | 3300005293 | Bacteria | 6478 |
| 21 | Ga0065715_10045889 | 3300005293 | Unclassified | 925 |
| 22 | Ga0065715_10165279 | 3300005293 | Bacteria | 1592 |
| 23 | Ga0065715_10222833 | 3300005293 | Bacteria | 1256 |
| 24 | Ga0065715_10308034 | 3300005293 | Bacteria | 1003 |
| 25 | Ga0065715_10315550 | 3300005293 | Unclassified | 1012 |
| 26 | Ga0065715_10462569 | 3300005293 | Unclassified | 814 |
| 27 | Ga0065715_10653720 | 3300005293 | Bacteria | 677 |
| 28 | Ga0070658_10124678 | 3300005327 | Unclassified | 2143 |
| 29 | Ga0070658_10206917 | 3300005327 | Bacteria | 1657 |
| 30 | Ga0070676_10111507 | 3300005328 | Unclassified | 1704 |
| 31 | Ga0070676_10365960 | 3300005328 | Bacteria | 995 |
| 32 | Ga0070676_10945792 | 3300005328 | Bacteria | 644 |
| 33 | Ga0070683_100086768 | 3300005329 | Bacteria | 2934 |
| 34 | Ga0070683_100256046 | 3300005329 | Bacteria | 1665 |
| 35 | Ga0070683_101088683 | 3300005329 | Bacteria | 768 |
| 36 | Ga0070690_100056113 | 3300005330 | Bacteria | 2524 |
| 37 | Ga0070690_100061471 | 3300005330 | Unclassified | 2420 |
| 38 | Ga0070690_100063513 | 3300005330 | Bacteria | 2383 |
| 39 | Ga0070690_100301271 | 3300005330 | Bacteria | 1150 |
| 40 | Ga0070690_101626037 | 3300005330 | Unclassified | 524 |
| 41 | Ga0070670_100045128 | 3300005331 | Bacteria | 3788 |
| 42 | Ga0070670_101520046 | 3300005331 | Bacteria | 615 |
| 43 | Ga0070670_101710320 | 3300005331 | Unclassified | 579 |
| 44 | Ga0070677_10584719 | 3300005333 | Unclassified | 616 |
| 45 | Ga0070666_10003567 | 3300005335 | Bacteria | 9436 |
| 46 | Ga0070666_10030280 | 3300005335 | Bacteria | 3564 |
| 47 | Ga0070666_10534084 | 3300005335 | Bacteria | 852 |
| 48 | Ga0070680_100159369 | 3300005336 | Unclassified | 1896 |
| 49 | Ga0068868_100043736 | 3300005338 | Bacteria | 3499 |
| 50 | Ga0068868_100103364 | 3300005338 | Bacteria | 2308 |
| 51 | Ga0068868_100245091 | 3300005338 | Bacteria | 1507 |
| 52 | Ga0068868_100728260 | 3300005338 | Bacteria | 889 |
| 53 | Ga0070689_100011860 | 3300005340 | Bacteria | 6255 |
| 54 | Ga0070689_100241445 | 3300005340 | Bacteria | 1488 |
| 55 | Ga0070691_10411866 | 3300005341 | Bacteria | 764 |
| 56 | Ga0070661_100010625 | 3300005344 | Bacteria | 6405 |
| 57 | Ga0070668_100342387 | 3300005347 | Bacteria | 1263 |
| 58 | Ga0070668_100435819 | 3300005347 | Bacteria | 1124 |
| 59 | Ga0070668_100532707 | 3300005347 | Bacteria | 1020 |
| 60 | Ga0070669_100219934 | 3300005353 | Unclassified | 1501 |
| 61 | Ga0070669_100295503 | 3300005353 | Bacteria | 1302 |
| 62 | Ga0070669_100477196 | 3300005353 | Unclassified | 1031 |
| 63 | Ga0070669_100496591 | 3300005353 | Bacteria | 1012 |
| 64 | Ga0070669_101334710 | 3300005353 | Unclassified | 621 |
| 65 | Ga0070675_100003444 | 3300005354 | Bacteria | 11981 |
| 66 | Ga0070675_100044740 | 3300005354 | Bacteria | 3620 |
| 67 | Ga0070675_100069720 | 3300005354 | Bacteria | 2913 |
| 68 | Ga0070675_100160557 | 3300005354 | Bacteria | 1933 |
| 69 | Ga0070675_100398725 | 3300005354 | Unclassified | 1227 |
| 70 | Ga0070675_101344533 | 3300005354 | Bacteria | 659 |
| 71 | Ga0070671_100009676 | 3300005355 | Bacteria | 7744 |
| 72 | Ga0070671_100053305 | 3300005355 | Bacteria | 3362 |
| 73 | Ga0070671_100134730 | 3300005355 | Bacteria | 2082 |
| 74 | Ga0070671_100165529 | 3300005355 | Bacteria | 1870 |
| 75 | Ga0070671_100209407 | 3300005355 | Bacteria | 1654 |
| 76 | Ga0070671_100403297 | 3300005355 | Bacteria | 1170 |
| 77 | Ga0070671_101554124 | 3300005355 | Unclassified | 586 |
| 78 | Ga0070671_101688746 | 3300005355 | Unclassified | 562 |
| 79 | Ga0070671_101861596 | 3300005355 | Unclassified | 535 |
| 80 | Ga0070671_102052673 | 3300005355 | Bacteria | 509 |
| 81 | Ga0070674_100055100 | 3300005356 | Bacteria | 2752 |
| 82 | Ga0070674_100279974 | 3300005356 | Bacteria | 1321 |
| 83 | Ga0070674_100606058 | 3300005356 | Bacteria | 926 |
| 84 | Ga0070673_100012597 | 3300005364 | Bacteria | 5811 |
| 85 | Ga0070673_100014033 | 3300005364 | Bacteria | 5563 |
| 86 | Ga0070673_100024451 | 3300005364 | Bacteria | 4430 |
| 87 | Ga0070673_100426164 | 3300005364 | Bacteria | 1190 |
| 88 | Ga0070673_100733371 | 3300005364 | Unclassified | 909 |
| 89 | Ga0070673_101082408 | 3300005364 | Bacteria | 748 |
| 90 | Ga0070673_101358976 | 3300005364 | Bacteria | 668 |
| 91 | Ga0070688_100073517 | 3300005365 | Bacteria | 2193 |
| 92 | Ga0070688_100258470 | 3300005365 | Bacteria | 1243 |
| 93 | Ga0070688_100283124 | 3300005365 | Bacteria | 1192 |
| 94 | Ga0070688_100607356 | 3300005365 | Bacteria | 838 |
| 95 | Ga0070688_100929908 | 3300005365 | Unclassified | 687 |
| 96 | Ga0070659_100581595 | 3300005366 | Bacteria | 961 |
| 97 | Ga0070659_101027044 | 3300005366 | Unclassified | 724 |
| 98 | Ga0070659_101464155 | 3300005366 | Bacteria | 608 |
| 99 | Ga0070667_100010448 | 3300005367 | Bacteria | 7664 |
| 100 | Ga0070667_100253267 | 3300005367 | Bacteria | 1574 |
| 101 | Ga0070667_100517532 | 3300005367 | Unclassified | 1095 |
| 102 | Ga0070667_101529114 | 3300005367 | Bacteria | 627 |
| 103 | Ga0070709_10112083 | 3300005434 | Bacteria | 1835 |
| 104 | Ga0070709_10627598 | 3300005434 | Unclassified | 830 |
| 105 | Ga0070709_11477153 | 3300005434 | Bacteria | 551 |
| 106 | Ga0070714_100054859 | 3300005435 | Bacteria | 3405 |
| 107 | Ga0070714_100174982 | 3300005435 | Bacteria | 1950 |
| 108 | Ga0070713_100035111 | 3300005436 | Bacteria | 4034 |
| 109 | Ga0070713_100075293 | 3300005436 | Bacteria | 2862 |
| 110 | Ga0070713_100544403 | 3300005436 | Unclassified | 1098 |
| 111 | Ga0070713_100641756 | 3300005436 | Unclassified | 1011 |
| 112 | Ga0070713_100832353 | 3300005436 | Unclassified | 886 |
| 113 | Ga0070713_100946626 | 3300005436 | Bacteria | 829 |
| 114 | Ga0070710_10505662 | 3300005437 | Unclassified | 828 |
| 115 | Ga0070710_10761436 | 3300005437 | Unclassified | 688 |
| 116 | Ga0070710_11182572 | 3300005437 | Bacteria | 564 |
| 117 | Ga0070711_100042568 | 3300005439 | Bacteria | 3071 |
| 118 | Ga0070711_100043178 | 3300005439 | Bacteria | 3052 |
| 119 | Ga0070711_100056884 | 3300005439 | Bacteria | 2706 |
| 120 | Ga0070711_100778567 | 3300005439 | Unclassified | 810 |
| 121 | Ga0070705_100135858 | 3300005440 | Bacteria | 1611 |
| 122 | Ga0070705_100324260 | 3300005440 | Bacteria | 1113 |
| 123 | Ga0070705_100327445 | 3300005440 | Bacteria | 1108 |
| 124 | Ga0070705_100426403 | 3300005440 | Bacteria | 989 |
| 125 | Ga0070705_100485367 | 3300005440 | Bacteria | 935 |
| 126 | Ga0070705_100505986 | 3300005440 | Bacteria | 918 |
| 127 | Ga0070705_101187677 | 3300005440 | Unclassified | 628 |
| 128 | Ga0070700_100622359 | 3300005441 | Unclassified | 849 |
| 129 | Ga0070694_100615581 | 3300005444 | Bacteria | 876 |
| 130 | Ga0070694_101000407 | 3300005444 | Unclassified | 694 |
| 131 | Ga0070708_100067210 | 3300005445 | Bacteria | 3218 |
| 132 | Ga0070708_100166203 | 3300005445 | Bacteria | 2058 |
| 133 | Ga0070708_100175209 | 3300005445 | Bacteria | 2004 |
| 134 | Ga0070708_100183611 | 3300005445 | Bacteria | 1955 |
| 135 | Ga0070708_100298124 | 3300005445 | Bacteria | 1518 |
| 136 | Ga0070708_100684644 | 3300005445 | Bacteria | 965 |
| 137 | Ga0070708_100768993 | 3300005445 | Bacteria | 906 |
| 138 | Ga0070708_100807341 | 3300005445 | Bacteria | 882 |
| 139 | Ga0070708_101076710 | 3300005445 | Unclassified | 753 |
| 140 | Ga0070708_101193926 | 3300005445 | Bacteria | 712 |
| 141 | Ga0070663_100776199 | 3300005455 | Bacteria | 820 |
| 142 | Ga0070678_100027907 | 3300005456 | Bacteria | 3840 |
| 143 | Ga0070678_100110953 | 3300005456 | Bacteria | 2146 |
| 144 | Ga0070662_100009389 | 3300005457 | Bacteria | 6393 |
| 145 | Ga0070662_100055132 | 3300005457 | Bacteria | 2883 |
| 146 | Ga0070662_100135635 | 3300005457 | Bacteria | 1902 |
| 147 | Ga0070662_101182981 | 3300005457 | Unclassified | 657 |
| 148 | Ga0070681_10919481 | 3300005458 | Unclassified | 793 |
| 149 | Ga0068867_100257175 | 3300005459 | Unclassified | 1422 |
| 150 | Ga0068867_100286278 | 3300005459 | Bacteria | 1353 |
| 151 | Ga0068867_100540142 | 3300005459 | Bacteria | 1008 |
| 152 | Ga0068867_100544949 | 3300005459 | Bacteria | 1004 |
| 153 | Ga0068867_101818599 | 3300005459 | Bacteria | 573 |
| 154 | Ga0070685_10004171 | 3300005466 | Bacteria | 7289 |
| 155 | Ga0070685_10126150 | 3300005466 | Unclassified | 1595 |
| 156 | Ga0070706_100000462 | 3300005467 | Bacteria | 48224 |
| 157 | Ga0070706_100008351 | 3300005467 | Bacteria | 9647 |
| 158 | Ga0070706_100010356 | 3300005467 | Bacteria | 8662 |
| 159 | Ga0070706_100010707 | 3300005467 | Bacteria | 8513 |
| 160 | Ga0070706_100015831 | 3300005467 | Bacteria | 6963 |
| 161 | Ga0070706_100052005 | 3300005467 | Bacteria | 3782 |
| 162 | Ga0070706_100052679 | 3300005467 | Bacteria | 3756 |
| 163 | Ga0070706_100057593 | 3300005467 | Unclassified | 3586 |
| 164 | Ga0070706_100100842 | 3300005467 | Unclassified | 2683 |
| 165 | Ga0070706_100185208 | 3300005467 | Unclassified | 1945 |
| 166 | Ga0070706_100266245 | 3300005467 | Unclassified | 1600 |
| 167 | Ga0070706_101298107 | 3300005467 | Unclassified | 668 |
| 168 | Ga0070707_100000728 | 3300005468 | Bacteria | 32782 |
| 169 | Ga0070707_100020395 | 3300005468 | Bacteria | 6251 |
| 170 | Ga0070707_100031469 | 3300005468 | Bacteria | 5055 |
| 171 | Ga0070707_100033907 | 3300005468 | Unclassified | 4869 |
| 172 | Ga0070707_100071171 | 3300005468 | Bacteria | 3350 |
| 173 | Ga0070707_100098027 | 3300005468 | Unclassified | 2839 |
| 174 | Ga0070707_100145379 | 3300005468 | Unclassified | 2308 |
| 175 | Ga0070707_100192158 | 3300005468 | Bacteria | 1990 |
| 176 | Ga0070707_100890020 | 3300005468 | Unclassified | 855 |
| 177 | Ga0070707_101427729 | 3300005468 | Unclassified | 659 |
| 178 | Ga0070698_100001706 | 3300005471 | Bacteria | 24505 |
| 179 | Ga0070698_100013186 | 3300005471 | Bacteria | 8746 |
| 180 | Ga0070698_100044105 | 3300005471 | Bacteria | 4568 |
| 181 | Ga0070698_100315838 | 3300005471 | Bacteria | 1493 |
| 182 | Ga0070698_100909145 | 3300005471 | Bacteria | 826 |
| 183 | Ga0070698_101398864 | 3300005471 | Bacteria | 650 |
| 184 | Ga0070698_101445163 | 3300005471 | Bacteria | 639 |
| 185 | Ga0070698_101697955 | 3300005471 | Unclassified | 584 |
| 186 | Ga0070698_101960688 | 3300005471 | Unclassified | 539 |
| 187 | Ga0070699_100151837 | 3300005518 | Bacteria | 2049 |
| 188 | Ga0070699_100165824 | 3300005518 | Bacteria | 1956 |
| 189 | Ga0070699_100204290 | 3300005518 | Unclassified | 1757 |
| 190 | Ga0070699_100358301 | 3300005518 | Bacteria | 1315 |
| 191 | Ga0070699_100385662 | 3300005518 | Bacteria | 1265 |
| 192 | Ga0070699_100843645 | 3300005518 | Bacteria | 839 |
| 193 | Ga0070699_100868531 | 3300005518 | Bacteria | 826 |
| 194 | Ga0070699_101365469 | 3300005518 | Unclassified | 650 |
| 195 | Ga0070679_100038308 | 3300005530 | Bacteria | 4765 |
| 196 | Ga0070684_100843061 | 3300005535 | Unclassified | 858 |
| 197 | Ga0070684_101233327 | 3300005535 | Unclassified | 703 |
| 198 | Ga0070697_100005221 | 3300005536 | Bacteria | 9978 |
| 199 | Ga0070697_100007360 | 3300005536 | Bacteria | 8564 |
| 200 | Ga0070697_100007779 | 3300005536 | Bacteria | 8342 |
| 201 | Ga0070697_100009630 | 3300005536 | Bacteria | 7547 |
| 202 | Ga0070697_100011319 | 3300005536 | Bacteria | 6970 |
| 203 | Ga0070697_100028337 | 3300005536 | Bacteria | 4483 |
| 204 | Ga0070697_100031417 | 3300005536 | Bacteria | 4272 |
| 205 | Ga0070697_100033027 | 3300005536 | Unclassified | 4166 |
| 206 | Ga0070697_100126189 | 3300005536 | Bacteria | 2144 |
| 207 | Ga0070697_100149250 | 3300005536 | Bacteria | 1970 |
| 208 | Ga0070697_100189074 | 3300005536 | Bacteria | 1747 |
| 209 | Ga0070697_100250092 | 3300005536 | Unclassified | 1516 |
| 210 | Ga0070697_100287920 | 3300005536 | Bacteria | 1411 |
| 211 | Ga0070697_100297722 | 3300005536 | Unclassified | 1386 |
| 212 | Ga0070697_100475323 | 3300005536 | Unclassified | 1091 |
| 213 | Ga0070697_100837095 | 3300005536 | Unclassified | 815 |
| 214 | Ga0070697_100991691 | 3300005536 | Bacteria | 746 |
| 215 | Ga0070697_101552966 | 3300005536 | Bacteria | 592 |
| 216 | Ga0068853_100992195 | 3300005539 | Bacteria | 808 |
| 217 | Ga0068853_102108636 | 3300005539 | Unclassified | 547 |
| 218 | Ga0070672_100122963 | 3300005543 | Bacteria | 2126 |
| 219 | Ga0070672_100451352 | 3300005543 | Bacteria | 1107 |
| 220 | Ga0070672_101283196 | 3300005543 | Unclassified | 653 |
| 221 | Ga0070672_101647098 | 3300005543 | Unclassified | 576 |
| 222 | Ga0070686_100042035 | 3300005544 | Bacteria | 2861 |
| 223 | Ga0070686_100253219 | 3300005544 | Unclassified | 1287 |
| 224 | Ga0070695_100034571 | 3300005545 | Bacteria | 3170 |
| 225 | Ga0070695_100172843 | 3300005545 | Bacteria | 1525 |
| 226 | Ga0070695_101864026 | 3300005545 | Unclassified | 505 |
| 227 | Ga0070665_100020149 | 3300005548 | Bacteria | 6696 |
| 228 | Ga0070665_100381215 | 3300005548 | Unclassified | 1417 |
| 229 | Ga0070665_100849734 | 3300005548 | Bacteria | 926 |
| 230 | Ga0070665_100894790 | 3300005548 | Bacteria | 900 |
| 231 | Ga0070704_100836743 | 3300005549 | Unclassified | 824 |
| 232 | Ga0070704_101050169 | 3300005549 | Bacteria | 738 |
| 233 | Ga0070704_101759696 | 3300005549 | Bacteria | 573 |
| 234 | Ga0070664_100527465 | 3300005564 | Unclassified | 1090 |
| 235 | Ga0070664_101466954 | 3300005564 | Unclassified | 645 |
| 236 | Ga0070664_102147858 | 3300005564 | Bacteria | 530 |
| 237 | Ga0068854_101180031 | 3300005578 | Bacteria | 685 |
| 238 | Ga0068856_100115811 | 3300005614 | Bacteria | 2680 |
| 239 | Ga0068856_100394480 | 3300005614 | Unclassified | 1404 |
| 240 | Ga0070702_100216165 | 3300005615 | Bacteria | 1279 |
| 241 | Ga0068852_100234377 | 3300005616 | Bacteria | 1751 |
| 242 | Ga0068859_102424446 | 3300005617 | Unclassified | 578 |
| 243 | Ga0068864_100323410 | 3300005618 | Unclassified | 1449 |
| 244 | Ga0068864_101334398 | 3300005618 | Bacteria | 718 |
| 245 | Ga0068866_10279177 | 3300005718 | Bacteria | 1034 |
| 246 | Ga0068866_11062765 | 3300005718 | Unclassified | 578 |
| 247 | Ga0068861_100553448 | 3300005719 | Bacteria | 1049 |
| 248 | Ga0068861_100582638 | 3300005719 | Bacteria | 1024 |
| 249 | Ga0068863_100355136 | 3300005841 | Bacteria | 1428 |
| 250 | Ga0068863_100396192 | 3300005841 | Unclassified | 1350 |
| 251 | Ga0068863_101170522 | 3300005841 | Unclassified | 774 |
| 252 | Ga0068863_101802315 | 3300005841 | Unclassified | 622 |
| 253 | Ga0068860_100121590 | 3300005843 | Bacteria | 2500 |
| 254 | Ga0068860_100375419 | 3300005843 | Bacteria | 1403 |
| 255 | Ga0068860_100623487 | 3300005843 | Bacteria | 1085 |
| 256 | Ga0068860_100656227 | 3300005843 | Unclassified | 1057 |
| 257 | Ga0068862_100010875 | 3300005844 | Bacteria | 7514 |
| 258 | Ga0068862_101378308 | 3300005844 | Bacteria | 708 |
| 259 | Ga0081455_10000605 | 3300005937 | Bacteria | 46387 |
| 260 | Ga0081455_10483289 | 3300005937 | Bacteria | 837 |
| 261 | Ga0081539_10000061 | 3300005985 | Bacteria | 250890 |
| 262 | Ga0081539_10039558 | 3300005985 | Bacteria | 2780 |
| 263 | Ga0070717_10000793 | 3300006028 | Bacteria | 20762 |
| 264 | Ga0070717_10032475 | 3300006028 | Bacteria | 4207 |
| 265 | Ga0070717_10061036 | 3300006028 | Bacteria | 3123 |
| 266 | Ga0070717_10098152 | 3300006028 | Unclassified | 2483 |
| 267 | Ga0070717_10811258 | 3300006028 | Unclassified | 851 |
| 268 | Ga0070717_10881428 | 3300006028 | Unclassified | 815 |
| 269 | Ga0070717_11056050 | 3300006028 | Bacteria | 740 |
| 270 | Ga0070717_11421793 | 3300006028 | Unclassified | 630 |
| 271 | Ga0070715_10075846 | 3300006163 | Bacteria | 1513 |
| 272 | Ga0070715_10137464 | 3300006163 | Unclassified | 1183 |
| 273 | Ga0070716_100082946 | 3300006173 | Bacteria | 1918 |
| 274 | Ga0070716_100141780 | 3300006173 | Unclassified | 1533 |
| 275 | Ga0070716_100145530 | 3300006173 | Bacteria | 1517 |
| 276 | Ga0070716_100290172 | 3300006173 | Bacteria | 1133 |
| 277 | Ga0070716_100542372 | 3300006173 | Unclassified | 866 |
| 278 | Ga0070716_100583947 | 3300006173 | Unclassified | 838 |
| 279 | Ga0070716_100668593 | 3300006173 | Bacteria | 790 |
| 280 | Ga0070716_100672216 | 3300006173 | Bacteria | 788 |
| 281 | Ga0070716_100885376 | 3300006173 | Bacteria | 698 |
| 282 | Ga0070716_101720908 | 3300006173 | Unclassified | 518 |
| 283 | Ga0070712_100044644 | 3300006175 | Unclassified | 3056 |
| 284 | Ga0070712_100227594 | 3300006175 | Unclassified | 1479 |
| 285 | Ga0070712_100297323 | 3300006175 | Bacteria | 1305 |
| 286 | Ga0070712_100460707 | 3300006175 | Bacteria | 1060 |
| 287 | Ga0070712_101542674 | 3300006175 | Bacteria | 581 |
| 288 | Ga0097621_100074010 | 3300006237 | Bacteria | 2821 |
| 289 | Ga0097621_100116993 | 3300006237 | Bacteria | 2258 |
| 290 | Ga0097621_100118082 | 3300006237 | Bacteria | 2248 |
| 291 | Ga0097621_100575944 | 3300006237 | Unclassified | 1027 |
| 292 | Ga0097621_100787939 | 3300006237 | Unclassified | 880 |
| 293 | Ga0068871_100003837 | 3300006358 | Bacteria | 10358 |
| 294 | Ga0068871_100020392 | 3300006358 | Bacteria | 5077 |
| 295 | Ga0068871_100042536 | 3300006358 | Bacteria | 3648 |
| 296 | Ga0068871_100131820 | 3300006358 | Bacteria | 2120 |
| 297 | Ga0068871_100155565 | 3300006358 | Unclassified | 1952 |
| 298 | Ga0068871_100211018 | 3300006358 | Bacteria | 1679 |
| 299 | Ga0068871_100292348 | 3300006358 | Unclassified | 1428 |
| 300 | Ga0068871_100484370 | 3300006358 | Bacteria | 1113 |
| 301 | Ga0075433_10441720 | 3300006852 | Unclassified | 1147 |
| 302 | Ga0075433_11453830 | 3300006852 | Unclassified | 592 |
| 303 | Ga0075434_100560806 | 3300006871 | Bacteria | 1162 |
| 304 | Ga0075434_100576985 | 3300006871 | Unclassified | 1144 |
| 305 | Ga0075434_101089345 | 3300006871 | Bacteria | 812 |
| 306 | Ga0075434_102168416 | 3300006871 | Bacteria | 560 |
| 307 | Ga0068865_100076037 | 3300006881 | Bacteria | 2396 |
| 308 | Ga0068865_100625137 | 3300006881 | Bacteria | 913 |
| 309 | Ga0068865_100670402 | 3300006881 | Unclassified | 883 |
| 310 | Ga0068865_101614111 | 3300006881 | Bacteria | 583 |
| 311 | Ga0068865_101932700 | 3300006881 | Unclassified | 535 |
| 312 | Ga0075436_100016212 | 3300006914 | Bacteria | 5101 |
| 313 | Ga0075436_100739511 | 3300006914 | Unclassified | 730 |
| 314 | Ga0097620_102424963 | 3300006931 | Unclassified | 578 |
| 315 | Ga0075435_100160743 | 3300007076 | Unclassified | 1892 |
| 316 | Ga0075435_101380852 | 3300007076 | Unclassified | 617 |
| 317 | Ga0099794_10324607 | 3300007265 | Unclassified | 799 |
| 318 | Ga0099794_10646450 | 3300007265 | Unclassified | 561 |
| 319 | Ga0099795_10258692 | 3300007788 | Bacteria | 753 |
| 320 | Ga0105240_10320610 | 3300009093 | Bacteria | 1767 |
| 321 | Ga0105240_10644133 | 3300009093 | Unclassified | 1162 |
| 322 | Ga0105240_10897098 | 3300009093 | Bacteria | 954 |
| 323 | Ga0105245_10033057 | 3300009098 | Bacteria | 4582 |
| 324 | Ga0105245_10063508 | 3300009098 | Bacteria | 3334 |
| 325 | Ga0105245_10144502 | 3300009098 | Unclassified | 2244 |
| 326 | Ga0105245_10302026 | 3300009098 | Bacteria | 1571 |
| 327 | Ga0105245_10508295 | 3300009098 | Bacteria | 1222 |
| 328 | Ga0105245_10574990 | 3300009098 | Bacteria | 1151 |
| 329 | Ga0105245_10826161 | 3300009098 | Unclassified | 966 |
| 330 | Ga0105245_11123982 | 3300009098 | Bacteria | 832 |
| 331 | Ga0105243_10502073 | 3300009148 | Bacteria | 1150 |
| 332 | Ga0105243_10547913 | 3300009148 | Bacteria | 1105 |
| 333 | Ga0105241_10139170 | 3300009174 | Bacteria | 1974 |
| 334 | Ga0105241_10327062 | 3300009174 | Bacteria | 1324 |
| 335 | Ga0105241_10393980 | 3300009174 | Bacteria | 1213 |
| 336 | Ga0105242_10814578 | 3300009176 | Bacteria | 926 |
| 337 | Ga0105248_10224471 | 3300009177 | Bacteria | 2115 |
| 338 | Ga0105248_10267479 | 3300009177 | Bacteria | 1925 |
| 339 | Ga0105249_10015800 | 3300009553 | Bacteria | 6688 |
| 340 | Ga0105249_10131732 | 3300009553 | Unclassified | 2388 |
| 341 | Ga0105249_11151957 | 3300009553 | Unclassified | 846 |
| 342 | Ga0099796_10028954 | 3300010159 | Bacteria | 1783 |
| 343 | Ga0099796_10310070 | 3300010159 | Bacteria | 671 |
| 344 | Ga0099796_10450825 | 3300010159 | Unclassified | 572 |
| 345 | Ga0105239_10097798 | 3300010375 | Bacteria | 3244 |
| 346 | Ga0105239_10437139 | 3300010375 | Unclassified | 1483 |
| 347 | Ga0105246_11893941 | 3300011119 | Unclassified | 572 |
| 348 | Ga0157373_10147023 | 3300013100 | Bacteria | 1658 |
| 349 | Ga0157373_10316208 | 3300013100 | Bacteria | 1110 |
| 350 | Ga0157373_10816452 | 3300013100 | Bacteria | 688 |
| 351 | Ga0157371_10051633 | 3300013102 | Bacteria | 2921 |
| 352 | Ga0157371_10067979 | 3300013102 | Bacteria | 2522 |
| 353 | Ga0157371_10263146 | 3300013102 | Bacteria | 1244 |
| 354 | Ga0157371_10471643 | 3300013102 | Bacteria | 924 |
| 355 | Ga0157369_10483435 | 3300013105 | Bacteria | 1282 |
| 356 | Ga0157374_10010738 | 3300013296 | Bacteria | 7893 |
| 357 | Ga0157374_10018747 | 3300013296 | Bacteria | 6114 |
| 358 | Ga0157374_10025175 | 3300013296 | Bacteria | 5340 |
| 359 | Ga0157374_10081760 | 3300013296 | Bacteria | 3066 |
| 360 | Ga0157374_10084630 | 3300013296 | Bacteria | 3015 |
| 361 | Ga0157374_10124764 | 3300013296 | Unclassified | 2488 |
| 362 | Ga0157374_10232767 | 3300013296 | Bacteria | 1810 |
| 363 | Ga0157374_10962735 | 3300013296 | Bacteria | 872 |
| 364 | Ga0157374_11301641 | 3300013296 | Unclassified | 749 |
| 365 | Ga0157374_11307949 | 3300013296 | Unclassified | 747 |
| 366 | Ga0157374_11686170 | 3300013296 | Unclassified | 658 |
| 367 | Ga0157374_11695638 | 3300013296 | Unclassified | 657 |
| 368 | Ga0157378_10005095 | 3300013297 | Bacteria | 11542 |
| 369 | Ga0157378_10008102 | 3300013297 | Bacteria | 9170 |
| 370 | Ga0157378_10026235 | 3300013297 | Bacteria | 5136 |
| 371 | Ga0157378_10121134 | 3300013297 | Bacteria | 2411 |
| 372 | Ga0157378_10128391 | 3300013297 | Bacteria | 2344 |
| 373 | Ga0157378_10201688 | 3300013297 | Bacteria | 1882 |
| 374 | Ga0157378_10561411 | 3300013297 | Unclassified | 1148 |
| 375 | Ga0157378_11054333 | 3300013297 | Bacteria | 849 |
| 376 | Ga0157378_11073539 | 3300013297 | Bacteria | 841 |
| 377 | Ga0157378_11331913 | 3300013297 | Bacteria | 760 |
| 378 | Ga0157378_11360240 | 3300013297 | Bacteria | 752 |
| 379 | Ga0157378_11440526 | 3300013297 | Bacteria | 732 |
| 380 | Ga0157378_11599005 | 3300013297 | Unclassified | 698 |
| 381 | Ga0157378_11626570 | 3300013297 | Bacteria | 692 |
| 382 | Ga0157378_11896964 | 3300013297 | Bacteria | 645 |
| 383 | Ga0163162_10051213 | 3300013306 | Bacteria | 4142 |
| 384 | Ga0163162_10069437 | 3300013306 | Unclassified | 3575 |
| 385 | Ga0163162_10287231 | 3300013306 | Bacteria | 1777 |
| 386 | Ga0163162_10354253 | 3300013306 | Bacteria | 1600 |
| 387 | Ga0163162_11444327 | 3300013306 | Unclassified | 783 |
| 388 | Ga0157372_10052471 | 3300013307 | Bacteria | 4541 |
| 389 | Ga0157372_10061027 | 3300013307 | Bacteria | 4220 |
| 390 | Ga0157372_10705284 | 3300013307 | Unclassified | 1174 |
| 391 | Ga0157372_10709422 | 3300013307 | Bacteria | 1170 |
| 392 | Ga0157372_12547906 | 3300013307 | Bacteria | 587 |
| 393 | Ga0157375_10011380 | 3300013308 | Bacteria | 7854 |
| 394 | Ga0157375_10017242 | 3300013308 | Bacteria | 6512 |
| 395 | Ga0157375_10416502 | 3300013308 | Unclassified | 1510 |
| 396 | Ga0157375_10604869 | 3300013308 | Bacteria | 1255 |
| 397 | Ga0157375_11367831 | 3300013308 | Bacteria | 833 |
| 398 | Ga0157375_12003534 | 3300013308 | Unclassified | 688 |
| 399 | Ga0157375_13194001 | 3300013308 | Unclassified | 547 |
| 400 | Ga0163163_10252060 | 3300014325 | Bacteria | 1816 |
| 401 | Ga0163163_10429858 | 3300014325 | Bacteria | 1380 |
| 402 | Ga0163163_10986997 | 3300014325 | Unclassified | 905 |
| 403 | Ga0163163_11329433 | 3300014325 | Unclassified | 781 |
| 404 | Ga0157377_10203648 | 3300014745 | Bacteria | 1258 |
| 405 | Ga0157377_10918835 | 3300014745 | Bacteria | 656 |
| 406 | Ga0157376_10106598 | 3300014969 | Bacteria | 2459 |
| 407 | Ga0157376_10150305 | 3300014969 | Bacteria | 2099 |
| 408 | Ga0157376_10170174 | 3300014969 | Bacteria | 1983 |
| 409 | Ga0157376_10655472 | 3300014969 | Unclassified | 1051 |
| 410 | Ga0182005_1104376 | 3300015265 | Unclassified | 796 |
| 411 | Ga0163161_10074147 | 3300017792 | Bacteria | 2495 |
| 412 | Ga0163161_10139624 | 3300017792 | Unclassified | 1834 |
| 413 | Ga0163161_11518959 | 3300017792 | Unclassified | 588 |
| 414 | Ga0207666_1000150 | 3300025271 | Bacteria | 10758 |
| 415 | Ga0207666_1006112 | 3300025271 | Unclassified | 1554 |
| 416 | Ga0207673_1000621 | 3300025290 | Unclassified | 3784 |
| 417 | Ga0207673_1007118 | 3300025290 | Bacteria | 1397 |
| 418 | Ga0207697_10001422 | 3300025315 | Bacteria | 13085 |
| 419 | Ga0207697_10003870 | 3300025315 | Bacteria | 7299 |
| 420 | Ga0207697_10006773 | 3300025315 | Bacteria | 5153 |
| 421 | Ga0207697_10047679 | 3300025315 | Bacteria | 1766 |
| 422 | Ga0207697_10084861 | 3300025315 | Unclassified | 1337 |
| 423 | Ga0207692_10459930 | 3300025898 | Unclassified | 802 |
| 424 | Ga0207642_10123101 | 3300025899 | Bacteria | 1341 |
| 425 | Ga0207688_10009510 | 3300025901 | Bacteria | 5290 |
| 426 | Ga0207680_10014921 | 3300025903 | Bacteria | 4039 |
| 427 | Ga0207680_10266870 | 3300025903 | Bacteria | 1186 |
| 428 | Ga0207680_10725681 | 3300025903 | Unclassified | 712 |
| 429 | Ga0207680_11006048 | 3300025903 | Bacteria | 597 |
| 430 | Ga0207685_10119431 | 3300025905 | Unclassified | 1155 |
| 431 | Ga0207699_10381963 | 3300025906 | Bacteria | 1000 |
| 432 | Ga0207699_10832570 | 3300025906 | Bacteria | 679 |
| 433 | Ga0207645_10025467 | 3300025907 | Bacteria | 3827 |
| 434 | Ga0207645_10106680 | 3300025907 | Bacteria | 1811 |
| 435 | Ga0207645_10495354 | 3300025907 | Bacteria | 827 |
| 436 | Ga0207684_10000512 | 3300025910 | Bacteria | 48238 |
| 437 | Ga0207684_10010267 | 3300025910 | Bacteria | 8241 |
| 438 | Ga0207684_10010449 | 3300025910 | Bacteria | 8172 |
| 439 | Ga0207684_10023670 | 3300025910 | Bacteria | 5242 |
| 440 | Ga0207684_10027226 | 3300025910 | Bacteria | 4873 |
| 441 | Ga0207684_10027382 | 3300025910 | Unclassified | 4857 |
| 442 | Ga0207684_10035234 | 3300025910 | Bacteria | 4250 |
| 443 | Ga0207684_10077287 | 3300025910 | Bacteria | 2830 |
| 444 | Ga0207684_10091730 | 3300025910 | Bacteria | 2589 |
| 445 | Ga0207684_10157817 | 3300025910 | Bacteria | 1953 |
| 446 | Ga0207684_10403442 | 3300025910 | Bacteria | 1175 |
| 447 | Ga0207684_10497928 | 3300025910 | Bacteria | 1044 |
| 448 | Ga0207684_10543512 | 3300025910 | Unclassified | 994 |
| 449 | Ga0207707_10060789 | 3300025912 | Bacteria | 3286 |
| 450 | Ga0207693_10005152 | 3300025915 | Bacteria | 10945 |
| 451 | Ga0207693_10071160 | 3300025915 | Bacteria | 2721 |
| 452 | Ga0207693_10171115 | 3300025915 | Bacteria | 1710 |
| 453 | Ga0207693_11060434 | 3300025915 | Unclassified | 617 |
| 454 | Ga0207663_10051182 | 3300025916 | Bacteria | 2570 |
| 455 | Ga0207663_10305321 | 3300025916 | Bacteria | 1190 |
| 456 | Ga0207663_11295918 | 3300025916 | Unclassified | 587 |
| 457 | Ga0207660_11589837 | 3300025917 | Unclassified | 527 |
| 458 | Ga0207662_10005566 | 3300025918 | Bacteria | 6728 |
| 459 | Ga0207657_10217301 | 3300025919 | Unclassified | 1533 |
| 460 | Ga0207649_10013593 | 3300025920 | Unclassified | 4548 |
| 461 | Ga0207652_10085397 | 3300025921 | Unclassified | 2766 |
| 462 | Ga0207646_10000867 | 3300025922 | Bacteria | 39113 |
| 463 | Ga0207646_10000886 | 3300025922 | Bacteria | 38660 |
| 464 | Ga0207646_10001911 | 3300025922 | Bacteria | 25095 |
| 465 | Ga0207646_10028991 | 3300025922 | Bacteria | 5034 |
| 466 | Ga0207646_10048928 | 3300025922 | Bacteria | 3788 |
| 467 | Ga0207646_10075291 | 3300025922 | Unclassified | 3016 |
| 468 | Ga0207646_10118421 | 3300025922 | Unclassified | 2379 |
| 469 | Ga0207646_10134257 | 3300025922 | Bacteria | 2228 |
| 470 | Ga0207646_10263476 | 3300025922 | Bacteria | 1558 |
| 471 | Ga0207646_10388751 | 3300025922 | Bacteria | 1260 |
| 472 | Ga0207646_10802294 | 3300025922 | Unclassified | 838 |
| 473 | Ga0207646_10885102 | 3300025922 | Unclassified | 793 |
| 474 | Ga0207646_11274163 | 3300025922 | Unclassified | 643 |
| 475 | Ga0207681_10006232 | 3300025923 | Bacteria | 7313 |
| 476 | Ga0207681_10144925 | 3300025923 | Bacteria | 1773 |
| 477 | Ga0207681_10340735 | 3300025923 | Unclassified | 1197 |
| 478 | Ga0207681_10458342 | 3300025923 | Unclassified | 1038 |
| 479 | Ga0207650_10011747 | 3300025925 | Bacteria | 6038 |
| 480 | Ga0207650_10202612 | 3300025925 | Bacteria | 1590 |
| 481 | Ga0207650_10208472 | 3300025925 | Bacteria | 1569 |
| 482 | Ga0207659_10011596 | 3300025926 | Bacteria | 5575 |
| 483 | Ga0207659_10042534 | 3300025926 | Bacteria | 3186 |
| 484 | Ga0207659_10117043 | 3300025926 | Unclassified | 2036 |
| 485 | Ga0207659_10119018 | 3300025926 | Bacteria | 2021 |
| 486 | Ga0207659_10125639 | 3300025926 | Bacteria | 1972 |
| 487 | Ga0207659_11020964 | 3300025926 | Unclassified | 712 |
| 488 | Ga0207687_10069685 | 3300025927 | Bacteria | 2509 |
| 489 | Ga0207687_10093261 | 3300025927 | Unclassified | 2201 |
| 490 | Ga0207700_10136147 | 3300025928 | Bacteria | 2012 |
| 491 | Ga0207700_11633520 | 3300025928 | Bacteria | 570 |
| 492 | Ga0207664_10025619 | 3300025929 | Bacteria | 4447 |
| 493 | Ga0207664_10161884 | 3300025929 | Bacteria | 1909 |
| 494 | Ga0207664_10541936 | 3300025929 | Unclassified | 1044 |
| 495 | Ga0207644_10021191 | 3300025931 | Unclassified | 4424 |
| 496 | Ga0207644_10080908 | 3300025931 | Bacteria | 2400 |
| 497 | Ga0207644_10084189 | 3300025931 | Bacteria | 2357 |
| 498 | Ga0207644_10498148 | 3300025931 | Bacteria | 1005 |
| 499 | Ga0207644_10768883 | 3300025931 | Unclassified | 805 |
| 500 | Ga0207644_10847511 | 3300025931 | Unclassified | 765 |
| 501 | Ga0207690_10526212 | 3300025932 | Bacteria | 959 |
| 502 | Ga0207690_10811281 | 3300025932 | Unclassified | 774 |
| 503 | Ga0207706_10032204 | 3300025933 | Unclassified | 4669 |
| 504 | Ga0207706_10102970 | 3300025933 | Bacteria | 2512 |
| 505 | Ga0207706_10160946 | 3300025933 | Bacteria | 1973 |
| 506 | Ga0207709_10155899 | 3300025935 | Unclassified | 1587 |
| 507 | Ga0207670_10009592 | 3300025936 | Bacteria | 5531 |
| 508 | Ga0207670_10096812 | 3300025936 | Unclassified | 2100 |
| 509 | Ga0207670_10347868 | 3300025936 | Bacteria | 1173 |
| 510 | Ga0207670_10453471 | 3300025936 | Bacteria | 1034 |
| 511 | Ga0207670_11121801 | 3300025936 | Unclassified | 664 |
| 512 | Ga0207669_10093396 | 3300025937 | Bacteria | 1966 |
| 513 | Ga0207669_10192430 | 3300025937 | Unclassified | 1473 |
| 514 | Ga0207669_10683653 | 3300025937 | Bacteria | 842 |
| 515 | Ga0207669_10722205 | 3300025937 | Bacteria | 820 |
| 516 | Ga0207669_11032738 | 3300025937 | Unclassified | 692 |
| 517 | Ga0207665_10021136 | 3300025939 | Bacteria | 4277 |
| 518 | Ga0207665_10165567 | 3300025939 | Unclassified | 1593 |
| 519 | Ga0207665_10311650 | 3300025939 | Unclassified | 1179 |
| 520 | Ga0207665_10384465 | 3300025939 | Bacteria | 1066 |
| 521 | Ga0207665_10921774 | 3300025939 | Unclassified | 693 |
| 522 | Ga0207665_11126028 | 3300025939 | Bacteria | 626 |
| 523 | Ga0207665_11218260 | 3300025939 | Unclassified | 600 |
| 524 | Ga0207665_11547786 | 3300025939 | Unclassified | 526 |
| 525 | Ga0207691_10000359 | 3300025940 | Bacteria | 46053 |
| 526 | Ga0207691_10075220 | 3300025940 | Unclassified | 3045 |
| 527 | Ga0207691_11433563 | 3300025940 | Unclassified | 566 |
| 528 | Ga0207661_10090916 | 3300025944 | Bacteria | 2542 |
| 529 | Ga0207661_10531814 | 3300025944 | Bacteria | 1076 |
| 530 | Ga0207661_10870782 | 3300025944 | Bacteria | 829 |
| 531 | Ga0207679_11316427 | 3300025945 | Bacteria | 663 |
| 532 | Ga0207667_10963941 | 3300025949 | Bacteria | 842 |
| 533 | Ga0207651_10149221 | 3300025960 | Bacteria | 1817 |
| 534 | Ga0207651_10629260 | 3300025960 | Bacteria | 940 |
| 535 | Ga0207651_10999334 | 3300025960 | Unclassified | 747 |
| 536 | Ga0207651_11700914 | 3300025960 | Bacteria | 568 |
| 537 | Ga0207712_10039324 | 3300025961 | Unclassified | 3240 |
| 538 | Ga0207712_10139678 | 3300025961 | Bacteria | 1857 |
| 539 | Ga0207668_10186759 | 3300025972 | Bacteria | 1639 |
| 540 | Ga0207668_10858032 | 3300025972 | Bacteria | 806 |
| 541 | Ga0207658_10035809 | 3300025986 | Unclassified | 3556 |
| 542 | Ga0207658_10184958 | 3300025986 | Bacteria | 1727 |
| 543 | Ga0207658_10187878 | 3300025986 | Bacteria | 1715 |
| 544 | Ga0207658_10420746 | 3300025986 | Bacteria | 1178 |
| 545 | Ga0207658_10533203 | 3300025986 | Unclassified | 1049 |
| 546 | Ga0207658_10709948 | 3300025986 | Bacteria | 909 |
| 547 | Ga0207677_10012800 | 3300026023 | Unclassified | 4841 |
| 548 | Ga0207677_10032416 | 3300026023 | Bacteria | 3359 |
| 549 | Ga0207677_10104574 | 3300026023 | Bacteria | 2093 |
| 550 | Ga0207677_10213274 | 3300026023 | Bacteria | 1543 |
| 551 | Ga0207677_10290147 | 3300026023 | Unclassified | 1347 |
| 552 | Ga0207677_10648801 | 3300026023 | Bacteria | 931 |
| 553 | Ga0207639_11622282 | 3300026041 | Unclassified | 607 |
| 554 | Ga0207678_10186757 | 3300026067 | Unclassified | 1770 |
| 555 | Ga0207702_10952218 | 3300026078 | Unclassified | 851 |
| 556 | Ga0207641_10277332 | 3300026088 | Bacteria | 1575 |
| 557 | Ga0207641_11487080 | 3300026088 | Bacteria | 679 |
| 558 | Ga0207648_10053740 | 3300026089 | Bacteria | 3520 |
| 559 | Ga0207648_10260120 | 3300026089 | Unclassified | 1548 |
| 560 | Ga0207648_10699701 | 3300026089 | Bacteria | 939 |
| 561 | Ga0207648_11142771 | 3300026089 | Bacteria | 731 |
| 562 | Ga0207648_12259030 | 3300026089 | Unclassified | 505 |
| 563 | Ga0207676_11290866 | 3300026095 | Bacteria | 725 |
| 564 | Ga0207676_12334331 | 3300026095 | Unclassified | 532 |
| 565 | Ga0207675_100116214 | 3300026118 | Unclassified | 2528 |
| 566 | Ga0207675_100185912 | 3300026118 | Unclassified | 1991 |
| 567 | Ga0207675_100553452 | 3300026118 | Bacteria | 1150 |
| 568 | Ga0207675_100943013 | 3300026118 | Bacteria | 880 |
| 569 | Ga0207683_10054108 | 3300026121 | Unclassified | 3519 |
| 570 | Ga0207683_10110619 | 3300026121 | Unclassified | 2460 |
| 571 | Ga0207683_10220382 | 3300026121 | Unclassified | 1728 |
| 572 | Ga0207698_10253923 | 3300026142 | Bacteria | 1611 |
| 573 | Ga0207698_10976081 | 3300026142 | Bacteria | 857 |
| 574 | Ga0209999_1104623 | 3300027543 | Unclassified | 552 |
| 575 | Ga0268266_10026192 | 3300028379 | Unclassified | 4962 |
| 576 | Ga0268266_10163441 | 3300028379 | Bacteria | 2015 |
| 577 | Ga0268266_10372233 | 3300028379 | Unclassified | 1346 |
| 578 | Ga0268266_11011797 | 3300028379 | Bacteria | 804 |
| 579 | Ga0268265_10420602 | 3300028380 | Bacteria | 1240 |
| 580 | Ga0268265_10620408 | 3300028380 | Bacteria | 1036 |
| 581 | Ga0268264_10156009 | 3300028381 | Bacteria | 2051 |
| 582 | Ga0268264_10773578 | 3300028381 | Unclassified | 958 |
| 583 | Ga0307513_10237415 | 3300031456 | Unclassified | 1631 |
| 584 | Ga0373926_0081795 | 3300035083 | Bacteria | 1195 |
| 585 | Ga0373944_0104186 | 3300035089 | Bacteria | 962 |
| 586 | Ga0373944_0317837 | 3300035089 | Bacteria | 587 |
| 587 | Ga0373932_0099119 | 3300035112 | Bacteria | 946 |
| 588 | Ga0373941_0196161 | 3300035115 | Bacteria | 765 |
| 589 | Ga0373945_0412041 | 3300035116 | Bacteria | 593 |
| 590 | Ga0373953_0157764 | 3300035117 | Unclassified | 975 |
| 591 | Ga0373956_0185313 | 3300035119 | Unclassified | 985 |
| 592 | Ga0373943_0011647 | 3300035170 | Bacteria | 3959 |
| 593 | Ga0373943_0273691 | 3300035170 | Bacteria | 953 |
| 594 | Ga0373946_0114597 | 3300035171 | Bacteria | 1224 |
| 595 | Ga0373955_0140957 | 3300035172 | Unclassified | 1414 |
| 596 | Ga0373955_0472475 | 3300035172 | Unclassified | 765 |
| 597 | Ga0373955_0652165 | 3300035172 | Unclassified | 645 |
| 598 | Ga0373931_0120059 | 3300035691 | Bacteria | 1501 |
| 599 | Ga0373935_0396526 | 3300035692 | Bacteria | 990 |
| 600 | Ga0373935_0505662 | 3300035692 | Unclassified | 878 |
| 601 | Ga0373927_0275893 | 3300035695 | Unclassified | 1106 |
| 602 | Ga0373927_0645903 | 3300035695 | Bacteria | 699 |
| 603 | Ga0373933_0252295 | 3300035724 | Unclassified | 1136 |
| 604 | Ga0373947_0019841 | 3300035725 | Unclassified | 3880 |
| 605 | Ga0373947_0040731 | 3300035725 | Bacteria | 2768 |
| 606 | Ga0373947_0095884 | 3300035725 | Bacteria | 1857 |
| 607 | Ga0373947_0203470 | 3300035725 | Bacteria | 1296 |
| 608 | Ga0373947_0549423 | 3300035725 | Unclassified | 786 |
| 609 | Ga0373947_0690081 | 3300035725 | Unclassified | 696 |
| 610 | Ga0373937_0066900 | 3300036401 | Bacteria | 3310 |
| 611 | Ga0373937_0112204 | 3300036401 | Unclassified | 2536 |
| 612 | Ga0373925_0138452 | 3300037068 | Bacteria | 1904 |
| 613 | Ga0373925_0365882 | 3300037068 | Unclassified | 1173 |
| 614 | Ga0395900_0107662 | 3300037418 | Bacteria | 2863 |
| 615 | Ga0395900_0611620 | 3300037418 | Unclassified | 1029 |
| 616 | Ga0395900_0631823 | 3300037418 | Unclassified | 1009 |
| 617 | Ga0436364_0255257 | 3300037853 | Unclassified | 1478 |
| 618 | Ga0395901_0040644 | 3300038443 | Bacteria | 4818 |
| 619 | Ga0395901_0760335 | 3300038443 | Unclassified | 961 |
| 620 | Ga0436365_0391059 | 3300039437 | Bacteria | 7445 |
| 621 | Ga0436363_0880421 | 3300039450 | Unclassified | 1088 |
| 622 | Ga0436362_1306557 | 3300039453 | Bacteria | 583 |
| 623 | Ga0451798_0119280 | 3300041458 | Unclassified | 682 |
| 624 | Ga0451807_0923257 | 3300041486 | Unclassified | 850 |
| 625 | Ga0451845_0445642 | 3300041501 | Bacteria | 779 |
| 626 | Ga0451843_1244407 | 3300041509 | Bacteria | 627 |
| 627 | Ga0439451_120013 | 3300042009 | Bacteria | 535 |
| 628 | Ga0439454_003710 | 3300042011 | Bacteria | 1718 |
| 629 | Ga0439455_0233245 | 3300042012 | Unclassified | 537 |
| 630 | Ga0439444_0087314 | 3300042437 | Unclassified | 691 |
| 631 | Ga0450893_0114469 | 3300042532 | Bacteria | 559 |
| 632 | Ga0439440_0036258 | 3300042993 | Bacteria | 1186 |
| 633 | Ga0453683_0475341 | 3300044673 | Bacteria | 810 |
| 634 | Ga0451576_0022372 | 3300045051 | Bacteria | 6855 |
| 635 | Ga0466967_2226260 | 3300045976 | Unclassified | 544 |
| 636 | Ga0495592_0006575 | 3300046454 | Bacteria | 8660 |
| 637 | Ga0495651_0444449 | 3300046462 | Bacteria | 839 |
| 638 | Ga0495580_0834371 | 3300046472 | Bacteria | 596 |
| 639 | Ga0495580_0988009 | 3300046472 | Bacteria | 537 |
| 640 | Ga0495584_0134290 | 3300046491 | Bacteria | 1256 |
| 641 | Ga0495584_0235004 | 3300046491 | Bacteria | 932 |
| 642 | Ga0495618_0146240 | 3300046514 | Unclassified | 1511 |
| 643 | Ga0495628_0009686 | 3300046516 | Bacteria | 8219 |
| 644 | Ga0495628_0704256 | 3300046516 | Unclassified | 713 |
| 645 | Ga0495628_1055922 | 3300046516 | Bacteria | 557 |
| 646 | Ga0495630_1394416 | 3300046517 | Unclassified | 527 |
| 647 | Ga0495652_0009726 | 3300046529 | Bacteria | 8721 |
| 648 | Ga0495586_0381069 | 3300046535 | Bacteria | 811 |
| 649 | Ga0495598_0010775 | 3300046537 | Bacteria | 2199 |
| 650 | Ga0495598_0125703 | 3300046537 | Bacteria | 874 |
| 651 | Ga0495645_0045234 | 3300046543 | Bacteria | 3211 |
| 652 | Ga0495635_0237568 | 3300046663 | Unclassified | 1230 |
| 653 | Ga0495657_0750607 | 3300046675 | Bacteria | 559 |
| 654 | Ga0495599_0004897 | 3300046678 | Bacteria | 7958 |
| 655 | Ga0495599_0601455 | 3300046678 | Unclassified | 640 |
| 656 | Ga0495623_0019061 | 3300046679 | Bacteria | 4431 |
| 657 | Ga0495646_0036702 | 3300046680 | Bacteria | 3035 |
| 658 | Ga0495647_0118119 | 3300046681 | Bacteria | 1113 |
| 659 | Ga0495658_0430138 | 3300046683 | Bacteria | 842 |
| 660 | Ga0495669_0409574 | 3300046684 | Unclassified | 657 |
| 661 | Ga0495613_0554393 | 3300046689 | Unclassified | 769 |
| 662 | Ga0495674_0131634 | 3300047319 | Unclassified | 2107 |
| 663 | Ga0495675_0385879 | 3300047444 | Unclassified | 819 |
| 664 | Ga0495684_0468347 | 3300047471 | Unclassified | 872 |
| 665 | Ga0495602_0109967 | 3300048088 | Unclassified | 2241 |
| 666 | Ga0496100_0400199 | 3300048903 | Unclassified | 1046 |
| 667 | Ga0496100_0936292 | 3300048903 | Bacteria | 681 |
| 668 | Ga0496101_0653574 | 3300048904 | Unclassified | 831 |
| 669 | Ga0496101_0778471 | 3300048904 | Bacteria | 755 |
| 670 | Ga0496102_1918074 | 3300048905 | Unclassified | 509 |
| 671 | Ga0496104_0006921 | 3300048907 | Bacteria | 10003 |
| 672 | Ga0496104_0139892 | 3300048907 | Unclassified | 2326 |
| 673 | Ga0496104_0260287 | 3300048907 | Bacteria | 1648 |
| 674 | Ga0496104_0318593 | 3300048907 | Unclassified | 1468 |
| 675 | Ga0496104_0722131 | 3300048907 | Bacteria | 904 |
| 676 | Ga0496104_1688729 | 3300048907 | Bacteria | 536 |
| 677 | Ga0496105_0219406 | 3300048908 | Bacteria | 1548 |
| 678 | Ga0496105_1259673 | 3300048908 | Unclassified | 542 |
| 679 | Ga0496106_0537514 | 3300048909 | Bacteria | 938 |
| 680 | Ga0496106_0547716 | 3300048909 | Bacteria | 928 |
| 681 | Ga0496106_0765224 | 3300048909 | Unclassified | 767 |
| 682 | Ga0496107_1109788 | 3300048910 | Bacteria | 571 |
| 683 | Ga0496108_0216733 | 3300048911 | Unclassified | 1662 |
| 684 | Ga0496109_0023561 | 3300048912 | Bacteria | 5465 |
| 685 | Ga0496109_0250082 | 3300048912 | Bacteria | 1669 |
| 686 | Ga0496109_0259529 | 3300048912 | Bacteria | 1637 |
| 687 | Ga0496109_0489484 | 3300048912 | Bacteria | 1161 |
| 688 | Ga0496109_0968982 | 3300048912 | Unclassified | 788 |
| 689 | Ga0496109_1900248 | 3300048912 | Bacteria | 528 |
| 690 | Ga0496110_0107198 | 3300048913 | Bacteria | 2508 |
| 691 | Ga0496110_0147861 | 3300048913 | Bacteria | 2126 |
| 692 | Ga0496111_0774061 | 3300048914 | Bacteria | 695 |
| 693 | Ga0496112_0018854 | 3300048915 | Bacteria | 6500 |
| 694 | Ga0496112_0078067 | 3300048915 | Unclassified | 3275 |
| 695 | Ga0496112_0088355 | 3300048915 | Bacteria | 3067 |
| 696 | Ga0496112_0129908 | 3300048915 | Bacteria | 2490 |
| 697 | Ga0496112_0347944 | 3300048915 | Bacteria | 1425 |
| 698 | Ga0496112_0643235 | 3300048915 | Bacteria | 990 |
| 699 | Ga0496112_1184771 | 3300048915 | Unclassified | 681 |
| 700 | Ga0496112_1678687 | 3300048915 | Unclassified | 548 |
| 701 | Ga0496113_0058985 | 3300048916 | Bacteria | 2890 |
| 702 | Ga0496113_1131685 | 3300048916 | Bacteria | 613 |
| 703 | Ga0496114_0046176 | 3300048917 | Bacteria | 3619 |
| 704 | Ga0496114_0112717 | 3300048917 | Unclassified | 2331 |
| 705 | Ga0496115_0000936 | 3300048918 | Bacteria | 21169 |
| 706 | Ga0496115_0038615 | 3300048918 | Unclassified | 3789 |
| 707 | Ga0496115_0136797 | 3300048918 | Bacteria | 2020 |
| 708 | nmdc:mga0n895_1057861_c1 | 3300050512 | Bacteria | 790 |
| 709 | nmdc:mga0n895_1651941_c1 | 3300050512 | Unclassified | 604 |
| 710 | nmdc:mga0n895_1669061_c1 | 3300050512 | Bacteria | 600 |
| 711 | nmdc:mga0n895_586503_c1 | 3300050512 | Unclassified | 1118 |
| 712 | nmdc:mga0rr50_1256753_c1 | 3300050513 | Unclassified | 628 |
| 713 | nmdc:mga0rr50_240015_c1 | 3300050513 | Bacteria | 1502 |
| 714 | nmdc:mga0rr50_92627_c1 | 3300050513 | Unclassified | 2356 |
| 715 | nmdc:mga08x19_139377_c1 | 3300050514 | Bacteria | 1637 |
| 716 | nmdc:mga08x19_607403_c1 | 3300050514 | Unclassified | 775 |
| 717 | nmdc:mga08x19_844154_c1 | 3300050514 | Bacteria | 651 |
| 718 | Ga0495601_0011059 | 3300053077 | Bacteria | 5391 |
| 719 | Ga0587085_172813 | 3300059506 | Bacteria | 513 |
| 720 | Ga0065712_10035423 | |||
| 721 | CNXas_1000241 | |||
| 722 | JGI24743J22301_10015543 | |||
| 723 | JGI24750J21931_1026906 | |||
| 724 | JGI24035J26624_1001005 | |||
| 725 | JGI25406J46586_10000002 | |||
| 726 | JGI25406J46586_10037932 | |||
| 727 | JGI25405J52794_10000285 | |||
| 728 | Ga0065703_1019283 | |||
| 729 | Ga0065714_10018687 | |||
| 730 | Ga0065704_10005500 | |||
| 731 | Ga0065704_10024776 | |||
| 732 | Ga0065704_10031018 | |||
| 733 | Ga0065704_10166899 | |||
| 734 | Ga0065704_10441436 | |||
| 735 | Ga0065712_10070627 | |||
| 736 | Ga0065712_10147954 | |||
| 737 | Ga0065712_10367122 | |||
| 738 | Ga0065712_10552818 | |||
| 739 | Ga0065715_10003385 | |||
| 740 | Ga0065715_10045889 | |||
| 741 | Ga0065715_10165279 | |||
| 742 | Ga0065715_10222833 | |||
| 743 | Ga0065715_10308034 | |||
| 744 | Ga0065715_10315550 | |||
| 745 | Ga0065715_10462569 | |||
| 746 | Ga0065715_10653720 | |||
| 747 | Ga0070658_10124678 | |||
| 748 | Ga0070658_10206917 | |||
| 749 | Ga0070676_10111507 | |||
| 750 | Ga0070676_10365960 | |||
| 751 | Ga0070676_10945792 | |||
| 752 | Ga0070683_100086768 | |||
| 753 | Ga0070683_100256046 | |||
| 754 | Ga0070683_101088683 | |||
| 755 | Ga0070690_100056113 | |||
| 756 | Ga0070690_100061471 | |||
| 757 | Ga0070690_100063513 | |||
| 758 | Ga0070690_100301271 | |||
| 759 | Ga0070690_101626037 | |||
| 760 | Ga0070670_100045128 | |||
| 761 | Ga0070670_101520046 | |||
| 762 | Ga0070670_101710320 | |||
| 763 | Ga0070677_10584719 | |||
| 764 | Ga0070666_10003567 | |||
| 765 | Ga0070666_10030280 | |||
| 766 | Ga0070666_10534084 | |||
| 767 | Ga0070680_100159369 | |||
| 768 | Ga0068868_100043736 | |||
| 769 | Ga0068868_100103364 | |||
| 770 | Ga0068868_100245091 | |||
| 771 | Ga0068868_100728260 | |||
| 772 | Ga0070689_100011860 | |||
| 773 | Ga0070689_100241445 | |||
| 774 | Ga0070691_10411866 | |||
| 775 | Ga0070661_100010625 | |||
| 776 | Ga0070668_100342387 | |||
| 777 | Ga0070668_100435819 | |||
| 778 | Ga0070668_100532707 | |||
| 779 | Ga0070669_100219934 | |||
| 780 | Ga0070669_100295503 | |||
| 781 | Ga0070669_100477196 | |||
| 782 | Ga0070669_100496591 | |||
| 783 | Ga0070669_101334710 | |||
| 784 | Ga0070675_100003444 | |||
| 785 | Ga0070675_100044740 | |||
| 786 | Ga0070675_100069720 | |||
| 787 | Ga0070675_100160557 | |||
| 788 | Ga0070675_100398725 | |||
| 789 | Ga0070675_101344533 | |||
| 790 | Ga0070671_100009676 | |||
| 791 | Ga0070671_100053305 | |||
| 792 | Ga0070671_100134730 | |||
| 793 | Ga0070671_100165529 | |||
| 794 | Ga0070671_100209407 | |||
| 795 | Ga0070671_100403297 | |||
| 796 | Ga0070671_101554124 | |||
| 797 | Ga0070671_101688746 | |||
| 798 | Ga0070671_101861596 | |||
| 799 | Ga0070671_102052673 | |||
| 800 | Ga0070674_100055100 | |||
| 801 | Ga0070674_100279974 | |||
| 802 | Ga0070674_100606058 | |||
| 803 | Ga0070673_100012597 | |||
| 804 | Ga0070673_100014033 | |||
| 805 | Ga0070673_100024451 | |||
| 806 | Ga0070673_100426164 | |||
| 807 | Ga0070673_100733371 | |||
| 808 | Ga0070673_101082408 | |||
| 809 | Ga0070673_101358976 | |||
| 810 | Ga0070688_100073517 | |||
| 811 | Ga0070688_100258470 | |||
| 812 | Ga0070688_100283124 | |||
| 813 | Ga0070688_100607356 | |||
| 814 | Ga0070688_100929908 | |||
| 815 | Ga0070659_100581595 | |||
| 816 | Ga0070659_101027044 | |||
| 817 | Ga0070659_101464155 | |||
| 818 | Ga0070667_100010448 | |||
| 819 | Ga0070667_100253267 | |||
| 820 | Ga0070667_100517532 | |||
| 821 | Ga0070667_101529114 | |||
| 822 | Ga0070709_10112083 | |||
| 823 | Ga0070709_10627598 | |||
| 824 | Ga0070709_11477153 | |||
| 825 | Ga0070714_100054859 | |||
| 826 | Ga0070714_100174982 | |||
| 827 | Ga0070713_100035111 | |||
| 828 | Ga0070713_100075293 | |||
| 829 | Ga0070713_100544403 | |||
| 830 | Ga0070713_100641756 | |||
| 831 | Ga0070713_100832353 | |||
| 832 | Ga0070713_100946626 | |||
| 833 | Ga0070710_10505662 | |||
| 834 | Ga0070710_10761436 | |||
| 835 | Ga0070710_11182572 | |||
| 836 | Ga0070711_100042568 | |||
| 837 | Ga0070711_100043178 | |||
| 838 | Ga0070711_100056884 | |||
| 839 | Ga0070711_100778567 | |||
| 840 | Ga0070705_100135858 | |||
| 841 | Ga0070705_100324260 | |||
| 842 | Ga0070705_100327445 | |||
| 843 | Ga0070705_100426403 | |||
| 844 | Ga0070705_100485367 | |||
| 845 | Ga0070705_100505986 | |||
| 846 | Ga0070705_101187677 | |||
| 847 | Ga0070700_100622359 | |||
| 848 | Ga0070694_100615581 | |||
| 849 | Ga0070694_101000407 | |||
| 850 | Ga0070708_100067210 | |||
| 851 | Ga0070708_100166203 | |||
| 852 | Ga0070708_100175209 | |||
| 853 | Ga0070708_100183611 | |||
| 854 | Ga0070708_100298124 | |||
| 855 | Ga0070708_100684644 | |||
| 856 | Ga0070708_100768993 | |||
| 857 | Ga0070708_100807341 | |||
| 858 | Ga0070708_101076710 | |||
| 859 | Ga0070708_101193926 | |||
| 860 | Ga0070663_100776199 | |||
| 861 | Ga0070678_100027907 | |||
| 862 | Ga0070678_100110953 | |||
| 863 | Ga0070662_100009389 | |||
| 864 | Ga0070662_100055132 | |||
| 865 | Ga0070662_100135635 | |||
| 866 | Ga0070662_101182981 | |||
| 867 | Ga0070681_10919481 | |||
| 868 | Ga0068867_100257175 | |||
| 869 | Ga0068867_100286278 | |||
| 870 | Ga0068867_100540142 | |||
| 871 | Ga0068867_100544949 | |||
| 872 | Ga0068867_101818599 | |||
| 873 | Ga0070685_10004171 | |||
| 874 | Ga0070685_10126150 | |||
| 875 | Ga0070706_100000462 | |||
| 876 | Ga0070706_100008351 | |||
| 877 | Ga0070706_100010356 | |||
| 878 | Ga0070706_100010707 | |||
| 879 | Ga0070706_100015831 | |||
| 880 | Ga0070706_100052005 | |||
| 881 | Ga0070706_100052679 | |||
| 882 | Ga0070706_100057593 | |||
| 883 | Ga0070706_100100842 | |||
| 884 | Ga0070706_100185208 | |||
| 885 | Ga0070706_100266245 | |||
| 886 | Ga0070706_101298107 | |||
| 887 | Ga0070707_100000728 | |||
| 888 | Ga0070707_100020395 | |||
| 889 | Ga0070707_100031469 | |||
| 890 | Ga0070707_100033907 | |||
| 891 | Ga0070707_100071171 | |||
| 892 | Ga0070707_100098027 | |||
| 893 | Ga0070707_100145379 | |||
| 894 | Ga0070707_100192158 | |||
| 895 | Ga0070707_100890020 | |||
| 896 | Ga0070707_101427729 | |||
| 897 | Ga0070698_100001706 | |||
| 898 | Ga0070698_100013186 | |||
| 899 | Ga0070698_100044105 | |||
| 900 | Ga0070698_100315838 | |||
| 901 | Ga0070698_100909145 | |||
| 902 | Ga0070698_101398864 | |||
| 903 | Ga0070698_101445163 | |||
| 904 | Ga0070698_101697955 | |||
| 905 | Ga0070698_101960688 | |||
| 906 | Ga0070699_100151837 | |||
| 907 | Ga0070699_100165824 | |||
| 908 | Ga0070699_100204290 | |||
| 909 | Ga0070699_100358301 | |||
| 910 | Ga0070699_100385662 | |||
| 911 | Ga0070699_100843645 | |||
| 912 | Ga0070699_100868531 | |||
| 913 | Ga0070699_101365469 | |||
| 914 | Ga0070679_100038308 | |||
| 915 | Ga0070684_100843061 | |||
| 916 | Ga0070684_101233327 | |||
| 917 | Ga0070697_100005221 | |||
| 918 | Ga0070697_100007360 | |||
| 919 | Ga0070697_100007779 | |||
| 920 | Ga0070697_100009630 | |||
| 921 | Ga0070697_100011319 | |||
| 922 | Ga0070697_100028337 | |||
| 923 | Ga0070697_100031417 | |||
| 924 | Ga0070697_100033027 | |||
| 925 | Ga0070697_100126189 | |||
| 926 | Ga0070697_100149250 | |||
| 927 | Ga0070697_100189074 | |||
| 928 | Ga0070697_100250092 | |||
| 929 | Ga0070697_100287920 | |||
| 930 | Ga0070697_100297722 | |||
| 931 | Ga0070697_100475323 | |||
| 932 | Ga0070697_100837095 | |||
| 933 | Ga0070697_100991691 | |||
| 934 | Ga0070697_101552966 | |||
| 935 | Ga0068853_100992195 | |||
| 936 | Ga0068853_102108636 | |||
| 937 | Ga0070672_100122963 | |||
| 938 | Ga0070672_100451352 | |||
| 939 | Ga0070672_101283196 | |||
| 940 | Ga0070672_101647098 | |||
| 941 | Ga0070686_100042035 | |||
| 942 | Ga0070686_100253219 | |||
| 943 | Ga0070695_100034571 | |||
| 944 | Ga0070695_100172843 | |||
| 945 | Ga0070695_101864026 | |||
| 946 | Ga0070665_100020149 | |||
| 947 | Ga0070665_100381215 | |||
| 948 | Ga0070665_100849734 | |||
| 949 | Ga0070665_100894790 | |||
| 950 | Ga0070704_100836743 | |||
| 951 | Ga0070704_101050169 | |||
| 952 | Ga0070704_101759696 | |||
| 953 | Ga0070664_100527465 | |||
| 954 | Ga0070664_101466954 | |||
| 955 | Ga0070664_102147858 | |||
| 956 | Ga0068854_101180031 | |||
| 957 | Ga0068856_100115811 | |||
| 958 | Ga0068856_100394480 | |||
| 959 | Ga0070702_100216165 | |||
| 960 | Ga0068852_100234377 | |||
| 961 | Ga0068859_102424446 | |||
| 962 | Ga0068864_100323410 | |||
| 963 | Ga0068864_101334398 | |||
| 964 | Ga0068866_10279177 | |||
| 965 | Ga0068866_11062765 | |||
| 966 | Ga0068861_100553448 | |||
| 967 | Ga0068861_100582638 | |||
| 968 | Ga0068863_100355136 | |||
| 969 | Ga0068863_100396192 | |||
| 970 | Ga0068863_101170522 | |||
| 971 | Ga0068863_101802315 | |||
| 972 | Ga0068860_100121590 | |||
| 973 | Ga0068860_100375419 | |||
| 974 | Ga0068860_100623487 | |||
| 975 | Ga0068860_100656227 | |||
| 976 | Ga0068862_100010875 | |||
| 977 | Ga0068862_101378308 | |||
| 978 | Ga0081455_10000605 | |||
| 979 | Ga0081455_10483289 | |||
| 980 | Ga0081539_10000061 | |||
| 981 | Ga0081539_10039558 | |||
| 982 | Ga0070717_10000793 | |||
| 983 | Ga0070717_10032475 | |||
| 984 | Ga0070717_10061036 | |||
| 985 | Ga0070717_10098152 | |||
| 986 | Ga0070717_10811258 | |||
| 987 | Ga0070717_10881428 | |||
| 988 | Ga0070717_11056050 | |||
| 989 | Ga0070717_11421793 | |||
| 990 | Ga0070715_10075846 | |||
| 991 | Ga0070715_10137464 | |||
| 992 | Ga0070716_100082946 | |||
| 993 | Ga0070716_100141780 | |||
| 994 | Ga0070716_100145530 | |||
| 995 | Ga0070716_100290172 | |||
| 996 | Ga0070716_100542372 | |||
| 997 | Ga0070716_100583947 | |||
| 998 | Ga0070716_100668593 | |||
| 999 | Ga0070716_100672216 | |||
| 1000 | Ga0070716_100885376 | |||
| 1001 | Ga0070716_101720908 | |||
| 1002 | Ga0070712_100044644 | |||
| 1003 | Ga0070712_100227594 | |||
| 1004 | Ga0070712_100297323 | |||
| 1005 | Ga0070712_100460707 | |||
| 1006 | Ga0070712_101542674 | |||
| 1007 | Ga0097621_100074010 | |||
| 1008 | Ga0097621_100116993 | |||
| 1009 | Ga0097621_100118082 | |||
| 1010 | Ga0097621_100575944 | |||
| 1011 | Ga0097621_100787939 | |||
| 1012 | Ga0068871_100003837 | |||
| 1013 | Ga0068871_100020392 | |||
| 1014 | Ga0068871_100042536 | |||
| 1015 | Ga0068871_100131820 | |||
| 1016 | Ga0068871_100155565 | |||
| 1017 | Ga0068871_100211018 | |||
| 1018 | Ga0068871_100292348 | |||
| 1019 | Ga0068871_100484370 | |||
| 1020 | Ga0075433_10441720 | |||
| 1021 | Ga0075433_11453830 | |||
| 1022 | Ga0075434_100560806 | |||
| 1023 | Ga0075434_100576985 | |||
| 1024 | Ga0075434_101089345 | |||
| 1025 | Ga0075434_102168416 | |||
| 1026 | Ga0068865_100076037 | |||
| 1027 | Ga0068865_100625137 | |||
| 1028 | Ga0068865_100670402 | |||
| 1029 | Ga0068865_101614111 | |||
| 1030 | Ga0068865_101932700 | |||
| 1031 | Ga0075436_100016212 | |||
| 1032 | Ga0075436_100739511 | |||
| 1033 | Ga0097620_102424963 | |||
| 1034 | Ga0075435_100160743 | |||
| 1035 | Ga0075435_101380852 | |||
| 1036 | Ga0099794_10324607 | |||
| 1037 | Ga0099794_10646450 | |||
| 1038 | Ga0099795_10258692 | |||
| 1039 | Ga0105240_10320610 | |||
| 1040 | Ga0105240_10644133 | |||
| 1041 | Ga0105240_10897098 | |||
| 1042 | Ga0105245_10033057 | |||
| 1043 | Ga0105245_10063508 | |||
| 1044 | Ga0105245_10144502 | |||
| 1045 | Ga0105245_10302026 | |||
| 1046 | Ga0105245_10508295 | |||
| 1047 | Ga0105245_10574990 | |||
| 1048 | Ga0105245_10826161 | |||
| 1049 | Ga0105245_11123982 | |||
| 1050 | Ga0105243_10502073 | |||
| 1051 | Ga0105243_10547913 | |||
| 1052 | Ga0105241_10139170 | |||
| 1053 | Ga0105241_10327062 | |||
| 1054 | Ga0105241_10393980 | |||
| 1055 | Ga0105242_10814578 | |||
| 1056 | Ga0105248_10224471 | |||
| 1057 | Ga0105248_10267479 | |||
| 1058 | Ga0105249_10015800 | |||
| 1059 | Ga0105249_10131732 | |||
| 1060 | Ga0105249_11151957 | |||
| 1061 | Ga0099796_10028954 | |||
| 1062 | Ga0099796_10310070 | |||
| 1063 | Ga0099796_10450825 | |||
| 1064 | Ga0105239_10097798 | |||
| 1065 | Ga0105239_10437139 | |||
| 1066 | Ga0105246_11893941 | |||
| 1067 | Ga0157373_10147023 | |||
| 1068 | Ga0157373_10316208 | |||
| 1069 | Ga0157373_10816452 | |||
| 1070 | Ga0157371_10051633 | |||
| 1071 | Ga0157371_10067979 | |||
| 1072 | Ga0157371_10263146 | |||
| 1073 | Ga0157371_10471643 | |||
| 1074 | Ga0157369_10483435 | |||
| 1075 | Ga0157374_10010738 | |||
| 1076 | Ga0157374_10018747 | |||
| 1077 | Ga0157374_10025175 | |||
| 1078 | Ga0157374_10081760 | |||
| 1079 | Ga0157374_10084630 | |||
| 1080 | Ga0157374_10124764 | |||
| 1081 | Ga0157374_10232767 | |||
| 1082 | Ga0157374_10962735 | |||
| 1083 | Ga0157374_11301641 | |||
| 1084 | Ga0157374_11307949 | |||
| 1085 | Ga0157374_11686170 | |||
| 1086 | Ga0157374_11695638 | |||
| 1087 | Ga0157378_10005095 | |||
| 1088 | Ga0157378_10008102 | |||
| 1089 | Ga0157378_10026235 | |||
| 1090 | Ga0157378_10121134 | |||
| 1091 | Ga0157378_10128391 | |||
| 1092 | Ga0157378_10201688 | |||
| 1093 | Ga0157378_10561411 | |||
| 1094 | Ga0157378_11054333 | |||
| 1095 | Ga0157378_11073539 | |||
| 1096 | Ga0157378_11331913 | |||
| 1097 | Ga0157378_11360240 | |||
| 1098 | Ga0157378_11440526 | |||
| 1099 | Ga0157378_11599005 | |||
| 1100 | Ga0157378_11626570 | |||
| 1101 | Ga0157378_11896964 | |||
| 1102 | Ga0163162_10051213 | |||
| 1103 | Ga0163162_10069437 | |||
| 1104 | Ga0163162_10287231 | |||
| 1105 | Ga0163162_10354253 | |||
| 1106 | Ga0163162_11444327 | |||
| 1107 | Ga0157372_10052471 | |||
| 1108 | Ga0157372_10061027 | |||
| 1109 | Ga0157372_10705284 | |||
| 1110 | Ga0157372_10709422 | |||
| 1111 | Ga0157372_12547906 | |||
| 1112 | Ga0157375_10011380 | |||
| 1113 | Ga0157375_10017242 | |||
| 1114 | Ga0157375_10416502 | |||
| 1115 | Ga0157375_10604869 | |||
| 1116 | Ga0157375_11367831 | |||
| 1117 | Ga0157375_12003534 | |||
| 1118 | Ga0157375_13194001 | |||
| 1119 | Ga0163163_10252060 | |||
| 1120 | Ga0163163_10429858 | |||
| 1121 | Ga0163163_10986997 | |||
| 1122 | Ga0163163_11329433 | |||
| 1123 | Ga0157377_10203648 | |||
| 1124 | Ga0157377_10918835 | |||
| 1125 | Ga0157376_10106598 | |||
| 1126 | Ga0157376_10150305 | |||
| 1127 | Ga0157376_10170174 | |||
| 1128 | Ga0157376_10655472 | |||
| 1129 | Ga0182005_1104376 | |||
| 1130 | Ga0163161_10074147 | |||
| 1131 | Ga0163161_10139624 | |||
| 1132 | Ga0163161_11518959 | |||
| 1133 | Ga0207666_1000150 | |||
| 1134 | Ga0207666_1006112 | |||
| 1135 | Ga0207673_1000621 | |||
| 1136 | Ga0207673_1007118 | |||
| 1137 | Ga0207697_10001422 | |||
| 1138 | Ga0207697_10003870 | |||
| 1139 | Ga0207697_10006773 | |||
| 1140 | Ga0207697_10047679 | |||
| 1141 | Ga0207697_10084861 | |||
| 1142 | Ga0207692_10459930 | |||
| 1143 | Ga0207642_10123101 | |||
| 1144 | Ga0207688_10009510 | |||
| 1145 | Ga0207680_10014921 | |||
| 1146 | Ga0207680_10266870 | |||
| 1147 | Ga0207680_10725681 | |||
| 1148 | Ga0207680_11006048 | |||
| 1149 | Ga0207685_10119431 | |||
| 1150 | Ga0207699_10381963 | |||
| 1151 | Ga0207699_10832570 | |||
| 1152 | Ga0207645_10025467 | |||
| 1153 | Ga0207645_10106680 | |||
| 1154 | Ga0207645_10495354 | |||
| 1155 | Ga0207684_10000512 | |||
| 1156 | Ga0207684_10010267 | |||
| 1157 | Ga0207684_10010449 | |||
| 1158 | Ga0207684_10023670 | |||
| 1159 | Ga0207684_10027226 | |||
| 1160 | Ga0207684_10027382 | |||
| 1161 | Ga0207684_10035234 | |||
| 1162 | Ga0207684_10077287 | |||
| 1163 | Ga0207684_10091730 | |||
| 1164 | Ga0207684_10157817 | |||
| 1165 | Ga0207684_10403442 | |||
| 1166 | Ga0207684_10497928 | |||
| 1167 | Ga0207684_10543512 | |||
| 1168 | Ga0207707_10060789 | |||
| 1169 | Ga0207693_10005152 | |||
| 1170 | Ga0207693_10071160 | |||
| 1171 | Ga0207693_10171115 | |||
| 1172 | Ga0207693_11060434 | |||
| 1173 | Ga0207663_10051182 | |||
| 1174 | Ga0207663_10305321 | |||
| 1175 | Ga0207663_11295918 | |||
| 1176 | Ga0207660_11589837 | |||
| 1177 | Ga0207662_10005566 | |||
| 1178 | Ga0207657_10217301 | |||
| 1179 | Ga0207649_10013593 | |||
| 1180 | Ga0207652_10085397 | |||
| 1181 | Ga0207646_10000867 | |||
| 1182 | Ga0207646_10000886 | |||
| 1183 | Ga0207646_10001911 | |||
| 1184 | Ga0207646_10028991 | |||
| 1185 | Ga0207646_10048928 | |||
| 1186 | Ga0207646_10075291 | |||
| 1187 | Ga0207646_10118421 | |||
| 1188 | Ga0207646_10134257 | |||
| 1189 | Ga0207646_10263476 | |||
| 1190 | Ga0207646_10388751 | |||
| 1191 | Ga0207646_10802294 | |||
| 1192 | Ga0207646_10885102 | |||
| 1193 | Ga0207646_11274163 | |||
| 1194 | Ga0207681_10006232 | |||
| 1195 | Ga0207681_10144925 | |||
| 1196 | Ga0207681_10340735 | |||
| 1197 | Ga0207681_10458342 | |||
| 1198 | Ga0207650_10011747 | |||
| 1199 | Ga0207650_10202612 | |||
| 1200 | Ga0207650_10208472 | |||
| 1201 | Ga0207659_10011596 | |||
| 1202 | Ga0207659_10042534 | |||
| 1203 | Ga0207659_10117043 | |||
| 1204 | Ga0207659_10119018 | |||
| 1205 | Ga0207659_10125639 | |||
| 1206 | Ga0207659_11020964 | |||
| 1207 | Ga0207687_10069685 | |||
| 1208 | Ga0207687_10093261 | |||
| 1209 | Ga0207700_10136147 | |||
| 1210 | Ga0207700_11633520 | |||
| 1211 | Ga0207664_10025619 | |||
| 1212 | Ga0207664_10161884 | |||
| 1213 | Ga0207664_10541936 | |||
| 1214 | Ga0207644_10021191 | |||
| 1215 | Ga0207644_10080908 | |||
| 1216 | Ga0207644_10084189 | |||
| 1217 | Ga0207644_10498148 | |||
| 1218 | Ga0207644_10768883 | |||
| 1219 | Ga0207644_10847511 | |||
| 1220 | Ga0207690_10526212 | |||
| 1221 | Ga0207690_10811281 | |||
| 1222 | Ga0207706_10032204 | |||
| 1223 | Ga0207706_10102970 | |||
| 1224 | Ga0207706_10160946 | |||
| 1225 | Ga0207709_10155899 | |||
| 1226 | Ga0207670_10009592 | |||
| 1227 | Ga0207670_10096812 | |||
| 1228 | Ga0207670_10347868 | |||
| 1229 | Ga0207670_10453471 | |||
| 1230 | Ga0207670_11121801 | |||
| 1231 | Ga0207669_10093396 | |||
| 1232 | Ga0207669_10192430 | |||
| 1233 | Ga0207669_10683653 | |||
| 1234 | Ga0207669_10722205 | |||
| 1235 | Ga0207669_11032738 | |||
| 1236 | Ga0207665_10021136 | |||
| 1237 | Ga0207665_10165567 | |||
| 1238 | Ga0207665_10311650 | |||
| 1239 | Ga0207665_10384465 | |||
| 1240 | Ga0207665_10921774 | |||
| 1241 | Ga0207665_11126028 | |||
| 1242 | Ga0207665_11218260 | |||
| 1243 | Ga0207665_11547786 | |||
| 1244 | Ga0207691_10000359 | |||
| 1245 | Ga0207691_10075220 | |||
| 1246 | Ga0207691_11433563 | |||
| 1247 | Ga0207661_10090916 | |||
| 1248 | Ga0207661_10531814 | |||
| 1249 | Ga0207661_10870782 | |||
| 1250 | Ga0207679_11316427 | |||
| 1251 | Ga0207667_10963941 | |||
| 1252 | Ga0207651_10149221 | |||
| 1253 | Ga0207651_10629260 | |||
| 1254 | Ga0207651_10999334 | |||
| 1255 | Ga0207651_11700914 | |||
| 1256 | Ga0207712_10039324 | |||
| 1257 | Ga0207712_10139678 | |||
| 1258 | Ga0207668_10186759 | |||
| 1259 | Ga0207668_10858032 | |||
| 1260 | Ga0207658_10035809 | |||
| 1261 | Ga0207658_10184958 | |||
| 1262 | Ga0207658_10187878 | |||
| 1263 | Ga0207658_10420746 | |||
| 1264 | Ga0207658_10533203 | |||
| 1265 | Ga0207658_10709948 | |||
| 1266 | Ga0207677_10012800 | |||
| 1267 | Ga0207677_10032416 | |||
| 1268 | Ga0207677_10104574 | |||
| 1269 | Ga0207677_10213274 | |||
| 1270 | Ga0207677_10290147 | |||
| 1271 | Ga0207677_10648801 | |||
| 1272 | Ga0207639_11622282 | |||
| 1273 | Ga0207678_10186757 | |||
| 1274 | Ga0207702_10952218 | |||
| 1275 | Ga0207641_10277332 | |||
| 1276 | Ga0207641_11487080 | |||
| 1277 | Ga0207648_10053740 | |||
| 1278 | Ga0207648_10260120 | |||
| 1279 | Ga0207648_10699701 | |||
| 1280 | Ga0207648_11142771 | |||
| 1281 | Ga0207648_12259030 | |||
| 1282 | Ga0207676_11290866 | |||
| 1283 | Ga0207676_12334331 | |||
| 1284 | Ga0207675_100116214 | |||
| 1285 | Ga0207675_100185912 | |||
| 1286 | Ga0207675_100553452 | |||
| 1287 | Ga0207675_100943013 | |||
| 1288 | Ga0207683_10054108 | |||
| 1289 | Ga0207683_10110619 | |||
| 1290 | Ga0207683_10220382 | |||
| 1291 | Ga0207698_10253923 | |||
| 1292 | Ga0207698_10976081 | |||
| 1293 | Ga0209999_1104623 | |||
| 1294 | Ga0268266_10026192 | |||
| 1295 | Ga0268266_10163441 | |||
| 1296 | Ga0268266_10372233 | |||
| 1297 | Ga0268266_11011797 | |||
| 1298 | Ga0268265_10420602 | |||
| 1299 | Ga0268265_10620408 | |||
| 1300 | Ga0268264_10156009 | |||
| 1301 | Ga0268264_10773578 | |||
| 1302 | Ga0307513_10237415 | |||
| 1303 | Ga0373926_0081795 | |||
| 1304 | Ga0373944_0104186 | |||
| 1305 | Ga0373944_0317837 | |||
| 1306 | Ga0373932_0099119 | |||
| 1307 | Ga0373941_0196161 | |||
| 1308 | Ga0373945_0412041 | |||
| 1309 | Ga0373953_0157764 | |||
| 1310 | Ga0373956_0185313 | |||
| 1311 | Ga0373943_0011647 | |||
| 1312 | Ga0373943_0273691 | |||
| 1313 | Ga0373946_0114597 | |||
| 1314 | Ga0373955_0140957 | |||
| 1315 | Ga0373955_0472475 | |||
| 1316 | Ga0373955_0652165 | |||
| 1317 | Ga0373931_0120059 | |||
| 1318 | Ga0373935_0396526 | |||
| 1319 | Ga0373935_0505662 | |||
| 1320 | Ga0373927_0275893 | |||
| 1321 | Ga0373927_0645903 | |||
| 1322 | Ga0373933_0252295 | |||
| 1323 | Ga0373947_0019841 | |||
| 1324 | Ga0373947_0040731 | |||
| 1325 | Ga0373947_0095884 | |||
| 1326 | Ga0373947_0203470 | |||
| 1327 | Ga0373947_0549423 | |||
| 1328 | Ga0373947_0690081 | |||
| 1329 | Ga0373937_0066900 | |||
| 1330 | Ga0373937_0112204 | |||
| 1331 | Ga0373925_0138452 | |||
| 1332 | Ga0373925_0365882 | |||
| 1333 | Ga0395900_0107662 | |||
| 1334 | Ga0395900_0611620 | |||
| 1335 | Ga0395900_0631823 | |||
| 1336 | Ga0436364_0255257 | |||
| 1337 | Ga0395901_0040644 | |||
| 1338 | Ga0395901_0760335 | |||
| 1339 | Ga0436365_0391059 | |||
| 1340 | Ga0436363_0880421 | |||
| 1341 | Ga0436362_1306557 | |||
| 1342 | Ga0451798_0119280 | |||
| 1343 | Ga0451807_0923257 | |||
| 1344 | Ga0451845_0445642 | |||
| 1345 | Ga0451843_1244407 | |||
| 1346 | Ga0439451_120013 | |||
| 1347 | Ga0439454_003710 | |||
| 1348 | Ga0439455_0233245 | |||
| 1349 | Ga0439444_0087314 | |||
| 1350 | Ga0450893_0114469 | |||
| 1351 | Ga0439440_0036258 | |||
| 1352 | Ga0453683_0475341 | |||
| 1353 | Ga0451576_0022372 | |||
| 1354 | Ga0466967_2226260 | |||
| 1355 | Ga0495592_0006575 | |||
| 1356 | Ga0495651_0444449 | |||
| 1357 | Ga0495580_0834371 | |||
| 1358 | Ga0495580_0988009 | |||
| 1359 | Ga0495584_0134290 | |||
| 1360 | Ga0495584_0235004 | |||
| 1361 | Ga0495618_0146240 | |||
| 1362 | Ga0495628_0009686 | |||
| 1363 | Ga0495628_0704256 | |||
| 1364 | Ga0495628_1055922 | |||
| 1365 | Ga0495630_1394416 | |||
| 1366 | Ga0495652_0009726 | |||
| 1367 | Ga0495586_0381069 | |||
| 1368 | Ga0495598_0010775 | |||
| 1369 | Ga0495598_0125703 | |||
| 1370 | Ga0495645_0045234 | |||
| 1371 | Ga0495635_0237568 | |||
| 1372 | Ga0495657_0750607 | |||
| 1373 | Ga0495599_0004897 | |||
| 1374 | Ga0495599_0601455 | |||
| 1375 | Ga0495623_0019061 | |||
| 1376 | Ga0495646_0036702 | |||
| 1377 | Ga0495647_0118119 | |||
| 1378 | Ga0495658_0430138 | |||
| 1379 | Ga0495669_0409574 | |||
| 1380 | Ga0495613_0554393 | |||
| 1381 | Ga0495674_0131634 | |||
| 1382 | Ga0495675_0385879 | |||
| 1383 | Ga0495684_0468347 | |||
| 1384 | Ga0495602_0109967 | |||
| 1385 | Ga0496100_0400199 | |||
| 1386 | Ga0496100_0936292 | |||
| 1387 | Ga0496101_0653574 | |||
| 1388 | Ga0496101_0778471 | |||
| 1389 | Ga0496102_1918074 | |||
| 1390 | Ga0496104_0006921 | |||
| 1391 | Ga0496104_0139892 | |||
| 1392 | Ga0496104_0260287 | |||
| 1393 | Ga0496104_0318593 | |||
| 1394 | Ga0496104_0722131 | |||
| 1395 | Ga0496104_1688729 | |||
| 1396 | Ga0496105_0219406 | |||
| 1397 | Ga0496105_1259673 | |||
| 1398 | Ga0496106_0537514 | |||
| 1399 | Ga0496106_0547716 | |||
| 1400 | Ga0496106_0765224 | |||
| 1401 | Ga0496107_1109788 | |||
| 1402 | Ga0496108_0216733 | |||
| 1403 | Ga0496109_0023561 | |||
| 1404 | Ga0496109_0250082 | |||
| 1405 | Ga0496109_0259529 | |||
| 1406 | Ga0496109_0489484 | |||
| 1407 | Ga0496109_0968982 | |||
| 1408 | Ga0496109_1900248 | |||
| 1409 | Ga0496110_0107198 | |||
| 1410 | Ga0496110_0147861 | |||
| 1411 | Ga0496111_0774061 | |||
| 1412 | Ga0496112_0018854 | |||
| 1413 | Ga0496112_0078067 | |||
| 1414 | Ga0496112_0088355 | |||
| 1415 | Ga0496112_0129908 | |||
| 1416 | Ga0496112_0347944 | |||
| 1417 | Ga0496112_0643235 | |||
| 1418 | Ga0496112_1184771 | |||
| 1419 | Ga0496112_1678687 | |||
| 1420 | Ga0496113_0058985 | |||
| 1421 | Ga0496113_1131685 | |||
| 1422 | Ga0496114_0046176 | |||
| 1423 | Ga0496114_0112717 | |||
| 1424 | Ga0496115_0000936 | |||
| 1425 | Ga0496115_0038615 | |||
| 1426 | Ga0496115_0136797 | |||
| 1427 | nmdc:mga0n895_1057861_c1 | |||
| 1428 | nmdc:mga0n895_1651941_c1 | |||
| 1429 | nmdc:mga0n895_1669061_c1 | |||
| 1430 | nmdc:mga0n895_586503_c1 | |||
| 1431 | nmdc:mga0rr50_1256753_c1 | |||
| 1432 | nmdc:mga0rr50_240015_c1 | |||
| 1433 | nmdc:mga0rr50_92627_c1 | |||
| 1434 | nmdc:mga08x19_139377_c1 | |||
| 1435 | nmdc:mga08x19_607403_c1 | |||
| 1436 | nmdc:mga08x19_844154_c1 | |||
| 1437 | Ga0495601_0011059 | |||
| 1438 | Ga0587085_172813 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy