F477164

General Info

Members Datasets Scaffolds Average Seq Length
718 316 1436 268

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10205652|Ga0105239_102056522
Length 298
Sequence MSDLRIDLPLRRFAERGRVAGGSLGFPAMEAEDLGLDTDRDLQGVYRYYELAKRAEWQVRDLPWGEIAPIPEYSGSPQKLARRRDLWRSVITQQLQADELAVEMATQLFSIAPDHEAKLYYTTMVQDESRHTEAWLKLIAESGGMAERDPHLDRLARMTLDADTLEEKVFVMQVFYERLIIPRFRMIARSSRGTILEDLCNRLTIDDGIHHGAGMAYERVLLEGAGRGVHTKLIAAANQMLPVFTQHALWRPKAREFIGALMRETDIRMLKEDLEQGVRLARSLGIDVGDIELPAELH

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 7.8
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10205652 3300010375 Bacteria 2206
2 Ga0058863_11972964 3300004799 Bacteria 939
3 Ga0070658_10004765 3300005327 Bacteria 11035
4 Ga0070658_10141272 3300005327 Unclassified 2012
5 Ga0070658_10485368 3300005327 Bacteria 1066
6 Ga0070683_100027337 3300005329 Bacteria 5145
7 Ga0070683_100050164 3300005329 Bacteria 3862
8 Ga0070683_100101969 3300005329 Bacteria 2703
9 Ga0070683_100110700 3300005329 Bacteria 2590
10 Ga0070683_100206559 3300005329 Bacteria 1865
11 Ga0070680_100005763 3300005336 Bacteria 9398
12 Ga0070680_100156525 3300005336 Bacteria 1914
13 Ga0070680_100183912 3300005336 Archaea 1760
14 Ga0068868_100068586 3300005338 Archaea 2824
15 Ga0068868_100260239 3300005338 Bacteria 1463
16 Ga0070660_100001363 3300005339 Bacteria 16606
17 Ga0070660_100024109 3300005339 Bacteria 4513
18 Ga0070660_100039863 3300005339 Bacteria 3571
19 Ga0070660_100116416 3300005339 Bacteria 2131
20 Ga0070660_100186467 3300005339 Bacteria 1680
21 Ga0070689_100370653 3300005340 Bacteria 1205
22 Ga0070661_100113013 3300005344 Bacteria 2029
23 Ga0070692_10038517 3300005345 Bacteria 2437
24 Ga0070674_100074108 3300005356 Bacteria 2415
25 Ga0070674_100446954 3300005356 Bacteria 1066
26 Ga0070659_100035834 3300005366 Bacteria 3865
27 Ga0070659_100046644 3300005366 Bacteria 3397
28 Ga0070667_100193371 3300005367 Bacteria 1803
29 Ga0070709_10053812 3300005434 Bacteria 2535
30 Ga0070714_100112610 3300005435 Bacteria 2411
31 Ga0070710_10158296 3300005437 Bacteria 1402
32 Ga0070701_10109210 3300005438 Bacteria 1543
33 Ga0070711_100320321 3300005439 Bacteria 1238
34 Ga0070705_100567472 3300005440 Bacteria 873
35 Ga0070694_100203240 3300005444 Unclassified 1478
36 Ga0070708_100016662 3300005445 Bacteria 6106
37 Ga0070708_100071410 3300005445 Bacteria 3125
38 Ga0070708_100408321 3300005445 Bacteria 1281
39 Ga0070708_100427751 3300005445 Unclassified 1249
40 Ga0070663_100248669 3300005455 Bacteria 1406
41 Ga0070678_100084189 3300005456 Bacteria 2420
42 Ga0070678_100173152 3300005456 Bacteria 1760
43 Ga0070678_100222760 3300005456 Bacteria 1569
44 Ga0070662_100323530 3300005457 Unclassified 1258
45 Ga0070681_10000568 3300005458 Bacteria 30431
46 Ga0070681_10001517 3300005458 Bacteria 20575
47 Ga0070681_10036756 3300005458 Bacteria 4917
48 Ga0070681_10109041 3300005458 Bacteria 2709
49 Ga0070681_10212496 3300005458 Bacteria 1850
50 Ga0070681_10214587 3300005458 Unclassified 1841
51 Ga0070681_10248719 3300005458 Bacteria 1691
52 Ga0070706_100500434 3300005467 Bacteria 1131
53 Ga0070707_100010491 3300005468 Bacteria 8631
54 Ga0070707_100084210 3300005468 Bacteria 3072
55 Ga0070707_100161676 3300005468 Bacteria 2182
56 Ga0070698_100003138 3300005471 Bacteria 18207
57 Ga0070698_100255543 3300005471 Unclassified 1685
58 Ga0070699_100238776 3300005518 Unclassified 1621
59 Ga0070699_100391542 3300005518 Bacteria 1256
60 Ga0070679_100006546 3300005530 Bacteria 10858
61 Ga0070679_100016991 3300005530 Bacteria 7034
62 Ga0070679_100141564 3300005530 Bacteria 2384
63 Ga0070679_100234800 3300005530 Unclassified 1793
64 Ga0070679_100327157 3300005530 Bacteria 1481
65 Ga0070684_100024169 3300005535 Bacteria 5094
66 Ga0070684_100043239 3300005535 Bacteria 3889
67 Ga0070684_100065525 3300005535 Bacteria 3188
68 Ga0070684_100085591 3300005535 Unclassified 2796
69 Ga0070684_100094422 3300005535 Bacteria 2664
70 Ga0070684_100299747 3300005535 Bacteria 1475
71 Ga0070697_100119828 3300005536 Bacteria 2200
72 Ga0070686_100319123 3300005544 Unclassified 1158
73 Ga0070696_100028317 3300005546 Bacteria 3823
74 Ga0070665_100023734 3300005548 Bacteria 6177
75 Ga0070704_100032063 3300005549 Bacteria 3540
76 Ga0070704_100155329 3300005549 Bacteria 1804
77 Ga0070704_100522237 3300005549 Bacteria 1034
78 Ga0068855_100016986 3300005563 Bacteria 8752
79 Ga0068855_100049088 3300005563 Bacteria 4979
80 Ga0068855_100050501 3300005563 Archaea 4901
81 Ga0068855_100067944 3300005563 Bacteria 4151
82 Ga0068855_100089909 3300005563 Bacteria 3544
83 Ga0068855_100351002 3300005563 Bacteria 1625
84 Ga0070664_100161016 3300005564 Bacteria 1985
85 Ga0070664_100300751 3300005564 Bacteria 1450
86 Ga0068854_100154724 3300005578 Unclassified 1771
87 Ga0068856_100375908 3300005614 Unclassified 1440
88 Ga0070702_100068046 3300005615 Bacteria 2094
89 Ga0068852_100029065 3300005616 Bacteria 4535
90 Ga0068852_100137871 3300005616 Bacteria 2254
91 Ga0068852_100224496 3300005616 Bacteria 1788
92 Ga0068852_100633444 3300005616 Unclassified 1076
93 Ga0068864_100577624 3300005618 Unclassified 1089
94 Ga0068861_100301737 3300005719 Bacteria 1388
95 Ga0068870_10046637 3300005840 Bacteria 2274
96 Ga0068863_100510098 3300005841 Bacteria 1185
97 Ga0068858_100241538 3300005842 Bacteria 1714
98 Ga0068862_100151888 3300005844 Bacteria 2062
99 Ga0068862_100195026 3300005844 Unclassified 1824
100 Ga0081455_10004326 3300005937 Bacteria 15989
101 Ga0081455_10022328 3300005937 Bacteria 5917
102 Ga0081455_10053756 3300005937 Bacteria 3439
103 Ga0081455_10100202 3300005937 Bacteria 2328
104 Ga0081538_10064751 3300005981 Bacteria 2065
105 Ga0081540_1010951 3300005983 Bacteria 6091
106 Ga0081539_10005523 3300005985 Bacteria 12824
107 Ga0081539_10007543 3300005985 Bacteria 9853
108 Ga0070717_10196931 3300006028 Bacteria 1763
109 Ga0070717_10207394 3300006028 Bacteria 1719
110 Ga0070715_10016269 3300006163 Bacteria 2791
111 Ga0070716_100034368 3300006173 Bacteria 2779
112 Ga0070712_100036751 3300006175 Bacteria 3334
113 Ga0070712_100088083 3300006175 Bacteria 2267
114 Ga0070712_100269789 3300006175 Bacteria 1366
115 Ga0070712_100428510 3300006175 Unclassified 1097
116 Ga0075428_100033962 3300006844 Bacteria 5627
117 Ga0075428_100051185 3300006844 Bacteria 4529
118 Ga0075431_100165961 3300006847 Bacteria 2270
119 Ga0075434_100044743 3300006871 Bacteria 4390
120 Ga0075435_100070349 3300007076 Bacteria 2856
121 Ga0105250_10039888 3300009092 Bacteria 1883
122 Ga0105240_10021422 3300009093 Bacteria 8594
123 Ga0105240_10223201 3300009093 Bacteria 2194
124 Ga0105240_10249758 3300009093 Bacteria 2052
125 Ga0111539_10005856 3300009094 Bacteria 15887
126 Ga0111539_10010125 3300009094 Bacteria 11881
127 Ga0111539_10011388 3300009094 Bacteria 11166
128 Ga0111539_10029299 3300009094 Bacteria 6707
129 Ga0105245_10334441 3300009098 Unclassified 1496
130 Ga0105245_10703291 3300009098 Bacteria 1044
131 Ga0105247_10240089 3300009101 Bacteria 1234
132 Ga0114129_10058515 3300009147 Bacteria 5390
133 Ga0114129_10064758 3300009147 Bacteria 5101
134 Ga0114129_10136272 3300009147 Bacteria 3368
135 Ga0114129_10254041 3300009147 Bacteria 2358
136 Ga0114129_10517383 3300009147 Bacteria 1556
137 Ga0114129_10602776 3300009147 Bacteria 1423
138 Ga0105242_10046730 3300009176 Bacteria 3513
139 Ga0105242_10338947 3300009176 Unclassified 1385
140 Ga0105242_10691359 3300009176 Bacteria 997
141 Ga0105248_10399940 3300009177 Bacteria 1547
142 Ga0105237_10062693 3300009545 Bacteria 3717
143 Ga0105238_10033143 3300009551 Bacteria 5256
144 Ga0105238_10111035 3300009551 Bacteria 2722
145 Ga0105249_10152789 3300009553 Bacteria 2224
146 Ga0105249_10203964 3300009553 Unclassified 1936
147 Ga0105249_10248125 3300009553 Bacteria 1763
148 Ga0105239_10133101 3300010375 Bacteria 2767
149 Ga0105239_10341078 3300010375 Bacteria 1691
150 Ga0105239_10575954 3300010375 Unclassified 1283
151 Ga0157371_10429976 3300013102 Unclassified 969
152 Ga0157370_10016279 3300013104 Bacteria 7534
153 Ga0157370_10097764 3300013104 Bacteria 2754
154 Ga0157370_10144874 3300013104 Bacteria 2212
155 Ga0157370_10190051 3300013104 Bacteria 1906
156 Ga0157370_10205317 3300013104 Bacteria 1827
157 Ga0157369_10001416 3300013105 Bacteria 29494
158 Ga0157369_10017845 3300013105 Bacteria 7966
159 Ga0157369_10051321 3300013105 Bacteria 4463
160 Ga0157369_10286545 3300013105 Bacteria 1715
161 Ga0157369_10334865 3300013105 Bacteria 1572
162 Ga0157369_10445738 3300013105 Unclassified 1341
163 Ga0157374_10048009 3300013296 Bacteria 3960
164 Ga0157374_10525385 3300013296 Bacteria 1190
165 Ga0157378_10103510 3300013297 Archaea 2601
166 Ga0157372_10152133 3300013307 Bacteria 2671
167 Ga0157372_10270280 3300013307 Bacteria 1975
168 Ga0157375_11329889 3300013308 Unclassified 845
169 Ga0157380_10025891 3300014326 Bacteria 4451
170 Ga0157379_10120272 3300014968 Bacteria 2362
171 Ga0157376_10177205 3300014969 Bacteria 1945
172 Ga0163161_10178180 3300017792 Unclassified 1628
173 Ga0197907_10672060 3300020069 Bacteria 1428
174 Ga0197907_11289452 3300020069 Bacteria 1519
175 Ga0206356_10249027 3300020070 Bacteria 2429
176 Ga0206356_11002235 3300020070 Bacteria 2365
177 Ga0206356_11771681 3300020070 Bacteria 3281
178 Ga0206355_1120413 3300020076 Unclassified 1165
179 Ga0206354_10148756 3300020081 Unclassified 1372
180 Ga0206353_10409533 3300020082 Bacteria 2132
181 Ga0206353_10667668 3300020082 Unclassified 1643
182 Ga0206353_10850478 3300020082 Bacteria 6381
183 Ga0206353_10875716 3300020082 Bacteria 6509
184 Ga0154015_1542097 3300020610 Bacteria 1119
185 Ga0213876_10182906 3300021384 Unclassified 1115
186 Ga0207653_10004076 3300025885 Bacteria 4596
187 Ga0207692_10057117 3300025898 Bacteria 2005
188 Ga0207692_10238673 3300025898 Unclassified 1085
189 Ga0207688_10004395 3300025901 Bacteria 7673
190 Ga0207643_10011529 3300025908 Bacteria 4774
191 Ga0207705_10039721 3300025909 Bacteria 3373
192 Ga0207705_10044602 3300025909 Bacteria 3186
193 Ga0207705_10063843 3300025909 Bacteria 2661
194 Ga0207705_10157391 3300025909 Unclassified 1705
195 Ga0207684_10090447 3300025910 Bacteria 2608
196 Ga0207684_10133837 3300025910 Bacteria 2128
197 Ga0207684_10203998 3300025910 Bacteria 1706
198 Ga0207684_10432324 3300025910 Bacteria 1131
199 Ga0207654_10138518 3300025911 Bacteria 1549
200 Ga0207707_10002326 3300025912 Bacteria 17116
201 Ga0207707_10014539 3300025912 Bacteria 6855
202 Ga0207707_10067104 3300025912 Archaea 3125
203 Ga0207707_10094537 3300025912 Bacteria 2611
204 Ga0207707_10105274 3300025912 Bacteria 2466
205 Ga0207707_10112439 3300025912 Bacteria 2381
206 Ga0207693_10002056 3300025915 Bacteria 17601
207 Ga0207663_10061187 3300025916 Bacteria 2388
208 Ga0207663_10069533 3300025916 Unclassified 2265
209 Ga0207663_10292035 3300025916 Bacteria 1215
210 Ga0207660_10111565 3300025917 Bacteria 2058
211 Ga0207660_10205137 3300025917 Bacteria 1541
212 Ga0207662_10060958 3300025918 Bacteria 2264
213 Ga0207657_10000331 3300025919 Bacteria 50115
214 Ga0207657_10007492 3300025919 Bacteria 11185
215 Ga0207657_10037460 3300025919 Bacteria 4329
216 Ga0207657_10165974 3300025919 Bacteria 1791
217 Ga0207649_10107427 3300025920 Bacteria 1858
218 Ga0207652_10007548 3300025921 Bacteria 8757
219 Ga0207652_10023727 3300025921 Bacteria 5084
220 Ga0207652_10031089 3300025921 Bacteria 4480
221 Ga0207652_10046367 3300025921 Bacteria 3708
222 Ga0207652_10244967 3300025921 Unclassified 1616
223 Ga0207646_10002821 3300025922 Bacteria 20211
224 Ga0207646_10086109 3300025922 Unclassified 2811
225 Ga0207646_10123767 3300025922 Bacteria 2324
226 Ga0207646_10245698 3300025922 Unclassified 1617
227 Ga0207700_10154794 3300025928 Bacteria 1898
228 Ga0207700_10330494 3300025928 Bacteria 1323
229 Ga0207664_10411948 3300025929 Bacteria 1203
230 Ga0207706_10052787 3300025933 Bacteria 3589
231 Ga0207706_10091667 3300025933 Bacteria 2672
232 Ga0207709_10039217 3300025935 Bacteria 2828
233 Ga0207709_10208895 3300025935 Unclassified 1400
234 Ga0207670_10024520 3300025936 Bacteria 3771
235 Ga0207704_10188495 3300025938 Unclassified 1498
236 Ga0207665_10020792 3300025939 Bacteria 4315
237 Ga0207689_10198934 3300025942 Unclassified 1654
238 Ga0207661_10017520 3300025944 Bacteria 5304
239 Ga0207661_10050866 3300025944 Bacteria 3304
240 Ga0207661_10168478 3300025944 Bacteria 1905
241 Ga0207661_10224762 3300025944 Bacteria 1660
242 Ga0207661_10288400 3300025944 Bacteria 1468
243 Ga0207679_10529355 3300025945 Bacteria 1055
244 Ga0207667_10127836 3300025949 Bacteria 2617
245 Ga0207667_10171349 3300025949 Bacteria 2231
246 Ga0207667_10202628 3300025949 Bacteria 2035
247 Ga0207667_10276277 3300025949 Bacteria 1717
248 Ga0207667_10309772 3300025949 Archaea 1613
249 Ga0207667_10632783 3300025949 Unclassified 1077
250 Ga0207712_10211403 3300025961 Unclassified 1545
251 Ga0207640_10048646 3300025981 Bacteria 2742
252 Ga0207658_10066502 3300025986 Bacteria 2711
253 Ga0207677_10152144 3300026023 Bacteria 1787
254 Ga0207703_10075577 3300026035 Bacteria 2792
255 Ga0207678_10229610 3300026067 Bacteria 1589
256 Ga0207708_10106658 3300026075 Bacteria 2172
257 Ga0207708_10323231 3300026075 Bacteria 1260
258 Ga0207702_10189255 3300026078 Bacteria 1900
259 Ga0207641_10617967 3300026088 Bacteria 1062
260 Ga0207674_10113718 3300026116 Bacteria 2679
261 Ga0207675_100023645 3300026118 Bacteria 5716
262 Ga0207675_100174178 3300026118 Bacteria 2058
263 Ga0207683_10077641 3300026121 Bacteria 2941
264 Ga0207698_10430687 3300026142 Bacteria 1268
265 Ga0207428_10064900 3300027907 Bacteria 2882
266 Ga0207428_10123483 3300027907 Unclassified 1984
267 Ga0207428_10270014 3300027907 Bacteria 1265
268 Ga0268265_10199209 3300028380 Bacteria 1736
269 Ga0268265_10319183 3300028380 Unclassified 1406
270 Ga0268264_10580102 3300028381 Bacteria 1103
271 Ga0265318_10068149 3300028577 Bacteria 1320
272 Ga0265338_10048183 3300028800 Bacteria 3880
273 Ga0265330_10061397 3300031235 Bacteria 1635
274 Ga0265339_10052350 3300031249 Bacteria 2224
275 Ga0265327_10020702 3300031251 Bacteria 3996
276 Ga0265316_10080186 3300031344 Bacteria 2503
277 Ga0307408_100116923 3300031548 Bacteria 2059
278 Ga0265313_10025499 3300031595 Bacteria 3131
279 Ga0265314_10007254 3300031711 Bacteria 9631
280 Ga0265342_10063214 3300031712 Bacteria 2176
281 Ga0307405_10006258 3300031731 Bacteria 5839
282 Ga0307405_10069514 3300031731 Bacteria 2258
283 Ga0307405_10097403 3300031731 Bacteria 1964
284 Ga0307405_10311084 3300031731 Bacteria 1199
285 Ga0307410_10006439 3300031852 Bacteria 6337
286 Ga0307410_10388948 3300031852 Bacteria 1124
287 Ga0307406_10155230 3300031901 Bacteria 1638
288 Ga0307406_10472807 3300031901 Unclassified 1010
289 Ga0307407_10115005 3300031903 Unclassified 1695
290 Ga0307412_10016331 3300031911 Bacteria 4421
291 Ga0307412_10264840 3300031911 Bacteria 1342
292 Ga0307409_100039272 3300031995 Bacteria 3510
293 Ga0307409_100096010 3300031995 Bacteria 2444
294 Ga0307416_100083345 3300032002 Bacteria 2712
295 Ga0307416_100170118 3300032002 Bacteria 2027
296 Ga0307416_100243881 3300032002 Bacteria 1743
297 Ga0307414_10492618 3300032004 Unclassified 1083
298 Ga0307411_10052108 3300032005 Bacteria 2674
299 Ga0307415_100007518 3300032126 Bacteria 5965
300 Ga0307415_100040998 3300032126 Bacteria 3071
301 Ga0307415_100304675 3300032126 Bacteria 1321
302 Ga0373948_0001620 3300034817 Bacteria 3172
303 Ga0373926_0032926 3300035083 Bacteria 1830
304 Ga0373926_0035784 3300035083 Bacteria 1762
305 Ga0373944_0007792 3300035089 Bacteria 2879
306 Ga0373949_0019618 3300035090 Unclassified 1541
307 Ga0373951_0002727 3300035091 Bacteria 4421
308 Ga0373936_0014314 3300035113 Bacteria 3029
309 Ga0373941_0011974 3300035115 Unclassified 2255
310 Ga0373945_0003422 3300035116 Bacteria 4992
311 Ga0373945_0013486 3300035116 Bacteria 2728
312 Ga0373954_0084119 3300035118 Bacteria 1523
313 Ga0373956_0050165 3300035119 Bacteria 1873
314 Ga0373957_0053652 3300035120 Bacteria 1547
315 Ga0373960_0011429 3300035121 Unclassified 2187
316 Ga0373943_0000896 3300035170 Bacteria 13120
317 Ga0373943_0003423 3300035170 Bacteria 7229
318 Ga0373943_0012785 3300035170 Bacteria 3784
319 Ga0373946_0005596 3300035171 Bacteria 4536
320 Ga0373946_0062301 3300035171 Bacteria 1590
321 Ga0373955_0073204 3300035172 Bacteria 1920
322 Ga0373942_0002046 3300035207 Bacteria 5013
323 Ga0373961_0084766 3300035241 Unclassified 1002
324 Ga0373962_0012237 3300035242 Bacteria 2159
325 Ga0373931_0004257 3300035691 Bacteria 6514
326 Ga0373935_0014820 3300035692 Bacteria 4707
327 Ga0373935_0179712 3300035692 Bacteria 1452
328 Ga0373947_0012053 3300035725 Bacteria 4951
329 Ga0373947_0026069 3300035725 Bacteria 3412
330 Ga0373947_0144032 3300035725 Bacteria 1530
331 Ga0373937_0047884 3300036401 Bacteria 3912
332 Ga0373925_0001681 3300037068 Bacteria 18616
333 Ga0373925_0008347 3300037068 Bacteria 7541
334 Ga0395899_0000727 3300037312 Bacteria 32895
335 Ga0395899_0018343 3300037312 Bacteria 5318
336 Ga0395899_0025523 3300037312 Bacteria 4460
337 Ga0395899_0031204 3300037312 Bacteria 4005
338 Ga0395899_0038751 3300037312 Bacteria 3568
339 Ga0395899_0174170 3300037312 Bacteria 1514
340 Ga0395900_0005981 3300037418 Bacteria 12702
341 Ga0395900_0006517 3300037418 Bacteria 12165
342 Ga0395900_0011622 3300037418 Bacteria 9009
343 Ga0395900_0023255 3300037418 Bacteria 6343
344 Ga0395900_0023967 3300037418 Bacteria 6244
345 Ga0395900_0046407 3300037418 Bacteria 4474
346 Ga0395900_0051599 3300037418 Bacteria 4236
347 Ga0395900_0060520 3300037418 Bacteria 3897
348 Ga0395900_0119757 3300037418 Bacteria 2701
349 Ga0395900_0154041 3300037418 Bacteria 2348
350 Ga0395900_0160386 3300037418 Bacteria 2294
351 Ga0395900_0294349 3300037418 Bacteria 1611
352 Ga0395900_0355165 3300037418 Bacteria 1438
353 Ga0395898_0007522 3300037466 Bacteria 11578
354 Ga0395898_0022336 3300037466 Bacteria 6407
355 Ga0395898_0045062 3300037466 Bacteria 4336
356 Ga0395898_0067737 3300037466 Bacteria 3455
357 Ga0395898_0070596 3300037466 Bacteria 3376
358 Ga0395898_0082474 3300037466 Bacteria 3099
359 Ga0395898_0116146 3300037466 Bacteria 2564
360 Ga0395898_0204673 3300037466 Bacteria 1883
361 Ga0395898_0296706 3300037466 Bacteria 1542
362 Ga0395898_0439523 3300037466 Bacteria 1243
363 Ga0395905_0002457 3300037471 Bacteria 20517
364 Ga0395905_0010592 3300037471 Bacteria 8953
365 Ga0395905_0028622 3300037471 Bacteria 5252
366 Ga0395905_0032610 3300037471 Bacteria 4898
367 Ga0395905_0037496 3300037471 Bacteria 4550
368 Ga0395905_0046598 3300037471 Bacteria 4065
369 Ga0395905_0053398 3300037471 Bacteria 3782
370 Ga0395905_0063264 3300037471 Bacteria 3462
371 Ga0395905_0172691 3300037471 Bacteria 2030
372 Ga0395905_0282512 3300037471 Bacteria 1546
373 Ga0395905_0317863 3300037471 Bacteria 1446
374 Ga0395905_0610102 3300037471 Bacteria 993
375 Ga0395901_0003418 3300038443 Bacteria 15999
376 Ga0395901_0007676 3300038443 Bacteria 10880
377 Ga0395901_0009332 3300038443 Bacteria 9946
378 Ga0395901_0009579 3300038443 Bacteria 9830
379 Ga0395901_0011618 3300038443 Bacteria 8919
380 Ga0395901_0012040 3300038443 Bacteria 8775
381 Ga0395901_0013640 3300038443 Bacteria 8263
382 Ga0395901_0014388 3300038443 Bacteria 8053
383 Ga0395901_0015943 3300038443 Bacteria 7654
384 Ga0395901_0020472 3300038443 Bacteria 6770
385 Ga0395901_0032261 3300038443 Bacteria 5404
386 Ga0395901_0058602 3300038443 Bacteria 4005
387 Ga0395901_0062685 3300038443 Bacteria 3869
388 Ga0395901_0066779 3300038443 Bacteria 3745
389 Ga0395901_0072874 3300038443 Bacteria 3581
390 Ga0395901_0104240 3300038443 Bacteria 2976
391 Ga0395901_0113815 3300038443 Bacteria 2841
392 Ga0395901_0184873 3300038443 Bacteria 2186
393 Ga0436365_0152440 3300039437 Bacteria 1268
394 Ga0436365_1603605 3300039437 Bacteria 3728
395 Ga0439451_001447 3300042009 Bacteria 4691
396 Ga0439458_0002517 3300042157 Bacteria 4446
397 Ga0450918_006233 3300042531 Bacteria 2130
398 Ga0466969_0036211 3300044656 Bacteria 2494
399 Ga0466965_0024340 3300044683 Bacteria 2928
400 Ga0466965_0213116 3300044683 Unclassified 1027
401 Ga0466966_0004783 3300044684 Bacteria 8909
402 Ga0466966_0015008 3300044684 Bacteria 5125
403 Ga0466961_0003118 3300044693 Bacteria 10313
404 Ga0466961_0009477 3300044693 Bacteria 6202
405 Ga0466961_0069788 3300044693 Bacteria 2230
406 Ga0466963_0002364 3300044694 Bacteria 10534
407 Ga0466963_0010083 3300044694 Bacteria 5712
408 Ga0466963_0034714 3300044694 Bacteria 3283
409 Ga0466963_0073576 3300044694 Bacteria 2304
410 Ga0466963_0075203 3300044694 Bacteria 2279
411 Ga0466963_0079497 3300044694 Bacteria 2218
412 Ga0466963_0113336 3300044694 Bacteria 1862
413 Ga0466963_0142401 3300044694 Viruses 1661
414 Ga0466963_0321393 3300044694 Bacteria 1089
415 Ga0466963_0380074 3300044694 Bacteria 995
416 Ga0466964_0000962 3300044706 Bacteria 9518
417 Ga0466964_0008547 3300044706 Bacteria 3848
418 Ga0466964_0198219 3300044706 Bacteria 962
419 Ga0466971_0026919 3300044719 Bacteria 2573
420 Ga0466968_0092963 3300044735 Bacteria 1339
421 Ga0466970_0055482 3300044765 Bacteria 2116
422 Ga0466970_0059078 3300044765 Unclassified 2054
423 Ga0466970_0149514 3300044765 Unclassified 1289
424 Ga0466957_0014153 3300044842 Bacteria 4641
425 Ga0466957_0026965 3300044842 Bacteria 3411
426 Ga0466957_0039452 3300044842 Bacteria 2849
427 Ga0466960_0101967 3300044901 Bacteria 1479
428 Ga0466959_0005640 3300045049 Bacteria 8611
429 Ga0466959_0007161 3300045049 Bacteria 7807
430 Ga0466959_0023477 3300045049 Bacteria 4564
431 Ga0466959_0120779 3300045049 Bacteria 1863
432 Ga0466959_0234141 3300045049 Bacteria 1270
433 Ga0451576_0425039 3300045051 Bacteria 1394
434 Ga0451576_0480834 3300045051 Unclassified 1304
435 Ga0466958_0006317 3300045836 Bacteria 6440
436 Ga0466958_0011009 3300045836 Bacteria 5085
437 Ga0466958_0029630 3300045836 Bacteria 3248
438 Ga0466958_0085286 3300045836 Bacteria 1948
439 Ga0466958_0124907 3300045836 Bacteria 1613
440 Ga0466967_0000274 3300045976 Bacteria 22748
441 Ga0466967_0004211 3300045976 Bacteria 9644
442 Ga0466967_0012534 3300045976 Bacteria 6491
443 Ga0466967_0101630 3300045976 Bacteria 2628
444 Ga0466967_0143139 3300045976 Bacteria 2228
445 Ga0466967_0235771 3300045976 Bacteria 1744
446 Ga0495592_0126513 3300046454 Bacteria 1792
447 Ga0495592_0252611 3300046454 Bacteria 1164
448 Ga0495629_0009665 3300046459 Bacteria 7044
449 Ga0495629_0027009 3300046459 Bacteria 4077
450 Ga0495641_0011337 3300046461 Bacteria 5088
451 Ga0495641_0027081 3300046461 Bacteria 2791
452 Ga0495651_0031660 3300046462 Bacteria 4124
453 Ga0495651_0086137 3300046462 Unclassified 2364
454 Ga0495653_0025779 3300046463 Bacteria 4717
455 Ga0495653_0028795 3300046463 Bacteria 4440
456 Ga0495653_0112838 3300046463 Bacteria 1950
457 Ga0495582_0000050 3300046473 Bacteria 59164
458 Ga0495582_0135719 3300046473 Bacteria 1392
459 Ga0495605_0092506 3300046474 Bacteria 1400
460 Ga0495605_0141309 3300046474 Bacteria 1080
461 Ga0495639_0001750 3300046475 Bacteria 9636
462 Ga0495662_0004271 3300046476 Bacteria 7186
463 Ga0495664_0054505 3300046477 Bacteria 2378
464 Ga0495664_0105999 3300046477 Unclassified 1695
465 Ga0495664_0180185 3300046477 Bacteria 1281
466 Ga0495594_0057551 3300046499 Bacteria 2147
467 Ga0495596_0043683 3300046500 Bacteria 1766
468 Ga0495607_0122319 3300046501 Bacteria 1364
469 Ga0495608_0001715 3300046511 Bacteria 15720
470 Ga0495608_0013267 3300046511 Bacteria 5717
471 Ga0495616_0055272 3300046513 Bacteria 1966
472 Ga0495618_0042286 3300046514 Bacteria 2872
473 Ga0495618_0126144 3300046514 Unclassified 1639
474 Ga0495618_0206067 3300046514 Unclassified 1244
475 Ga0495628_0035111 3300046516 Bacteria 4031
476 Ga0495628_0195811 3300046516 Bacteria 1525
477 Ga0495630_0009961 3300046517 Bacteria 6843
478 Ga0495630_0077032 3300046517 Unclassified 2513
479 Ga0495643_0180867 3300046522 Bacteria 1025
480 Ga0495663_0004137 3300046525 Bacteria 4104
481 Ga0495666_0024194 3300046526 Bacteria 3001
482 Ga0495666_0084513 3300046526 Unclassified 1499
483 Ga0495652_0238094 3300046529 Bacteria 1356
484 Ga0495665_0044867 3300046531 Unclassified 2348
485 Ga0495640_0005917 3300046533 Bacteria 9697
486 Ga0495640_0023452 3300046533 Bacteria 4494
487 Ga0495640_0097540 3300046533 Bacteria 1932
488 Ga0495597_0034082 3300046542 Bacteria 2302
489 Ga0495645_0054213 3300046543 Bacteria 2914
490 Ga0495645_0109769 3300046543 Bacteria 1953
491 Ga0495667_0007872 3300046559 Bacteria 7223
492 Ga0495667_0033197 3300046559 Bacteria 3454
493 Ga0495667_0048616 3300046559 Unclassified 2800
494 Ga0495667_0180588 3300046559 Unclassified 1354
495 Ga0495634_0009879 3300046642 Bacteria 7018
496 Ga0495634_0016648 3300046642 Bacteria 5254
497 Ga0495634_0075449 3300046642 Bacteria 2214
498 Ga0495611_0113015 3300046648 Bacteria 1265
499 Ga0495635_0011303 3300046663 Bacteria 6262
500 Ga0495659_0029846 3300046664 Bacteria 1895
501 Ga0495657_0048654 3300046675 Bacteria 2859
502 Ga0495657_0078052 3300046675 Bacteria 2147
503 Ga0495599_0028024 3300046678 Bacteria 3529
504 Ga0495599_0055552 3300046678 Unclassified 2479
505 Ga0495646_0035446 3300046680 Bacteria 3095
506 Ga0495658_0000020 3300046683 Bacteria 87200
507 Ga0495658_0194097 3300046683 Bacteria 1263
508 Ga0495658_0214598 3300046683 Unclassified 1203
509 Ga0495669_0057228 3300046684 Bacteria 1759
510 Ga0495613_0009224 3300046689 Bacteria 7316
511 Ga0495624_0112428 3300046690 Bacteria 1674
512 Ga0495670_0052006 3300046691 Bacteria 2050
513 Ga0495589_0064836 3300046794 Bacteria 1791
514 Ga0495600_0074456 3300046809 Bacteria 2217
515 Ga0495600_0124381 3300046809 Unclassified 1677
516 Ga0495581_0009383 3300047315 Bacteria 5662
517 Ga0495581_0162157 3300047315 Bacteria 1307
518 Ga0495604_0096696 3300047317 Bacteria 2178
519 Ga0495604_0105022 3300047317 Bacteria 2068
520 Ga0495604_0114215 3300047317 Bacteria 1964
521 Ga0495674_0001037 3300047319 Bacteria 26704
522 Ga0495674_0025803 3300047319 Bacteria 5382
523 Ga0495674_0041714 3300047319 Bacteria 4097
524 Ga0495674_0217454 3300047319 Bacteria 1581
525 Ga0495676_0000506 3300047321 Bacteria 31895
526 Ga0495676_0035591 3300047321 Bacteria 4163
527 Ga0495680_0002190 3300047322 Bacteria 20224
528 Ga0495680_0092950 3300047322 Bacteria 2258
529 Ga0495680_0202417 3300047322 Bacteria 1424
530 Ga0495683_0087730 3300047323 Bacteria 1511
531 Ga0495675_0069998 3300047444 Bacteria 2215
532 Ga0495675_0082335 3300047444 Unclassified 2026
533 Ga0495681_0084052 3300047470 Unclassified 1416
534 Ga0495684_0004005 3300047471 Bacteria 11492
535 Ga0495684_0020811 3300047471 Bacteria 5055
536 Ga0495684_0080790 3300047471 Bacteria 2468
537 Ga0495684_0298972 3300047471 Bacteria 1157
538 Ga0495593_0084994 3300047673 Bacteria 1633
539 Ga0495593_0103371 3300047673 Bacteria 1459
540 Ga0495602_0029350 3300048088 Bacteria 5239
541 Ga0495602_0073284 3300048088 Bacteria 2915
542 Ga0495602_0210742 3300048088 Bacteria 1475
543 Ga0495615_0025802 3300048090 Bacteria 1367
544 Ga0495626_0074170 3300048091 Bacteria 1523
545 Ga0496100_0118214 3300048903 Bacteria 1851
546 Ga0496100_0307916 3300048903 Unclassified 1187
547 Ga0496101_0003495 3300048904 Bacteria 9803
548 Ga0496101_0020946 3300048904 Bacteria 4486
549 Ga0496102_0275912 3300048905 Unclassified 1584
550 Ga0496102_0418130 3300048905 Unclassified 1259
551 Ga0496103_0112072 3300048906 Bacteria 1733
552 Ga0496104_0011816 3300048907 Bacteria 7834
553 Ga0496104_0152638 3300048907 Unclassified 2216
554 Ga0496104_0168650 3300048907 Bacteria 2099
555 Ga0496104_0193011 3300048907 Bacteria 1948
556 Ga0496105_0005669 3300048908 Bacteria 9502
557 Ga0496105_0064450 3300048908 Bacteria 3023
558 Ga0496105_0106504 3300048908 Bacteria 2314
559 Ga0496105_0268819 3300048908 Unclassified 1377
560 Ga0496106_0014672 3300048909 Bacteria 5791
561 Ga0496106_0051381 3300048909 Bacteria 3108
562 Ga0496106_0090498 3300048909 Bacteria 2361
563 Ga0496106_0163011 3300048909 Bacteria 1764
564 Ga0496106_0246547 3300048909 Bacteria 1427
565 Ga0496106_0485236 3300048909 Unclassified 993
566 Ga0496107_0002933 3300048910 Bacteria 11281
567 Ga0496107_0054382 3300048910 Bacteria 2889
568 Ga0496107_0089191 3300048910 Bacteria 2252
569 Ga0496107_0217345 3300048910 Unclassified 1421
570 Ga0496108_0005600 3300048911 Bacteria 10164
571 Ga0496108_0008011 3300048911 Bacteria 8573
572 Ga0496108_0078291 3300048911 Bacteria 2798
573 Ga0496109_0002295 3300048912 Bacteria 15905
574 Ga0496109_0023166 3300048912 Bacteria 5509
575 Ga0496109_0031992 3300048912 Bacteria 4726
576 Ga0496109_0067373 3300048912 Bacteria 3279
577 Ga0496109_0105115 3300048912 Bacteria 2622
578 Ga0496109_0609049 3300048912 Bacteria 1028
579 Ga0496110_0001066 3300048913 Bacteria 19357
580 Ga0496110_0125325 3300048913 Bacteria 2317
581 Ga0496110_0316935 3300048913 Bacteria 1420
582 Ga0496111_0200515 3300048914 Archaea 1483
583 Ga0496111_0334950 3300048914 Bacteria 1120
584 Ga0496112_0023125 3300048915 Bacteria 5933
585 Ga0496112_0030821 3300048915 Bacteria 5195
586 Ga0496112_0047360 3300048915 Bacteria 4218
587 Ga0496112_0115948 3300048915 Unclassified 2649
588 Ga0496112_0140078 3300048915 Bacteria 2388
589 Ga0496112_0173396 3300048915 Bacteria 2122
590 Ga0496112_0313618 3300048915 Bacteria 1513
591 Ga0496112_0447654 3300048915 Bacteria 1229
592 Ga0496113_0032205 3300048916 Bacteria 3809
593 Ga0496113_0068157 3300048916 Bacteria 2700
594 Ga0496114_0005004 3300048917 Bacteria 10338
595 Ga0496114_0015601 3300048917 Bacteria 6109
596 Ga0496114_0069959 3300048917 Bacteria 2947
597 Ga0496115_0007400 3300048918 Bacteria 8077
598 Ga0496115_0016446 3300048918 Bacteria 5634
599 Ga0496115_0017710 3300048918 Bacteria 5453
600 Ga0496115_0019498 3300048918 Bacteria 5220
601 Ga0501031_0000045 3300049568 Bacteria 66639
602 Ga0501031_0009046 3300049568 Bacteria 6480
603 Ga0501032_0000545 3300049569 Bacteria 30507
604 Ga0501032_0065513 3300049569 Unclassified 2429
605 Ga0501033_0000698 3300049570 Bacteria 31022
606 Ga0501033_0006732 3300049570 Bacteria 8975
607 Ga0501034_0021687 3300049571 Bacteria 6543
608 Ga0501034_0169786 3300049571 Bacteria 2149
609 Ga0501036_0002118 3300049572 Bacteria 15497
610 Ga0501036_0006165 3300049572 Bacteria 9728
611 Ga0501037_0000612 3300049573 Bacteria 27713
612 Ga0501037_0018046 3300049573 Bacteria 5196
613 Ga0501038_0000193 3300049574 Bacteria 52887
614 Ga0501038_0004891 3300049574 Bacteria 12444
615 Ga0501039_0006974 3300049575 Bacteria 8604
616 Ga0501040_0000044 3300049576 Bacteria 57546
617 Ga0501040_0000718 3300049576 Bacteria 20451
618 Ga0501040_0010244 3300049576 Bacteria 6131
619 Ga0501041_0000091 3300049577 Bacteria 36285
620 Ga0501041_0001848 3300049577 Bacteria 11868
621 Ga0501041_0035202 3300049577 Bacteria 3033
622 Ga0501042_0000016 3300049578 Bacteria 51701
623 Ga0501042_0001180 3300049578 Bacteria 15129
624 Ga0501042_0200868 3300049578 Unclassified 1437
625 Ga0501043_0000630 3300049579 Bacteria 31159
626 Ga0501043_0032227 3300049579 Bacteria 4119
627 Ga0501046_0000264 3300049580 Bacteria 53355
628 Ga0501046_0002496 3300049580 Bacteria 17221
629 Ga0501047_0000171 3300049581 Bacteria 79570
630 Ga0501047_0099208 3300049581 Bacteria 2791
631 Ga0501047_0158254 3300049581 Unclassified 2137
632 Ga0501048_0001526 3300049582 Bacteria 17568
633 Ga0501048_0001748 3300049582 Bacteria 16526
634 Ga0501048_0281952 3300049582 Unclassified 1181
635 Ga0501067_0000495 3300049583 Bacteria 21600
636 Ga0501067_0013586 3300049583 Bacteria 4509
637 Ga0501067_0269529 3300049583 Bacteria 948
638 Ga0501068_0000025 3300049584 Bacteria 56674
639 Ga0501068_0015392 3300049584 Bacteria 4391
640 Ga0501069_0000196 3300049585 Bacteria 26733
641 Ga0501069_0003131 3300049585 Bacteria 8476
642 Ga0501069_0010875 3300049585 Bacteria 4821
643 Ga0501069_0014233 3300049585 Bacteria 4249
644 Ga0501069_0064078 3300049585 Bacteria 2054
645 Ga0501070_0000514 3300049586 Bacteria 35487
646 Ga0501070_0001651 3300049586 Bacteria 19790
647 Ga0501070_0007569 3300049586 Bacteria 9227
648 Ga0501070_0014550 3300049586 Bacteria 6620
649 Ga0501070_0064405 3300049586 Bacteria 3036
650 Ga0501070_0100237 3300049586 Bacteria 2396
651 Ga0501070_0238137 3300049586 Bacteria 1490
652 Ga0501071_0000006 3300049587 Bacteria 76967
653 Ga0501071_0088379 3300049587 Unclassified 2273
654 Ga0501071_0240768 3300049587 Bacteria 1364
655 Ga0501072_0000143 3300049588 Bacteria 53349
656 Ga0501072_0002757 3300049588 Bacteria 13205
657 Ga0501072_0487286 3300049588 Bacteria 975
658 Ga0501073_0000279 3300049589 Bacteria 33733
659 Ga0501073_0002058 3300049589 Bacteria 15033
660 Ga0501074_0000078 3300049590 Bacteria 47463
661 Ga0501074_0004760 3300049590 Bacteria 9728
662 Ga0501075_0000044 3300049591 Bacteria 51077
663 Ga0501075_0002360 3300049591 Bacteria 12538
664 Ga0501076_0000334 3300049592 Bacteria 29117
665 Ga0501076_0008077 3300049592 Bacteria 7691
666 Ga0501077_0006572 3300049593 Bacteria 7138
667 Ga0501077_0014651 3300049593 Bacteria 4928
668 Ga0501077_0143669 3300049593 Bacteria 1514
669 Ga0501225_0052482 3300049705 Bacteria 1137
670 Ga0501079_0000008 3300049741 Bacteria 75650
671 Ga0501079_0000286 3300049741 Bacteria 31231
672 Ga0501079_0138880 3300049741 Bacteria 1893
673 Ga0501079_0577230 3300049741 Unclassified 884
674 Ga0501080_0001884 3300049742 Bacteria 18045
675 Ga0501080_0008885 3300049742 Bacteria 9136
676 Ga0501080_0188321 3300049742 Bacteria 1897
677 Ga0501081_0000020 3300049743 Bacteria 56347
678 Ga0501081_0001702 3300049743 Bacteria 13646
679 Ga0501083_0000175 3300049744 Bacteria 41315
680 Ga0501083_0002332 3300049744 Bacteria 12983
681 Ga0501035_0000993 3300049822 Bacteria 29972
682 Ga0501035_0004199 3300049822 Bacteria 13689
683 Ga0501035_0325760 3300049822 Bacteria 1290
684 Ga0501044_0001032 3300049823 Bacteria 33566
685 Ga0501044_0004011 3300049823 Bacteria 16495
686 Ga0501044_0183089 3300049823 Bacteria 2061
687 Ga0501044_0288177 3300049823 Unclassified 1574
688 Ga0501045_0000036 3300049824 Bacteria 57085
689 Ga0501045_0001036 3300049824 Bacteria 18271
690 Ga0501045_0122534 3300049824 Bacteria 1930
691 nmdc:mga0yw44_239705_c1 3300050492 Unclassified 1205
692 nmdc:mga05p37_573705_c1 3300050507 Unclassified 1279
693 nmdc:mga05p37_7413_c1 3300050507 Bacteria 12942
694 nmdc:mga05p37_85942_c1 3300050507 Bacteria 3877
695 nmdc:mga08y16_22314_c1 3300050511 Bacteria 6680
696 nmdc:mga08y16_67021_c1 3300050511 Bacteria 3746
697 nmdc:mga0n895_18845_c1 3300050512 Bacteria 6398
698 nmdc:mga0n895_75211_c1 3300050512 Bacteria 3357
699 nmdc:mga0rr50_17983_c1 3300050513 Bacteria 4736
700 nmdc:mga08x19_38995_c1 3300050514 Bacteria 3019
701 nmdc:mga0a205_138633_c1 3300050515 Bacteria 2333
702 Ga0495601_0174520 3300053077 Unclassified 1405
703 Ga0495595_0001549 3300053084 Bacteria 8957
704 Ga0495619_0002214 3300053085 Bacteria 12875
705 Ga0495619_0033154 3300053085 Bacteria 3353
706 Ga0495619_0135566 3300053085 Unclassified 1693
707 Ga0495619_0169063 3300053085 Bacteria 1511
708 Ga0501084_0000083 3300054114 Bacteria 69431
709 Ga0501084_0002951 3300054114 Bacteria 13773
710 Ga0501084_0108986 3300054114 Bacteria 2327
711 Ga0501084_0660308 3300054114 Unclassified 883
712 Ga0501082_0000472 3300060353 Bacteria 35547
713 Ga0501082_0004484 3300060353 Bacteria 12197
714 Ga0530510_0000031 3300061734 Bacteria 63666
715 Ga0530510_0002746 3300061734 Bacteria 12093
716 Ga0530510_0011304 3300061734 Bacteria 6266
717 Ga0530510_0061749 3300061734 Unclassified 2713
718 Ga0530510_0077770 3300061734 Bacteria 2411
719 Ga0105239_10205652
720 Ga0058863_11972964
721 Ga0070658_10004765
722 Ga0070658_10141272
723 Ga0070658_10485368
724 Ga0070683_100027337
725 Ga0070683_100050164
726 Ga0070683_100101969
727 Ga0070683_100110700
728 Ga0070683_100206559
729 Ga0070680_100005763
730 Ga0070680_100156525
731 Ga0070680_100183912
732 Ga0068868_100068586
733 Ga0068868_100260239
734 Ga0070660_100001363
735 Ga0070660_100024109
736 Ga0070660_100039863
737 Ga0070660_100116416
738 Ga0070660_100186467
739 Ga0070689_100370653
740 Ga0070661_100113013
741 Ga0070692_10038517
742 Ga0070674_100074108
743 Ga0070674_100446954
744 Ga0070659_100035834
745 Ga0070659_100046644
746 Ga0070667_100193371
747 Ga0070709_10053812
748 Ga0070714_100112610
749 Ga0070710_10158296
750 Ga0070701_10109210
751 Ga0070711_100320321
752 Ga0070705_100567472
753 Ga0070694_100203240
754 Ga0070708_100016662
755 Ga0070708_100071410
756 Ga0070708_100408321
757 Ga0070708_100427751
758 Ga0070663_100248669
759 Ga0070678_100084189
760 Ga0070678_100173152
761 Ga0070678_100222760
762 Ga0070662_100323530
763 Ga0070681_10000568
764 Ga0070681_10001517
765 Ga0070681_10036756
766 Ga0070681_10109041
767 Ga0070681_10212496
768 Ga0070681_10214587
769 Ga0070681_10248719
770 Ga0070706_100500434
771 Ga0070707_100010491
772 Ga0070707_100084210
773 Ga0070707_100161676
774 Ga0070698_100003138
775 Ga0070698_100255543
776 Ga0070699_100238776
777 Ga0070699_100391542
778 Ga0070679_100006546
779 Ga0070679_100016991
780 Ga0070679_100141564
781 Ga0070679_100234800
782 Ga0070679_100327157
783 Ga0070684_100024169
784 Ga0070684_100043239
785 Ga0070684_100065525
786 Ga0070684_100085591
787 Ga0070684_100094422
788 Ga0070684_100299747
789 Ga0070697_100119828
790 Ga0070686_100319123
791 Ga0070696_100028317
792 Ga0070665_100023734
793 Ga0070704_100032063
794 Ga0070704_100155329
795 Ga0070704_100522237
796 Ga0068855_100016986
797 Ga0068855_100049088
798 Ga0068855_100050501
799 Ga0068855_100067944
800 Ga0068855_100089909
801 Ga0068855_100351002
802 Ga0070664_100161016
803 Ga0070664_100300751
804 Ga0068854_100154724
805 Ga0068856_100375908
806 Ga0070702_100068046
807 Ga0068852_100029065
808 Ga0068852_100137871
809 Ga0068852_100224496
810 Ga0068852_100633444
811 Ga0068864_100577624
812 Ga0068861_100301737
813 Ga0068870_10046637
814 Ga0068863_100510098
815 Ga0068858_100241538
816 Ga0068862_100151888
817 Ga0068862_100195026
818 Ga0081455_10004326
819 Ga0081455_10022328
820 Ga0081455_10053756
821 Ga0081455_10100202
822 Ga0081538_10064751
823 Ga0081540_1010951
824 Ga0081539_10005523
825 Ga0081539_10007543
826 Ga0070717_10196931
827 Ga0070717_10207394
828 Ga0070715_10016269
829 Ga0070716_100034368
830 Ga0070712_100036751
831 Ga0070712_100088083
832 Ga0070712_100269789
833 Ga0070712_100428510
834 Ga0075428_100033962
835 Ga0075428_100051185
836 Ga0075431_100165961
837 Ga0075434_100044743
838 Ga0075435_100070349
839 Ga0105250_10039888
840 Ga0105240_10021422
841 Ga0105240_10223201
842 Ga0105240_10249758
843 Ga0111539_10005856
844 Ga0111539_10010125
845 Ga0111539_10011388
846 Ga0111539_10029299
847 Ga0105245_10334441
848 Ga0105245_10703291
849 Ga0105247_10240089
850 Ga0114129_10058515
851 Ga0114129_10064758
852 Ga0114129_10136272
853 Ga0114129_10254041
854 Ga0114129_10517383
855 Ga0114129_10602776
856 Ga0105242_10046730
857 Ga0105242_10338947
858 Ga0105242_10691359
859 Ga0105248_10399940
860 Ga0105237_10062693
861 Ga0105238_10033143
862 Ga0105238_10111035
863 Ga0105249_10152789
864 Ga0105249_10203964
865 Ga0105249_10248125
866 Ga0105239_10133101
867 Ga0105239_10341078
868 Ga0105239_10575954
869 Ga0157371_10429976
870 Ga0157370_10016279
871 Ga0157370_10097764
872 Ga0157370_10144874
873 Ga0157370_10190051
874 Ga0157370_10205317
875 Ga0157369_10001416
876 Ga0157369_10017845
877 Ga0157369_10051321
878 Ga0157369_10286545
879 Ga0157369_10334865
880 Ga0157369_10445738
881 Ga0157374_10048009
882 Ga0157374_10525385
883 Ga0157378_10103510
884 Ga0157372_10152133
885 Ga0157372_10270280
886 Ga0157375_11329889
887 Ga0157380_10025891
888 Ga0157379_10120272
889 Ga0157376_10177205
890 Ga0163161_10178180
891 Ga0197907_10672060
892 Ga0197907_11289452
893 Ga0206356_10249027
894 Ga0206356_11002235
895 Ga0206356_11771681
896 Ga0206355_1120413
897 Ga0206354_10148756
898 Ga0206353_10409533
899 Ga0206353_10667668
900 Ga0206353_10850478
901 Ga0206353_10875716
902 Ga0154015_1542097
903 Ga0213876_10182906
904 Ga0207653_10004076
905 Ga0207692_10057117
906 Ga0207692_10238673
907 Ga0207688_10004395
908 Ga0207643_10011529
909 Ga0207705_10039721
910 Ga0207705_10044602
911 Ga0207705_10063843
912 Ga0207705_10157391
913 Ga0207684_10090447
914 Ga0207684_10133837
915 Ga0207684_10203998
916 Ga0207684_10432324
917 Ga0207654_10138518
918 Ga0207707_10002326
919 Ga0207707_10014539
920 Ga0207707_10067104
921 Ga0207707_10094537
922 Ga0207707_10105274
923 Ga0207707_10112439
924 Ga0207693_10002056
925 Ga0207663_10061187
926 Ga0207663_10069533
927 Ga0207663_10292035
928 Ga0207660_10111565
929 Ga0207660_10205137
930 Ga0207662_10060958
931 Ga0207657_10000331
932 Ga0207657_10007492
933 Ga0207657_10037460
934 Ga0207657_10165974
935 Ga0207649_10107427
936 Ga0207652_10007548
937 Ga0207652_10023727
938 Ga0207652_10031089
939 Ga0207652_10046367
940 Ga0207652_10244967
941 Ga0207646_10002821
942 Ga0207646_10086109
943 Ga0207646_10123767
944 Ga0207646_10245698
945 Ga0207700_10154794
946 Ga0207700_10330494
947 Ga0207664_10411948
948 Ga0207706_10052787
949 Ga0207706_10091667
950 Ga0207709_10039217
951 Ga0207709_10208895
952 Ga0207670_10024520
953 Ga0207704_10188495
954 Ga0207665_10020792
955 Ga0207689_10198934
956 Ga0207661_10017520
957 Ga0207661_10050866
958 Ga0207661_10168478
959 Ga0207661_10224762
960 Ga0207661_10288400
961 Ga0207679_10529355
962 Ga0207667_10127836
963 Ga0207667_10171349
964 Ga0207667_10202628
965 Ga0207667_10276277
966 Ga0207667_10309772
967 Ga0207667_10632783
968 Ga0207712_10211403
969 Ga0207640_10048646
970 Ga0207658_10066502
971 Ga0207677_10152144
972 Ga0207703_10075577
973 Ga0207678_10229610
974 Ga0207708_10106658
975 Ga0207708_10323231
976 Ga0207702_10189255
977 Ga0207641_10617967
978 Ga0207674_10113718
979 Ga0207675_100023645
980 Ga0207675_100174178
981 Ga0207683_10077641
982 Ga0207698_10430687
983 Ga0207428_10064900
984 Ga0207428_10123483
985 Ga0207428_10270014
986 Ga0268265_10199209
987 Ga0268265_10319183
988 Ga0268264_10580102
989 Ga0265318_10068149
990 Ga0265338_10048183
991 Ga0265330_10061397
992 Ga0265339_10052350
993 Ga0265327_10020702
994 Ga0265316_10080186
995 Ga0307408_100116923
996 Ga0265313_10025499
997 Ga0265314_10007254
998 Ga0265342_10063214
999 Ga0307405_10006258
1000 Ga0307405_10069514
1001 Ga0307405_10097403
1002 Ga0307405_10311084
1003 Ga0307410_10006439
1004 Ga0307410_10388948
1005 Ga0307406_10155230
1006 Ga0307406_10472807
1007 Ga0307407_10115005
1008 Ga0307412_10016331
1009 Ga0307412_10264840
1010 Ga0307409_100039272
1011 Ga0307409_100096010
1012 Ga0307416_100083345
1013 Ga0307416_100170118
1014 Ga0307416_100243881
1015 Ga0307414_10492618
1016 Ga0307411_10052108
1017 Ga0307415_100007518
1018 Ga0307415_100040998
1019 Ga0307415_100304675
1020 Ga0373948_0001620
1021 Ga0373926_0032926
1022 Ga0373926_0035784
1023 Ga0373944_0007792
1024 Ga0373949_0019618
1025 Ga0373951_0002727
1026 Ga0373936_0014314
1027 Ga0373941_0011974
1028 Ga0373945_0003422
1029 Ga0373945_0013486
1030 Ga0373954_0084119
1031 Ga0373956_0050165
1032 Ga0373957_0053652
1033 Ga0373960_0011429
1034 Ga0373943_0000896
1035 Ga0373943_0003423
1036 Ga0373943_0012785
1037 Ga0373946_0005596
1038 Ga0373946_0062301
1039 Ga0373955_0073204
1040 Ga0373942_0002046
1041 Ga0373961_0084766
1042 Ga0373962_0012237
1043 Ga0373931_0004257
1044 Ga0373935_0014820
1045 Ga0373935_0179712
1046 Ga0373947_0012053
1047 Ga0373947_0026069
1048 Ga0373947_0144032
1049 Ga0373937_0047884
1050 Ga0373925_0001681
1051 Ga0373925_0008347
1052 Ga0395899_0000727
1053 Ga0395899_0018343
1054 Ga0395899_0025523
1055 Ga0395899_0031204
1056 Ga0395899_0038751
1057 Ga0395899_0174170
1058 Ga0395900_0005981
1059 Ga0395900_0006517
1060 Ga0395900_0011622
1061 Ga0395900_0023255
1062 Ga0395900_0023967
1063 Ga0395900_0046407
1064 Ga0395900_0051599
1065 Ga0395900_0060520
1066 Ga0395900_0119757
1067 Ga0395900_0154041
1068 Ga0395900_0160386
1069 Ga0395900_0294349
1070 Ga0395900_0355165
1071 Ga0395898_0007522
1072 Ga0395898_0022336
1073 Ga0395898_0045062
1074 Ga0395898_0067737
1075 Ga0395898_0070596
1076 Ga0395898_0082474
1077 Ga0395898_0116146
1078 Ga0395898_0204673
1079 Ga0395898_0296706
1080 Ga0395898_0439523
1081 Ga0395905_0002457
1082 Ga0395905_0010592
1083 Ga0395905_0028622
1084 Ga0395905_0032610
1085 Ga0395905_0037496
1086 Ga0395905_0046598
1087 Ga0395905_0053398
1088 Ga0395905_0063264
1089 Ga0395905_0172691
1090 Ga0395905_0282512
1091 Ga0395905_0317863
1092 Ga0395905_0610102
1093 Ga0395901_0003418
1094 Ga0395901_0007676
1095 Ga0395901_0009332
1096 Ga0395901_0009579
1097 Ga0395901_0011618
1098 Ga0395901_0012040
1099 Ga0395901_0013640
1100 Ga0395901_0014388
1101 Ga0395901_0015943
1102 Ga0395901_0020472
1103 Ga0395901_0032261
1104 Ga0395901_0058602
1105 Ga0395901_0062685
1106 Ga0395901_0066779
1107 Ga0395901_0072874
1108 Ga0395901_0104240
1109 Ga0395901_0113815
1110 Ga0395901_0184873
1111 Ga0436365_0152440
1112 Ga0436365_1603605
1113 Ga0439451_001447
1114 Ga0439458_0002517
1115 Ga0450918_006233
1116 Ga0466969_0036211
1117 Ga0466965_0024340
1118 Ga0466965_0213116
1119 Ga0466966_0004783
1120 Ga0466966_0015008
1121 Ga0466961_0003118
1122 Ga0466961_0009477
1123 Ga0466961_0069788
1124 Ga0466963_0002364
1125 Ga0466963_0010083
1126 Ga0466963_0034714
1127 Ga0466963_0073576
1128 Ga0466963_0075203
1129 Ga0466963_0079497
1130 Ga0466963_0113336
1131 Ga0466963_0142401
1132 Ga0466963_0321393
1133 Ga0466963_0380074
1134 Ga0466964_0000962
1135 Ga0466964_0008547
1136 Ga0466964_0198219
1137 Ga0466971_0026919
1138 Ga0466968_0092963
1139 Ga0466970_0055482
1140 Ga0466970_0059078
1141 Ga0466970_0149514
1142 Ga0466957_0014153
1143 Ga0466957_0026965
1144 Ga0466957_0039452
1145 Ga0466960_0101967
1146 Ga0466959_0005640
1147 Ga0466959_0007161
1148 Ga0466959_0023477
1149 Ga0466959_0120779
1150 Ga0466959_0234141
1151 Ga0451576_0425039
1152 Ga0451576_0480834
1153 Ga0466958_0006317
1154 Ga0466958_0011009
1155 Ga0466958_0029630
1156 Ga0466958_0085286
1157 Ga0466958_0124907
1158 Ga0466967_0000274
1159 Ga0466967_0004211
1160 Ga0466967_0012534
1161 Ga0466967_0101630
1162 Ga0466967_0143139
1163 Ga0466967_0235771
1164 Ga0495592_0126513
1165 Ga0495592_0252611
1166 Ga0495629_0009665
1167 Ga0495629_0027009
1168 Ga0495641_0011337
1169 Ga0495641_0027081
1170 Ga0495651_0031660
1171 Ga0495651_0086137
1172 Ga0495653_0025779
1173 Ga0495653_0028795
1174 Ga0495653_0112838
1175 Ga0495582_0000050
1176 Ga0495582_0135719
1177 Ga0495605_0092506
1178 Ga0495605_0141309
1179 Ga0495639_0001750
1180 Ga0495662_0004271
1181 Ga0495664_0054505
1182 Ga0495664_0105999
1183 Ga0495664_0180185
1184 Ga0495594_0057551
1185 Ga0495596_0043683
1186 Ga0495607_0122319
1187 Ga0495608_0001715
1188 Ga0495608_0013267
1189 Ga0495616_0055272
1190 Ga0495618_0042286
1191 Ga0495618_0126144
1192 Ga0495618_0206067
1193 Ga0495628_0035111
1194 Ga0495628_0195811
1195 Ga0495630_0009961
1196 Ga0495630_0077032
1197 Ga0495643_0180867
1198 Ga0495663_0004137
1199 Ga0495666_0024194
1200 Ga0495666_0084513
1201 Ga0495652_0238094
1202 Ga0495665_0044867
1203 Ga0495640_0005917
1204 Ga0495640_0023452
1205 Ga0495640_0097540
1206 Ga0495597_0034082
1207 Ga0495645_0054213
1208 Ga0495645_0109769
1209 Ga0495667_0007872
1210 Ga0495667_0033197
1211 Ga0495667_0048616
1212 Ga0495667_0180588
1213 Ga0495634_0009879
1214 Ga0495634_0016648
1215 Ga0495634_0075449
1216 Ga0495611_0113015
1217 Ga0495635_0011303
1218 Ga0495659_0029846
1219 Ga0495657_0048654
1220 Ga0495657_0078052
1221 Ga0495599_0028024
1222 Ga0495599_0055552
1223 Ga0495646_0035446
1224 Ga0495658_0000020
1225 Ga0495658_0194097
1226 Ga0495658_0214598
1227 Ga0495669_0057228
1228 Ga0495613_0009224
1229 Ga0495624_0112428
1230 Ga0495670_0052006
1231 Ga0495589_0064836
1232 Ga0495600_0074456
1233 Ga0495600_0124381
1234 Ga0495581_0009383
1235 Ga0495581_0162157
1236 Ga0495604_0096696
1237 Ga0495604_0105022
1238 Ga0495604_0114215
1239 Ga0495674_0001037
1240 Ga0495674_0025803
1241 Ga0495674_0041714
1242 Ga0495674_0217454
1243 Ga0495676_0000506
1244 Ga0495676_0035591
1245 Ga0495680_0002190
1246 Ga0495680_0092950
1247 Ga0495680_0202417
1248 Ga0495683_0087730
1249 Ga0495675_0069998
1250 Ga0495675_0082335
1251 Ga0495681_0084052
1252 Ga0495684_0004005
1253 Ga0495684_0020811
1254 Ga0495684_0080790
1255 Ga0495684_0298972
1256 Ga0495593_0084994
1257 Ga0495593_0103371
1258 Ga0495602_0029350
1259 Ga0495602_0073284
1260 Ga0495602_0210742
1261 Ga0495615_0025802
1262 Ga0495626_0074170
1263 Ga0496100_0118214
1264 Ga0496100_0307916
1265 Ga0496101_0003495
1266 Ga0496101_0020946
1267 Ga0496102_0275912
1268 Ga0496102_0418130
1269 Ga0496103_0112072
1270 Ga0496104_0011816
1271 Ga0496104_0152638
1272 Ga0496104_0168650
1273 Ga0496104_0193011
1274 Ga0496105_0005669
1275 Ga0496105_0064450
1276 Ga0496105_0106504
1277 Ga0496105_0268819
1278 Ga0496106_0014672
1279 Ga0496106_0051381
1280 Ga0496106_0090498
1281 Ga0496106_0163011
1282 Ga0496106_0246547
1283 Ga0496106_0485236
1284 Ga0496107_0002933
1285 Ga0496107_0054382
1286 Ga0496107_0089191
1287 Ga0496107_0217345
1288 Ga0496108_0005600
1289 Ga0496108_0008011
1290 Ga0496108_0078291
1291 Ga0496109_0002295
1292 Ga0496109_0023166
1293 Ga0496109_0031992
1294 Ga0496109_0067373
1295 Ga0496109_0105115
1296 Ga0496109_0609049
1297 Ga0496110_0001066
1298 Ga0496110_0125325
1299 Ga0496110_0316935
1300 Ga0496111_0200515
1301 Ga0496111_0334950
1302 Ga0496112_0023125
1303 Ga0496112_0030821
1304 Ga0496112_0047360
1305 Ga0496112_0115948
1306 Ga0496112_0140078
1307 Ga0496112_0173396
1308 Ga0496112_0313618
1309 Ga0496112_0447654
1310 Ga0496113_0032205
1311 Ga0496113_0068157
1312 Ga0496114_0005004
1313 Ga0496114_0015601
1314 Ga0496114_0069959
1315 Ga0496115_0007400
1316 Ga0496115_0016446
1317 Ga0496115_0017710
1318 Ga0496115_0019498
1319 Ga0501031_0000045
1320 Ga0501031_0009046
1321 Ga0501032_0000545
1322 Ga0501032_0065513
1323 Ga0501033_0000698
1324 Ga0501033_0006732
1325 Ga0501034_0021687
1326 Ga0501034_0169786
1327 Ga0501036_0002118
1328 Ga0501036_0006165
1329 Ga0501037_0000612
1330 Ga0501037_0018046
1331 Ga0501038_0000193
1332 Ga0501038_0004891
1333 Ga0501039_0006974
1334 Ga0501040_0000044
1335 Ga0501040_0000718
1336 Ga0501040_0010244
1337 Ga0501041_0000091
1338 Ga0501041_0001848
1339 Ga0501041_0035202
1340 Ga0501042_0000016
1341 Ga0501042_0001180
1342 Ga0501042_0200868
1343 Ga0501043_0000630
1344 Ga0501043_0032227
1345 Ga0501046_0000264
1346 Ga0501046_0002496
1347 Ga0501047_0000171
1348 Ga0501047_0099208
1349 Ga0501047_0158254
1350 Ga0501048_0001526
1351 Ga0501048_0001748
1352 Ga0501048_0281952
1353 Ga0501067_0000495
1354 Ga0501067_0013586
1355 Ga0501067_0269529
1356 Ga0501068_0000025
1357 Ga0501068_0015392
1358 Ga0501069_0000196
1359 Ga0501069_0003131
1360 Ga0501069_0010875
1361 Ga0501069_0014233
1362 Ga0501069_0064078
1363 Ga0501070_0000514
1364 Ga0501070_0001651
1365 Ga0501070_0007569
1366 Ga0501070_0014550
1367 Ga0501070_0064405
1368 Ga0501070_0100237
1369 Ga0501070_0238137
1370 Ga0501071_0000006
1371 Ga0501071_0088379
1372 Ga0501071_0240768
1373 Ga0501072_0000143
1374 Ga0501072_0002757
1375 Ga0501072_0487286
1376 Ga0501073_0000279
1377 Ga0501073_0002058
1378 Ga0501074_0000078
1379 Ga0501074_0004760
1380 Ga0501075_0000044
1381 Ga0501075_0002360
1382 Ga0501076_0000334
1383 Ga0501076_0008077
1384 Ga0501077_0006572
1385 Ga0501077_0014651
1386 Ga0501077_0143669
1387 Ga0501225_0052482
1388 Ga0501079_0000008
1389 Ga0501079_0000286
1390 Ga0501079_0138880
1391 Ga0501079_0577230
1392 Ga0501080_0001884
1393 Ga0501080_0008885
1394 Ga0501080_0188321
1395 Ga0501081_0000020
1396 Ga0501081_0001702
1397 Ga0501083_0000175
1398 Ga0501083_0002332
1399 Ga0501035_0000993
1400 Ga0501035_0004199
1401 Ga0501035_0325760
1402 Ga0501044_0001032
1403 Ga0501044_0004011
1404 Ga0501044_0183089
1405 Ga0501044_0288177
1406 Ga0501045_0000036
1407 Ga0501045_0001036
1408 Ga0501045_0122534
1409 nmdc:mga0yw44_239705_c1
1410 nmdc:mga05p37_573705_c1
1411 nmdc:mga05p37_7413_c1
1412 nmdc:mga05p37_85942_c1
1413 nmdc:mga08y16_22314_c1
1414 nmdc:mga08y16_67021_c1
1415 nmdc:mga0n895_18845_c1
1416 nmdc:mga0n895_75211_c1
1417 nmdc:mga0rr50_17983_c1
1418 nmdc:mga08x19_38995_c1
1419 nmdc:mga0a205_138633_c1
1420 Ga0495601_0174520
1421 Ga0495595_0001549
1422 Ga0495619_0002214
1423 Ga0495619_0033154
1424 Ga0495619_0135566
1425 Ga0495619_0169063
1426 Ga0501084_0000083
1427 Ga0501084_0002951
1428 Ga0501084_0108986
1429 Ga0501084_0660308
1430 Ga0501082_0000472
1431 Ga0501082_0004484
1432 Ga0530510_0000031
1433 Ga0530510_0002746
1434 Ga0530510_0011304
1435 Ga0530510_0061749
1436 Ga0530510_0077770

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k52-assembly4.cif.gz_D crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012 0.7753 56 264
5ffc-assembly1.cif.gz_A copm in the cu(ii)-bound form 0.7732 62 193
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.7504 58 200
5ffd-assembly1.cif.gz_A copm in the ag-bound form (by co-crystallization) 0.7487 65 199
5fej-assembly2.cif.gz_B copm in the cu(i)-bound form 0.7486 65 200
ID Description Score Start End Superfamily
af_P9WKQ5_6_314_1.10.620.20 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.7901 16 261 1.10.620.20
5ffcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7732 62 193 1.20.1260.10
3fseA02 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7604 65 199 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7548 65 200 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7504 58 200 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7V9DFD6-F1-model_v4 Ferritin-like domain-containing protein 0.9916 17 196
AF-A0A538GF55-F1-model_v4 Ferritin-like domain-containing protein 0.9897 34 268
AF-A0A538LL63-F1-model_v4 Ferritin-like domain-containing protein 0.986 16 268
AF-A0A1Q7WID7-F1-model_v4 Ferritin-like domain-containing protein 0.9845 65 269
AF-A0A1Q7WID7-F1-model_v4 Ferritin-like domain-containing protein 0.9751 65 269

Map