F477164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 316 | 1436 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10205652|Ga0105239_102056522 |
| Length | 298 |
| Sequence | MSDLRIDLPLRRFAERGRVAGGSLGFPAMEAEDLGLDTDRDLQGVYRYYELAKRAEWQVRDLPWGEIAPIPEYSGSPQKLARRRDLWRSVITQQLQADELAVEMATQLFSIAPDHEAKLYYTTMVQDESRHTEAWLKLIAESGGMAERDPHLDRLARMTLDADTLEEKVFVMQVFYERLIIPRFRMIARSSRGTILEDLCNRLTIDDGIHHGAGMAYERVLLEGAGRGVHTKLIAAANQMLPVFTQHALWRPKAREFIGALMRETDIRMLKEDLEQGVRLARSLGIDVGDIELPAELH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 183 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 184 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 1.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 7.8 |
| Rhizosphere | 91.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10205652 | 3300010375 | Bacteria | 2206 |
| 2 | Ga0058863_11972964 | 3300004799 | Bacteria | 939 |
| 3 | Ga0070658_10004765 | 3300005327 | Bacteria | 11035 |
| 4 | Ga0070658_10141272 | 3300005327 | Unclassified | 2012 |
| 5 | Ga0070658_10485368 | 3300005327 | Bacteria | 1066 |
| 6 | Ga0070683_100027337 | 3300005329 | Bacteria | 5145 |
| 7 | Ga0070683_100050164 | 3300005329 | Bacteria | 3862 |
| 8 | Ga0070683_100101969 | 3300005329 | Bacteria | 2703 |
| 9 | Ga0070683_100110700 | 3300005329 | Bacteria | 2590 |
| 10 | Ga0070683_100206559 | 3300005329 | Bacteria | 1865 |
| 11 | Ga0070680_100005763 | 3300005336 | Bacteria | 9398 |
| 12 | Ga0070680_100156525 | 3300005336 | Bacteria | 1914 |
| 13 | Ga0070680_100183912 | 3300005336 | Archaea | 1760 |
| 14 | Ga0068868_100068586 | 3300005338 | Archaea | 2824 |
| 15 | Ga0068868_100260239 | 3300005338 | Bacteria | 1463 |
| 16 | Ga0070660_100001363 | 3300005339 | Bacteria | 16606 |
| 17 | Ga0070660_100024109 | 3300005339 | Bacteria | 4513 |
| 18 | Ga0070660_100039863 | 3300005339 | Bacteria | 3571 |
| 19 | Ga0070660_100116416 | 3300005339 | Bacteria | 2131 |
| 20 | Ga0070660_100186467 | 3300005339 | Bacteria | 1680 |
| 21 | Ga0070689_100370653 | 3300005340 | Bacteria | 1205 |
| 22 | Ga0070661_100113013 | 3300005344 | Bacteria | 2029 |
| 23 | Ga0070692_10038517 | 3300005345 | Bacteria | 2437 |
| 24 | Ga0070674_100074108 | 3300005356 | Bacteria | 2415 |
| 25 | Ga0070674_100446954 | 3300005356 | Bacteria | 1066 |
| 26 | Ga0070659_100035834 | 3300005366 | Bacteria | 3865 |
| 27 | Ga0070659_100046644 | 3300005366 | Bacteria | 3397 |
| 28 | Ga0070667_100193371 | 3300005367 | Bacteria | 1803 |
| 29 | Ga0070709_10053812 | 3300005434 | Bacteria | 2535 |
| 30 | Ga0070714_100112610 | 3300005435 | Bacteria | 2411 |
| 31 | Ga0070710_10158296 | 3300005437 | Bacteria | 1402 |
| 32 | Ga0070701_10109210 | 3300005438 | Bacteria | 1543 |
| 33 | Ga0070711_100320321 | 3300005439 | Bacteria | 1238 |
| 34 | Ga0070705_100567472 | 3300005440 | Bacteria | 873 |
| 35 | Ga0070694_100203240 | 3300005444 | Unclassified | 1478 |
| 36 | Ga0070708_100016662 | 3300005445 | Bacteria | 6106 |
| 37 | Ga0070708_100071410 | 3300005445 | Bacteria | 3125 |
| 38 | Ga0070708_100408321 | 3300005445 | Bacteria | 1281 |
| 39 | Ga0070708_100427751 | 3300005445 | Unclassified | 1249 |
| 40 | Ga0070663_100248669 | 3300005455 | Bacteria | 1406 |
| 41 | Ga0070678_100084189 | 3300005456 | Bacteria | 2420 |
| 42 | Ga0070678_100173152 | 3300005456 | Bacteria | 1760 |
| 43 | Ga0070678_100222760 | 3300005456 | Bacteria | 1569 |
| 44 | Ga0070662_100323530 | 3300005457 | Unclassified | 1258 |
| 45 | Ga0070681_10000568 | 3300005458 | Bacteria | 30431 |
| 46 | Ga0070681_10001517 | 3300005458 | Bacteria | 20575 |
| 47 | Ga0070681_10036756 | 3300005458 | Bacteria | 4917 |
| 48 | Ga0070681_10109041 | 3300005458 | Bacteria | 2709 |
| 49 | Ga0070681_10212496 | 3300005458 | Bacteria | 1850 |
| 50 | Ga0070681_10214587 | 3300005458 | Unclassified | 1841 |
| 51 | Ga0070681_10248719 | 3300005458 | Bacteria | 1691 |
| 52 | Ga0070706_100500434 | 3300005467 | Bacteria | 1131 |
| 53 | Ga0070707_100010491 | 3300005468 | Bacteria | 8631 |
| 54 | Ga0070707_100084210 | 3300005468 | Bacteria | 3072 |
| 55 | Ga0070707_100161676 | 3300005468 | Bacteria | 2182 |
| 56 | Ga0070698_100003138 | 3300005471 | Bacteria | 18207 |
| 57 | Ga0070698_100255543 | 3300005471 | Unclassified | 1685 |
| 58 | Ga0070699_100238776 | 3300005518 | Unclassified | 1621 |
| 59 | Ga0070699_100391542 | 3300005518 | Bacteria | 1256 |
| 60 | Ga0070679_100006546 | 3300005530 | Bacteria | 10858 |
| 61 | Ga0070679_100016991 | 3300005530 | Bacteria | 7034 |
| 62 | Ga0070679_100141564 | 3300005530 | Bacteria | 2384 |
| 63 | Ga0070679_100234800 | 3300005530 | Unclassified | 1793 |
| 64 | Ga0070679_100327157 | 3300005530 | Bacteria | 1481 |
| 65 | Ga0070684_100024169 | 3300005535 | Bacteria | 5094 |
| 66 | Ga0070684_100043239 | 3300005535 | Bacteria | 3889 |
| 67 | Ga0070684_100065525 | 3300005535 | Bacteria | 3188 |
| 68 | Ga0070684_100085591 | 3300005535 | Unclassified | 2796 |
| 69 | Ga0070684_100094422 | 3300005535 | Bacteria | 2664 |
| 70 | Ga0070684_100299747 | 3300005535 | Bacteria | 1475 |
| 71 | Ga0070697_100119828 | 3300005536 | Bacteria | 2200 |
| 72 | Ga0070686_100319123 | 3300005544 | Unclassified | 1158 |
| 73 | Ga0070696_100028317 | 3300005546 | Bacteria | 3823 |
| 74 | Ga0070665_100023734 | 3300005548 | Bacteria | 6177 |
| 75 | Ga0070704_100032063 | 3300005549 | Bacteria | 3540 |
| 76 | Ga0070704_100155329 | 3300005549 | Bacteria | 1804 |
| 77 | Ga0070704_100522237 | 3300005549 | Bacteria | 1034 |
| 78 | Ga0068855_100016986 | 3300005563 | Bacteria | 8752 |
| 79 | Ga0068855_100049088 | 3300005563 | Bacteria | 4979 |
| 80 | Ga0068855_100050501 | 3300005563 | Archaea | 4901 |
| 81 | Ga0068855_100067944 | 3300005563 | Bacteria | 4151 |
| 82 | Ga0068855_100089909 | 3300005563 | Bacteria | 3544 |
| 83 | Ga0068855_100351002 | 3300005563 | Bacteria | 1625 |
| 84 | Ga0070664_100161016 | 3300005564 | Bacteria | 1985 |
| 85 | Ga0070664_100300751 | 3300005564 | Bacteria | 1450 |
| 86 | Ga0068854_100154724 | 3300005578 | Unclassified | 1771 |
| 87 | Ga0068856_100375908 | 3300005614 | Unclassified | 1440 |
| 88 | Ga0070702_100068046 | 3300005615 | Bacteria | 2094 |
| 89 | Ga0068852_100029065 | 3300005616 | Bacteria | 4535 |
| 90 | Ga0068852_100137871 | 3300005616 | Bacteria | 2254 |
| 91 | Ga0068852_100224496 | 3300005616 | Bacteria | 1788 |
| 92 | Ga0068852_100633444 | 3300005616 | Unclassified | 1076 |
| 93 | Ga0068864_100577624 | 3300005618 | Unclassified | 1089 |
| 94 | Ga0068861_100301737 | 3300005719 | Bacteria | 1388 |
| 95 | Ga0068870_10046637 | 3300005840 | Bacteria | 2274 |
| 96 | Ga0068863_100510098 | 3300005841 | Bacteria | 1185 |
| 97 | Ga0068858_100241538 | 3300005842 | Bacteria | 1714 |
| 98 | Ga0068862_100151888 | 3300005844 | Bacteria | 2062 |
| 99 | Ga0068862_100195026 | 3300005844 | Unclassified | 1824 |
| 100 | Ga0081455_10004326 | 3300005937 | Bacteria | 15989 |
| 101 | Ga0081455_10022328 | 3300005937 | Bacteria | 5917 |
| 102 | Ga0081455_10053756 | 3300005937 | Bacteria | 3439 |
| 103 | Ga0081455_10100202 | 3300005937 | Bacteria | 2328 |
| 104 | Ga0081538_10064751 | 3300005981 | Bacteria | 2065 |
| 105 | Ga0081540_1010951 | 3300005983 | Bacteria | 6091 |
| 106 | Ga0081539_10005523 | 3300005985 | Bacteria | 12824 |
| 107 | Ga0081539_10007543 | 3300005985 | Bacteria | 9853 |
| 108 | Ga0070717_10196931 | 3300006028 | Bacteria | 1763 |
| 109 | Ga0070717_10207394 | 3300006028 | Bacteria | 1719 |
| 110 | Ga0070715_10016269 | 3300006163 | Bacteria | 2791 |
| 111 | Ga0070716_100034368 | 3300006173 | Bacteria | 2779 |
| 112 | Ga0070712_100036751 | 3300006175 | Bacteria | 3334 |
| 113 | Ga0070712_100088083 | 3300006175 | Bacteria | 2267 |
| 114 | Ga0070712_100269789 | 3300006175 | Bacteria | 1366 |
| 115 | Ga0070712_100428510 | 3300006175 | Unclassified | 1097 |
| 116 | Ga0075428_100033962 | 3300006844 | Bacteria | 5627 |
| 117 | Ga0075428_100051185 | 3300006844 | Bacteria | 4529 |
| 118 | Ga0075431_100165961 | 3300006847 | Bacteria | 2270 |
| 119 | Ga0075434_100044743 | 3300006871 | Bacteria | 4390 |
| 120 | Ga0075435_100070349 | 3300007076 | Bacteria | 2856 |
| 121 | Ga0105250_10039888 | 3300009092 | Bacteria | 1883 |
| 122 | Ga0105240_10021422 | 3300009093 | Bacteria | 8594 |
| 123 | Ga0105240_10223201 | 3300009093 | Bacteria | 2194 |
| 124 | Ga0105240_10249758 | 3300009093 | Bacteria | 2052 |
| 125 | Ga0111539_10005856 | 3300009094 | Bacteria | 15887 |
| 126 | Ga0111539_10010125 | 3300009094 | Bacteria | 11881 |
| 127 | Ga0111539_10011388 | 3300009094 | Bacteria | 11166 |
| 128 | Ga0111539_10029299 | 3300009094 | Bacteria | 6707 |
| 129 | Ga0105245_10334441 | 3300009098 | Unclassified | 1496 |
| 130 | Ga0105245_10703291 | 3300009098 | Bacteria | 1044 |
| 131 | Ga0105247_10240089 | 3300009101 | Bacteria | 1234 |
| 132 | Ga0114129_10058515 | 3300009147 | Bacteria | 5390 |
| 133 | Ga0114129_10064758 | 3300009147 | Bacteria | 5101 |
| 134 | Ga0114129_10136272 | 3300009147 | Bacteria | 3368 |
| 135 | Ga0114129_10254041 | 3300009147 | Bacteria | 2358 |
| 136 | Ga0114129_10517383 | 3300009147 | Bacteria | 1556 |
| 137 | Ga0114129_10602776 | 3300009147 | Bacteria | 1423 |
| 138 | Ga0105242_10046730 | 3300009176 | Bacteria | 3513 |
| 139 | Ga0105242_10338947 | 3300009176 | Unclassified | 1385 |
| 140 | Ga0105242_10691359 | 3300009176 | Bacteria | 997 |
| 141 | Ga0105248_10399940 | 3300009177 | Bacteria | 1547 |
| 142 | Ga0105237_10062693 | 3300009545 | Bacteria | 3717 |
| 143 | Ga0105238_10033143 | 3300009551 | Bacteria | 5256 |
| 144 | Ga0105238_10111035 | 3300009551 | Bacteria | 2722 |
| 145 | Ga0105249_10152789 | 3300009553 | Bacteria | 2224 |
| 146 | Ga0105249_10203964 | 3300009553 | Unclassified | 1936 |
| 147 | Ga0105249_10248125 | 3300009553 | Bacteria | 1763 |
| 148 | Ga0105239_10133101 | 3300010375 | Bacteria | 2767 |
| 149 | Ga0105239_10341078 | 3300010375 | Bacteria | 1691 |
| 150 | Ga0105239_10575954 | 3300010375 | Unclassified | 1283 |
| 151 | Ga0157371_10429976 | 3300013102 | Unclassified | 969 |
| 152 | Ga0157370_10016279 | 3300013104 | Bacteria | 7534 |
| 153 | Ga0157370_10097764 | 3300013104 | Bacteria | 2754 |
| 154 | Ga0157370_10144874 | 3300013104 | Bacteria | 2212 |
| 155 | Ga0157370_10190051 | 3300013104 | Bacteria | 1906 |
| 156 | Ga0157370_10205317 | 3300013104 | Bacteria | 1827 |
| 157 | Ga0157369_10001416 | 3300013105 | Bacteria | 29494 |
| 158 | Ga0157369_10017845 | 3300013105 | Bacteria | 7966 |
| 159 | Ga0157369_10051321 | 3300013105 | Bacteria | 4463 |
| 160 | Ga0157369_10286545 | 3300013105 | Bacteria | 1715 |
| 161 | Ga0157369_10334865 | 3300013105 | Bacteria | 1572 |
| 162 | Ga0157369_10445738 | 3300013105 | Unclassified | 1341 |
| 163 | Ga0157374_10048009 | 3300013296 | Bacteria | 3960 |
| 164 | Ga0157374_10525385 | 3300013296 | Bacteria | 1190 |
| 165 | Ga0157378_10103510 | 3300013297 | Archaea | 2601 |
| 166 | Ga0157372_10152133 | 3300013307 | Bacteria | 2671 |
| 167 | Ga0157372_10270280 | 3300013307 | Bacteria | 1975 |
| 168 | Ga0157375_11329889 | 3300013308 | Unclassified | 845 |
| 169 | Ga0157380_10025891 | 3300014326 | Bacteria | 4451 |
| 170 | Ga0157379_10120272 | 3300014968 | Bacteria | 2362 |
| 171 | Ga0157376_10177205 | 3300014969 | Bacteria | 1945 |
| 172 | Ga0163161_10178180 | 3300017792 | Unclassified | 1628 |
| 173 | Ga0197907_10672060 | 3300020069 | Bacteria | 1428 |
| 174 | Ga0197907_11289452 | 3300020069 | Bacteria | 1519 |
| 175 | Ga0206356_10249027 | 3300020070 | Bacteria | 2429 |
| 176 | Ga0206356_11002235 | 3300020070 | Bacteria | 2365 |
| 177 | Ga0206356_11771681 | 3300020070 | Bacteria | 3281 |
| 178 | Ga0206355_1120413 | 3300020076 | Unclassified | 1165 |
| 179 | Ga0206354_10148756 | 3300020081 | Unclassified | 1372 |
| 180 | Ga0206353_10409533 | 3300020082 | Bacteria | 2132 |
| 181 | Ga0206353_10667668 | 3300020082 | Unclassified | 1643 |
| 182 | Ga0206353_10850478 | 3300020082 | Bacteria | 6381 |
| 183 | Ga0206353_10875716 | 3300020082 | Bacteria | 6509 |
| 184 | Ga0154015_1542097 | 3300020610 | Bacteria | 1119 |
| 185 | Ga0213876_10182906 | 3300021384 | Unclassified | 1115 |
| 186 | Ga0207653_10004076 | 3300025885 | Bacteria | 4596 |
| 187 | Ga0207692_10057117 | 3300025898 | Bacteria | 2005 |
| 188 | Ga0207692_10238673 | 3300025898 | Unclassified | 1085 |
| 189 | Ga0207688_10004395 | 3300025901 | Bacteria | 7673 |
| 190 | Ga0207643_10011529 | 3300025908 | Bacteria | 4774 |
| 191 | Ga0207705_10039721 | 3300025909 | Bacteria | 3373 |
| 192 | Ga0207705_10044602 | 3300025909 | Bacteria | 3186 |
| 193 | Ga0207705_10063843 | 3300025909 | Bacteria | 2661 |
| 194 | Ga0207705_10157391 | 3300025909 | Unclassified | 1705 |
| 195 | Ga0207684_10090447 | 3300025910 | Bacteria | 2608 |
| 196 | Ga0207684_10133837 | 3300025910 | Bacteria | 2128 |
| 197 | Ga0207684_10203998 | 3300025910 | Bacteria | 1706 |
| 198 | Ga0207684_10432324 | 3300025910 | Bacteria | 1131 |
| 199 | Ga0207654_10138518 | 3300025911 | Bacteria | 1549 |
| 200 | Ga0207707_10002326 | 3300025912 | Bacteria | 17116 |
| 201 | Ga0207707_10014539 | 3300025912 | Bacteria | 6855 |
| 202 | Ga0207707_10067104 | 3300025912 | Archaea | 3125 |
| 203 | Ga0207707_10094537 | 3300025912 | Bacteria | 2611 |
| 204 | Ga0207707_10105274 | 3300025912 | Bacteria | 2466 |
| 205 | Ga0207707_10112439 | 3300025912 | Bacteria | 2381 |
| 206 | Ga0207693_10002056 | 3300025915 | Bacteria | 17601 |
| 207 | Ga0207663_10061187 | 3300025916 | Bacteria | 2388 |
| 208 | Ga0207663_10069533 | 3300025916 | Unclassified | 2265 |
| 209 | Ga0207663_10292035 | 3300025916 | Bacteria | 1215 |
| 210 | Ga0207660_10111565 | 3300025917 | Bacteria | 2058 |
| 211 | Ga0207660_10205137 | 3300025917 | Bacteria | 1541 |
| 212 | Ga0207662_10060958 | 3300025918 | Bacteria | 2264 |
| 213 | Ga0207657_10000331 | 3300025919 | Bacteria | 50115 |
| 214 | Ga0207657_10007492 | 3300025919 | Bacteria | 11185 |
| 215 | Ga0207657_10037460 | 3300025919 | Bacteria | 4329 |
| 216 | Ga0207657_10165974 | 3300025919 | Bacteria | 1791 |
| 217 | Ga0207649_10107427 | 3300025920 | Bacteria | 1858 |
| 218 | Ga0207652_10007548 | 3300025921 | Bacteria | 8757 |
| 219 | Ga0207652_10023727 | 3300025921 | Bacteria | 5084 |
| 220 | Ga0207652_10031089 | 3300025921 | Bacteria | 4480 |
| 221 | Ga0207652_10046367 | 3300025921 | Bacteria | 3708 |
| 222 | Ga0207652_10244967 | 3300025921 | Unclassified | 1616 |
| 223 | Ga0207646_10002821 | 3300025922 | Bacteria | 20211 |
| 224 | Ga0207646_10086109 | 3300025922 | Unclassified | 2811 |
| 225 | Ga0207646_10123767 | 3300025922 | Bacteria | 2324 |
| 226 | Ga0207646_10245698 | 3300025922 | Unclassified | 1617 |
| 227 | Ga0207700_10154794 | 3300025928 | Bacteria | 1898 |
| 228 | Ga0207700_10330494 | 3300025928 | Bacteria | 1323 |
| 229 | Ga0207664_10411948 | 3300025929 | Bacteria | 1203 |
| 230 | Ga0207706_10052787 | 3300025933 | Bacteria | 3589 |
| 231 | Ga0207706_10091667 | 3300025933 | Bacteria | 2672 |
| 232 | Ga0207709_10039217 | 3300025935 | Bacteria | 2828 |
| 233 | Ga0207709_10208895 | 3300025935 | Unclassified | 1400 |
| 234 | Ga0207670_10024520 | 3300025936 | Bacteria | 3771 |
| 235 | Ga0207704_10188495 | 3300025938 | Unclassified | 1498 |
| 236 | Ga0207665_10020792 | 3300025939 | Bacteria | 4315 |
| 237 | Ga0207689_10198934 | 3300025942 | Unclassified | 1654 |
| 238 | Ga0207661_10017520 | 3300025944 | Bacteria | 5304 |
| 239 | Ga0207661_10050866 | 3300025944 | Bacteria | 3304 |
| 240 | Ga0207661_10168478 | 3300025944 | Bacteria | 1905 |
| 241 | Ga0207661_10224762 | 3300025944 | Bacteria | 1660 |
| 242 | Ga0207661_10288400 | 3300025944 | Bacteria | 1468 |
| 243 | Ga0207679_10529355 | 3300025945 | Bacteria | 1055 |
| 244 | Ga0207667_10127836 | 3300025949 | Bacteria | 2617 |
| 245 | Ga0207667_10171349 | 3300025949 | Bacteria | 2231 |
| 246 | Ga0207667_10202628 | 3300025949 | Bacteria | 2035 |
| 247 | Ga0207667_10276277 | 3300025949 | Bacteria | 1717 |
| 248 | Ga0207667_10309772 | 3300025949 | Archaea | 1613 |
| 249 | Ga0207667_10632783 | 3300025949 | Unclassified | 1077 |
| 250 | Ga0207712_10211403 | 3300025961 | Unclassified | 1545 |
| 251 | Ga0207640_10048646 | 3300025981 | Bacteria | 2742 |
| 252 | Ga0207658_10066502 | 3300025986 | Bacteria | 2711 |
| 253 | Ga0207677_10152144 | 3300026023 | Bacteria | 1787 |
| 254 | Ga0207703_10075577 | 3300026035 | Bacteria | 2792 |
| 255 | Ga0207678_10229610 | 3300026067 | Bacteria | 1589 |
| 256 | Ga0207708_10106658 | 3300026075 | Bacteria | 2172 |
| 257 | Ga0207708_10323231 | 3300026075 | Bacteria | 1260 |
| 258 | Ga0207702_10189255 | 3300026078 | Bacteria | 1900 |
| 259 | Ga0207641_10617967 | 3300026088 | Bacteria | 1062 |
| 260 | Ga0207674_10113718 | 3300026116 | Bacteria | 2679 |
| 261 | Ga0207675_100023645 | 3300026118 | Bacteria | 5716 |
| 262 | Ga0207675_100174178 | 3300026118 | Bacteria | 2058 |
| 263 | Ga0207683_10077641 | 3300026121 | Bacteria | 2941 |
| 264 | Ga0207698_10430687 | 3300026142 | Bacteria | 1268 |
| 265 | Ga0207428_10064900 | 3300027907 | Bacteria | 2882 |
| 266 | Ga0207428_10123483 | 3300027907 | Unclassified | 1984 |
| 267 | Ga0207428_10270014 | 3300027907 | Bacteria | 1265 |
| 268 | Ga0268265_10199209 | 3300028380 | Bacteria | 1736 |
| 269 | Ga0268265_10319183 | 3300028380 | Unclassified | 1406 |
| 270 | Ga0268264_10580102 | 3300028381 | Bacteria | 1103 |
| 271 | Ga0265318_10068149 | 3300028577 | Bacteria | 1320 |
| 272 | Ga0265338_10048183 | 3300028800 | Bacteria | 3880 |
| 273 | Ga0265330_10061397 | 3300031235 | Bacteria | 1635 |
| 274 | Ga0265339_10052350 | 3300031249 | Bacteria | 2224 |
| 275 | Ga0265327_10020702 | 3300031251 | Bacteria | 3996 |
| 276 | Ga0265316_10080186 | 3300031344 | Bacteria | 2503 |
| 277 | Ga0307408_100116923 | 3300031548 | Bacteria | 2059 |
| 278 | Ga0265313_10025499 | 3300031595 | Bacteria | 3131 |
| 279 | Ga0265314_10007254 | 3300031711 | Bacteria | 9631 |
| 280 | Ga0265342_10063214 | 3300031712 | Bacteria | 2176 |
| 281 | Ga0307405_10006258 | 3300031731 | Bacteria | 5839 |
| 282 | Ga0307405_10069514 | 3300031731 | Bacteria | 2258 |
| 283 | Ga0307405_10097403 | 3300031731 | Bacteria | 1964 |
| 284 | Ga0307405_10311084 | 3300031731 | Bacteria | 1199 |
| 285 | Ga0307410_10006439 | 3300031852 | Bacteria | 6337 |
| 286 | Ga0307410_10388948 | 3300031852 | Bacteria | 1124 |
| 287 | Ga0307406_10155230 | 3300031901 | Bacteria | 1638 |
| 288 | Ga0307406_10472807 | 3300031901 | Unclassified | 1010 |
| 289 | Ga0307407_10115005 | 3300031903 | Unclassified | 1695 |
| 290 | Ga0307412_10016331 | 3300031911 | Bacteria | 4421 |
| 291 | Ga0307412_10264840 | 3300031911 | Bacteria | 1342 |
| 292 | Ga0307409_100039272 | 3300031995 | Bacteria | 3510 |
| 293 | Ga0307409_100096010 | 3300031995 | Bacteria | 2444 |
| 294 | Ga0307416_100083345 | 3300032002 | Bacteria | 2712 |
| 295 | Ga0307416_100170118 | 3300032002 | Bacteria | 2027 |
| 296 | Ga0307416_100243881 | 3300032002 | Bacteria | 1743 |
| 297 | Ga0307414_10492618 | 3300032004 | Unclassified | 1083 |
| 298 | Ga0307411_10052108 | 3300032005 | Bacteria | 2674 |
| 299 | Ga0307415_100007518 | 3300032126 | Bacteria | 5965 |
| 300 | Ga0307415_100040998 | 3300032126 | Bacteria | 3071 |
| 301 | Ga0307415_100304675 | 3300032126 | Bacteria | 1321 |
| 302 | Ga0373948_0001620 | 3300034817 | Bacteria | 3172 |
| 303 | Ga0373926_0032926 | 3300035083 | Bacteria | 1830 |
| 304 | Ga0373926_0035784 | 3300035083 | Bacteria | 1762 |
| 305 | Ga0373944_0007792 | 3300035089 | Bacteria | 2879 |
| 306 | Ga0373949_0019618 | 3300035090 | Unclassified | 1541 |
| 307 | Ga0373951_0002727 | 3300035091 | Bacteria | 4421 |
| 308 | Ga0373936_0014314 | 3300035113 | Bacteria | 3029 |
| 309 | Ga0373941_0011974 | 3300035115 | Unclassified | 2255 |
| 310 | Ga0373945_0003422 | 3300035116 | Bacteria | 4992 |
| 311 | Ga0373945_0013486 | 3300035116 | Bacteria | 2728 |
| 312 | Ga0373954_0084119 | 3300035118 | Bacteria | 1523 |
| 313 | Ga0373956_0050165 | 3300035119 | Bacteria | 1873 |
| 314 | Ga0373957_0053652 | 3300035120 | Bacteria | 1547 |
| 315 | Ga0373960_0011429 | 3300035121 | Unclassified | 2187 |
| 316 | Ga0373943_0000896 | 3300035170 | Bacteria | 13120 |
| 317 | Ga0373943_0003423 | 3300035170 | Bacteria | 7229 |
| 318 | Ga0373943_0012785 | 3300035170 | Bacteria | 3784 |
| 319 | Ga0373946_0005596 | 3300035171 | Bacteria | 4536 |
| 320 | Ga0373946_0062301 | 3300035171 | Bacteria | 1590 |
| 321 | Ga0373955_0073204 | 3300035172 | Bacteria | 1920 |
| 322 | Ga0373942_0002046 | 3300035207 | Bacteria | 5013 |
| 323 | Ga0373961_0084766 | 3300035241 | Unclassified | 1002 |
| 324 | Ga0373962_0012237 | 3300035242 | Bacteria | 2159 |
| 325 | Ga0373931_0004257 | 3300035691 | Bacteria | 6514 |
| 326 | Ga0373935_0014820 | 3300035692 | Bacteria | 4707 |
| 327 | Ga0373935_0179712 | 3300035692 | Bacteria | 1452 |
| 328 | Ga0373947_0012053 | 3300035725 | Bacteria | 4951 |
| 329 | Ga0373947_0026069 | 3300035725 | Bacteria | 3412 |
| 330 | Ga0373947_0144032 | 3300035725 | Bacteria | 1530 |
| 331 | Ga0373937_0047884 | 3300036401 | Bacteria | 3912 |
| 332 | Ga0373925_0001681 | 3300037068 | Bacteria | 18616 |
| 333 | Ga0373925_0008347 | 3300037068 | Bacteria | 7541 |
| 334 | Ga0395899_0000727 | 3300037312 | Bacteria | 32895 |
| 335 | Ga0395899_0018343 | 3300037312 | Bacteria | 5318 |
| 336 | Ga0395899_0025523 | 3300037312 | Bacteria | 4460 |
| 337 | Ga0395899_0031204 | 3300037312 | Bacteria | 4005 |
| 338 | Ga0395899_0038751 | 3300037312 | Bacteria | 3568 |
| 339 | Ga0395899_0174170 | 3300037312 | Bacteria | 1514 |
| 340 | Ga0395900_0005981 | 3300037418 | Bacteria | 12702 |
| 341 | Ga0395900_0006517 | 3300037418 | Bacteria | 12165 |
| 342 | Ga0395900_0011622 | 3300037418 | Bacteria | 9009 |
| 343 | Ga0395900_0023255 | 3300037418 | Bacteria | 6343 |
| 344 | Ga0395900_0023967 | 3300037418 | Bacteria | 6244 |
| 345 | Ga0395900_0046407 | 3300037418 | Bacteria | 4474 |
| 346 | Ga0395900_0051599 | 3300037418 | Bacteria | 4236 |
| 347 | Ga0395900_0060520 | 3300037418 | Bacteria | 3897 |
| 348 | Ga0395900_0119757 | 3300037418 | Bacteria | 2701 |
| 349 | Ga0395900_0154041 | 3300037418 | Bacteria | 2348 |
| 350 | Ga0395900_0160386 | 3300037418 | Bacteria | 2294 |
| 351 | Ga0395900_0294349 | 3300037418 | Bacteria | 1611 |
| 352 | Ga0395900_0355165 | 3300037418 | Bacteria | 1438 |
| 353 | Ga0395898_0007522 | 3300037466 | Bacteria | 11578 |
| 354 | Ga0395898_0022336 | 3300037466 | Bacteria | 6407 |
| 355 | Ga0395898_0045062 | 3300037466 | Bacteria | 4336 |
| 356 | Ga0395898_0067737 | 3300037466 | Bacteria | 3455 |
| 357 | Ga0395898_0070596 | 3300037466 | Bacteria | 3376 |
| 358 | Ga0395898_0082474 | 3300037466 | Bacteria | 3099 |
| 359 | Ga0395898_0116146 | 3300037466 | Bacteria | 2564 |
| 360 | Ga0395898_0204673 | 3300037466 | Bacteria | 1883 |
| 361 | Ga0395898_0296706 | 3300037466 | Bacteria | 1542 |
| 362 | Ga0395898_0439523 | 3300037466 | Bacteria | 1243 |
| 363 | Ga0395905_0002457 | 3300037471 | Bacteria | 20517 |
| 364 | Ga0395905_0010592 | 3300037471 | Bacteria | 8953 |
| 365 | Ga0395905_0028622 | 3300037471 | Bacteria | 5252 |
| 366 | Ga0395905_0032610 | 3300037471 | Bacteria | 4898 |
| 367 | Ga0395905_0037496 | 3300037471 | Bacteria | 4550 |
| 368 | Ga0395905_0046598 | 3300037471 | Bacteria | 4065 |
| 369 | Ga0395905_0053398 | 3300037471 | Bacteria | 3782 |
| 370 | Ga0395905_0063264 | 3300037471 | Bacteria | 3462 |
| 371 | Ga0395905_0172691 | 3300037471 | Bacteria | 2030 |
| 372 | Ga0395905_0282512 | 3300037471 | Bacteria | 1546 |
| 373 | Ga0395905_0317863 | 3300037471 | Bacteria | 1446 |
| 374 | Ga0395905_0610102 | 3300037471 | Bacteria | 993 |
| 375 | Ga0395901_0003418 | 3300038443 | Bacteria | 15999 |
| 376 | Ga0395901_0007676 | 3300038443 | Bacteria | 10880 |
| 377 | Ga0395901_0009332 | 3300038443 | Bacteria | 9946 |
| 378 | Ga0395901_0009579 | 3300038443 | Bacteria | 9830 |
| 379 | Ga0395901_0011618 | 3300038443 | Bacteria | 8919 |
| 380 | Ga0395901_0012040 | 3300038443 | Bacteria | 8775 |
| 381 | Ga0395901_0013640 | 3300038443 | Bacteria | 8263 |
| 382 | Ga0395901_0014388 | 3300038443 | Bacteria | 8053 |
| 383 | Ga0395901_0015943 | 3300038443 | Bacteria | 7654 |
| 384 | Ga0395901_0020472 | 3300038443 | Bacteria | 6770 |
| 385 | Ga0395901_0032261 | 3300038443 | Bacteria | 5404 |
| 386 | Ga0395901_0058602 | 3300038443 | Bacteria | 4005 |
| 387 | Ga0395901_0062685 | 3300038443 | Bacteria | 3869 |
| 388 | Ga0395901_0066779 | 3300038443 | Bacteria | 3745 |
| 389 | Ga0395901_0072874 | 3300038443 | Bacteria | 3581 |
| 390 | Ga0395901_0104240 | 3300038443 | Bacteria | 2976 |
| 391 | Ga0395901_0113815 | 3300038443 | Bacteria | 2841 |
| 392 | Ga0395901_0184873 | 3300038443 | Bacteria | 2186 |
| 393 | Ga0436365_0152440 | 3300039437 | Bacteria | 1268 |
| 394 | Ga0436365_1603605 | 3300039437 | Bacteria | 3728 |
| 395 | Ga0439451_001447 | 3300042009 | Bacteria | 4691 |
| 396 | Ga0439458_0002517 | 3300042157 | Bacteria | 4446 |
| 397 | Ga0450918_006233 | 3300042531 | Bacteria | 2130 |
| 398 | Ga0466969_0036211 | 3300044656 | Bacteria | 2494 |
| 399 | Ga0466965_0024340 | 3300044683 | Bacteria | 2928 |
| 400 | Ga0466965_0213116 | 3300044683 | Unclassified | 1027 |
| 401 | Ga0466966_0004783 | 3300044684 | Bacteria | 8909 |
| 402 | Ga0466966_0015008 | 3300044684 | Bacteria | 5125 |
| 403 | Ga0466961_0003118 | 3300044693 | Bacteria | 10313 |
| 404 | Ga0466961_0009477 | 3300044693 | Bacteria | 6202 |
| 405 | Ga0466961_0069788 | 3300044693 | Bacteria | 2230 |
| 406 | Ga0466963_0002364 | 3300044694 | Bacteria | 10534 |
| 407 | Ga0466963_0010083 | 3300044694 | Bacteria | 5712 |
| 408 | Ga0466963_0034714 | 3300044694 | Bacteria | 3283 |
| 409 | Ga0466963_0073576 | 3300044694 | Bacteria | 2304 |
| 410 | Ga0466963_0075203 | 3300044694 | Bacteria | 2279 |
| 411 | Ga0466963_0079497 | 3300044694 | Bacteria | 2218 |
| 412 | Ga0466963_0113336 | 3300044694 | Bacteria | 1862 |
| 413 | Ga0466963_0142401 | 3300044694 | Viruses | 1661 |
| 414 | Ga0466963_0321393 | 3300044694 | Bacteria | 1089 |
| 415 | Ga0466963_0380074 | 3300044694 | Bacteria | 995 |
| 416 | Ga0466964_0000962 | 3300044706 | Bacteria | 9518 |
| 417 | Ga0466964_0008547 | 3300044706 | Bacteria | 3848 |
| 418 | Ga0466964_0198219 | 3300044706 | Bacteria | 962 |
| 419 | Ga0466971_0026919 | 3300044719 | Bacteria | 2573 |
| 420 | Ga0466968_0092963 | 3300044735 | Bacteria | 1339 |
| 421 | Ga0466970_0055482 | 3300044765 | Bacteria | 2116 |
| 422 | Ga0466970_0059078 | 3300044765 | Unclassified | 2054 |
| 423 | Ga0466970_0149514 | 3300044765 | Unclassified | 1289 |
| 424 | Ga0466957_0014153 | 3300044842 | Bacteria | 4641 |
| 425 | Ga0466957_0026965 | 3300044842 | Bacteria | 3411 |
| 426 | Ga0466957_0039452 | 3300044842 | Bacteria | 2849 |
| 427 | Ga0466960_0101967 | 3300044901 | Bacteria | 1479 |
| 428 | Ga0466959_0005640 | 3300045049 | Bacteria | 8611 |
| 429 | Ga0466959_0007161 | 3300045049 | Bacteria | 7807 |
| 430 | Ga0466959_0023477 | 3300045049 | Bacteria | 4564 |
| 431 | Ga0466959_0120779 | 3300045049 | Bacteria | 1863 |
| 432 | Ga0466959_0234141 | 3300045049 | Bacteria | 1270 |
| 433 | Ga0451576_0425039 | 3300045051 | Bacteria | 1394 |
| 434 | Ga0451576_0480834 | 3300045051 | Unclassified | 1304 |
| 435 | Ga0466958_0006317 | 3300045836 | Bacteria | 6440 |
| 436 | Ga0466958_0011009 | 3300045836 | Bacteria | 5085 |
| 437 | Ga0466958_0029630 | 3300045836 | Bacteria | 3248 |
| 438 | Ga0466958_0085286 | 3300045836 | Bacteria | 1948 |
| 439 | Ga0466958_0124907 | 3300045836 | Bacteria | 1613 |
| 440 | Ga0466967_0000274 | 3300045976 | Bacteria | 22748 |
| 441 | Ga0466967_0004211 | 3300045976 | Bacteria | 9644 |
| 442 | Ga0466967_0012534 | 3300045976 | Bacteria | 6491 |
| 443 | Ga0466967_0101630 | 3300045976 | Bacteria | 2628 |
| 444 | Ga0466967_0143139 | 3300045976 | Bacteria | 2228 |
| 445 | Ga0466967_0235771 | 3300045976 | Bacteria | 1744 |
| 446 | Ga0495592_0126513 | 3300046454 | Bacteria | 1792 |
| 447 | Ga0495592_0252611 | 3300046454 | Bacteria | 1164 |
| 448 | Ga0495629_0009665 | 3300046459 | Bacteria | 7044 |
| 449 | Ga0495629_0027009 | 3300046459 | Bacteria | 4077 |
| 450 | Ga0495641_0011337 | 3300046461 | Bacteria | 5088 |
| 451 | Ga0495641_0027081 | 3300046461 | Bacteria | 2791 |
| 452 | Ga0495651_0031660 | 3300046462 | Bacteria | 4124 |
| 453 | Ga0495651_0086137 | 3300046462 | Unclassified | 2364 |
| 454 | Ga0495653_0025779 | 3300046463 | Bacteria | 4717 |
| 455 | Ga0495653_0028795 | 3300046463 | Bacteria | 4440 |
| 456 | Ga0495653_0112838 | 3300046463 | Bacteria | 1950 |
| 457 | Ga0495582_0000050 | 3300046473 | Bacteria | 59164 |
| 458 | Ga0495582_0135719 | 3300046473 | Bacteria | 1392 |
| 459 | Ga0495605_0092506 | 3300046474 | Bacteria | 1400 |
| 460 | Ga0495605_0141309 | 3300046474 | Bacteria | 1080 |
| 461 | Ga0495639_0001750 | 3300046475 | Bacteria | 9636 |
| 462 | Ga0495662_0004271 | 3300046476 | Bacteria | 7186 |
| 463 | Ga0495664_0054505 | 3300046477 | Bacteria | 2378 |
| 464 | Ga0495664_0105999 | 3300046477 | Unclassified | 1695 |
| 465 | Ga0495664_0180185 | 3300046477 | Bacteria | 1281 |
| 466 | Ga0495594_0057551 | 3300046499 | Bacteria | 2147 |
| 467 | Ga0495596_0043683 | 3300046500 | Bacteria | 1766 |
| 468 | Ga0495607_0122319 | 3300046501 | Bacteria | 1364 |
| 469 | Ga0495608_0001715 | 3300046511 | Bacteria | 15720 |
| 470 | Ga0495608_0013267 | 3300046511 | Bacteria | 5717 |
| 471 | Ga0495616_0055272 | 3300046513 | Bacteria | 1966 |
| 472 | Ga0495618_0042286 | 3300046514 | Bacteria | 2872 |
| 473 | Ga0495618_0126144 | 3300046514 | Unclassified | 1639 |
| 474 | Ga0495618_0206067 | 3300046514 | Unclassified | 1244 |
| 475 | Ga0495628_0035111 | 3300046516 | Bacteria | 4031 |
| 476 | Ga0495628_0195811 | 3300046516 | Bacteria | 1525 |
| 477 | Ga0495630_0009961 | 3300046517 | Bacteria | 6843 |
| 478 | Ga0495630_0077032 | 3300046517 | Unclassified | 2513 |
| 479 | Ga0495643_0180867 | 3300046522 | Bacteria | 1025 |
| 480 | Ga0495663_0004137 | 3300046525 | Bacteria | 4104 |
| 481 | Ga0495666_0024194 | 3300046526 | Bacteria | 3001 |
| 482 | Ga0495666_0084513 | 3300046526 | Unclassified | 1499 |
| 483 | Ga0495652_0238094 | 3300046529 | Bacteria | 1356 |
| 484 | Ga0495665_0044867 | 3300046531 | Unclassified | 2348 |
| 485 | Ga0495640_0005917 | 3300046533 | Bacteria | 9697 |
| 486 | Ga0495640_0023452 | 3300046533 | Bacteria | 4494 |
| 487 | Ga0495640_0097540 | 3300046533 | Bacteria | 1932 |
| 488 | Ga0495597_0034082 | 3300046542 | Bacteria | 2302 |
| 489 | Ga0495645_0054213 | 3300046543 | Bacteria | 2914 |
| 490 | Ga0495645_0109769 | 3300046543 | Bacteria | 1953 |
| 491 | Ga0495667_0007872 | 3300046559 | Bacteria | 7223 |
| 492 | Ga0495667_0033197 | 3300046559 | Bacteria | 3454 |
| 493 | Ga0495667_0048616 | 3300046559 | Unclassified | 2800 |
| 494 | Ga0495667_0180588 | 3300046559 | Unclassified | 1354 |
| 495 | Ga0495634_0009879 | 3300046642 | Bacteria | 7018 |
| 496 | Ga0495634_0016648 | 3300046642 | Bacteria | 5254 |
| 497 | Ga0495634_0075449 | 3300046642 | Bacteria | 2214 |
| 498 | Ga0495611_0113015 | 3300046648 | Bacteria | 1265 |
| 499 | Ga0495635_0011303 | 3300046663 | Bacteria | 6262 |
| 500 | Ga0495659_0029846 | 3300046664 | Bacteria | 1895 |
| 501 | Ga0495657_0048654 | 3300046675 | Bacteria | 2859 |
| 502 | Ga0495657_0078052 | 3300046675 | Bacteria | 2147 |
| 503 | Ga0495599_0028024 | 3300046678 | Bacteria | 3529 |
| 504 | Ga0495599_0055552 | 3300046678 | Unclassified | 2479 |
| 505 | Ga0495646_0035446 | 3300046680 | Bacteria | 3095 |
| 506 | Ga0495658_0000020 | 3300046683 | Bacteria | 87200 |
| 507 | Ga0495658_0194097 | 3300046683 | Bacteria | 1263 |
| 508 | Ga0495658_0214598 | 3300046683 | Unclassified | 1203 |
| 509 | Ga0495669_0057228 | 3300046684 | Bacteria | 1759 |
| 510 | Ga0495613_0009224 | 3300046689 | Bacteria | 7316 |
| 511 | Ga0495624_0112428 | 3300046690 | Bacteria | 1674 |
| 512 | Ga0495670_0052006 | 3300046691 | Bacteria | 2050 |
| 513 | Ga0495589_0064836 | 3300046794 | Bacteria | 1791 |
| 514 | Ga0495600_0074456 | 3300046809 | Bacteria | 2217 |
| 515 | Ga0495600_0124381 | 3300046809 | Unclassified | 1677 |
| 516 | Ga0495581_0009383 | 3300047315 | Bacteria | 5662 |
| 517 | Ga0495581_0162157 | 3300047315 | Bacteria | 1307 |
| 518 | Ga0495604_0096696 | 3300047317 | Bacteria | 2178 |
| 519 | Ga0495604_0105022 | 3300047317 | Bacteria | 2068 |
| 520 | Ga0495604_0114215 | 3300047317 | Bacteria | 1964 |
| 521 | Ga0495674_0001037 | 3300047319 | Bacteria | 26704 |
| 522 | Ga0495674_0025803 | 3300047319 | Bacteria | 5382 |
| 523 | Ga0495674_0041714 | 3300047319 | Bacteria | 4097 |
| 524 | Ga0495674_0217454 | 3300047319 | Bacteria | 1581 |
| 525 | Ga0495676_0000506 | 3300047321 | Bacteria | 31895 |
| 526 | Ga0495676_0035591 | 3300047321 | Bacteria | 4163 |
| 527 | Ga0495680_0002190 | 3300047322 | Bacteria | 20224 |
| 528 | Ga0495680_0092950 | 3300047322 | Bacteria | 2258 |
| 529 | Ga0495680_0202417 | 3300047322 | Bacteria | 1424 |
| 530 | Ga0495683_0087730 | 3300047323 | Bacteria | 1511 |
| 531 | Ga0495675_0069998 | 3300047444 | Bacteria | 2215 |
| 532 | Ga0495675_0082335 | 3300047444 | Unclassified | 2026 |
| 533 | Ga0495681_0084052 | 3300047470 | Unclassified | 1416 |
| 534 | Ga0495684_0004005 | 3300047471 | Bacteria | 11492 |
| 535 | Ga0495684_0020811 | 3300047471 | Bacteria | 5055 |
| 536 | Ga0495684_0080790 | 3300047471 | Bacteria | 2468 |
| 537 | Ga0495684_0298972 | 3300047471 | Bacteria | 1157 |
| 538 | Ga0495593_0084994 | 3300047673 | Bacteria | 1633 |
| 539 | Ga0495593_0103371 | 3300047673 | Bacteria | 1459 |
| 540 | Ga0495602_0029350 | 3300048088 | Bacteria | 5239 |
| 541 | Ga0495602_0073284 | 3300048088 | Bacteria | 2915 |
| 542 | Ga0495602_0210742 | 3300048088 | Bacteria | 1475 |
| 543 | Ga0495615_0025802 | 3300048090 | Bacteria | 1367 |
| 544 | Ga0495626_0074170 | 3300048091 | Bacteria | 1523 |
| 545 | Ga0496100_0118214 | 3300048903 | Bacteria | 1851 |
| 546 | Ga0496100_0307916 | 3300048903 | Unclassified | 1187 |
| 547 | Ga0496101_0003495 | 3300048904 | Bacteria | 9803 |
| 548 | Ga0496101_0020946 | 3300048904 | Bacteria | 4486 |
| 549 | Ga0496102_0275912 | 3300048905 | Unclassified | 1584 |
| 550 | Ga0496102_0418130 | 3300048905 | Unclassified | 1259 |
| 551 | Ga0496103_0112072 | 3300048906 | Bacteria | 1733 |
| 552 | Ga0496104_0011816 | 3300048907 | Bacteria | 7834 |
| 553 | Ga0496104_0152638 | 3300048907 | Unclassified | 2216 |
| 554 | Ga0496104_0168650 | 3300048907 | Bacteria | 2099 |
| 555 | Ga0496104_0193011 | 3300048907 | Bacteria | 1948 |
| 556 | Ga0496105_0005669 | 3300048908 | Bacteria | 9502 |
| 557 | Ga0496105_0064450 | 3300048908 | Bacteria | 3023 |
| 558 | Ga0496105_0106504 | 3300048908 | Bacteria | 2314 |
| 559 | Ga0496105_0268819 | 3300048908 | Unclassified | 1377 |
| 560 | Ga0496106_0014672 | 3300048909 | Bacteria | 5791 |
| 561 | Ga0496106_0051381 | 3300048909 | Bacteria | 3108 |
| 562 | Ga0496106_0090498 | 3300048909 | Bacteria | 2361 |
| 563 | Ga0496106_0163011 | 3300048909 | Bacteria | 1764 |
| 564 | Ga0496106_0246547 | 3300048909 | Bacteria | 1427 |
| 565 | Ga0496106_0485236 | 3300048909 | Unclassified | 993 |
| 566 | Ga0496107_0002933 | 3300048910 | Bacteria | 11281 |
| 567 | Ga0496107_0054382 | 3300048910 | Bacteria | 2889 |
| 568 | Ga0496107_0089191 | 3300048910 | Bacteria | 2252 |
| 569 | Ga0496107_0217345 | 3300048910 | Unclassified | 1421 |
| 570 | Ga0496108_0005600 | 3300048911 | Bacteria | 10164 |
| 571 | Ga0496108_0008011 | 3300048911 | Bacteria | 8573 |
| 572 | Ga0496108_0078291 | 3300048911 | Bacteria | 2798 |
| 573 | Ga0496109_0002295 | 3300048912 | Bacteria | 15905 |
| 574 | Ga0496109_0023166 | 3300048912 | Bacteria | 5509 |
| 575 | Ga0496109_0031992 | 3300048912 | Bacteria | 4726 |
| 576 | Ga0496109_0067373 | 3300048912 | Bacteria | 3279 |
| 577 | Ga0496109_0105115 | 3300048912 | Bacteria | 2622 |
| 578 | Ga0496109_0609049 | 3300048912 | Bacteria | 1028 |
| 579 | Ga0496110_0001066 | 3300048913 | Bacteria | 19357 |
| 580 | Ga0496110_0125325 | 3300048913 | Bacteria | 2317 |
| 581 | Ga0496110_0316935 | 3300048913 | Bacteria | 1420 |
| 582 | Ga0496111_0200515 | 3300048914 | Archaea | 1483 |
| 583 | Ga0496111_0334950 | 3300048914 | Bacteria | 1120 |
| 584 | Ga0496112_0023125 | 3300048915 | Bacteria | 5933 |
| 585 | Ga0496112_0030821 | 3300048915 | Bacteria | 5195 |
| 586 | Ga0496112_0047360 | 3300048915 | Bacteria | 4218 |
| 587 | Ga0496112_0115948 | 3300048915 | Unclassified | 2649 |
| 588 | Ga0496112_0140078 | 3300048915 | Bacteria | 2388 |
| 589 | Ga0496112_0173396 | 3300048915 | Bacteria | 2122 |
| 590 | Ga0496112_0313618 | 3300048915 | Bacteria | 1513 |
| 591 | Ga0496112_0447654 | 3300048915 | Bacteria | 1229 |
| 592 | Ga0496113_0032205 | 3300048916 | Bacteria | 3809 |
| 593 | Ga0496113_0068157 | 3300048916 | Bacteria | 2700 |
| 594 | Ga0496114_0005004 | 3300048917 | Bacteria | 10338 |
| 595 | Ga0496114_0015601 | 3300048917 | Bacteria | 6109 |
| 596 | Ga0496114_0069959 | 3300048917 | Bacteria | 2947 |
| 597 | Ga0496115_0007400 | 3300048918 | Bacteria | 8077 |
| 598 | Ga0496115_0016446 | 3300048918 | Bacteria | 5634 |
| 599 | Ga0496115_0017710 | 3300048918 | Bacteria | 5453 |
| 600 | Ga0496115_0019498 | 3300048918 | Bacteria | 5220 |
| 601 | Ga0501031_0000045 | 3300049568 | Bacteria | 66639 |
| 602 | Ga0501031_0009046 | 3300049568 | Bacteria | 6480 |
| 603 | Ga0501032_0000545 | 3300049569 | Bacteria | 30507 |
| 604 | Ga0501032_0065513 | 3300049569 | Unclassified | 2429 |
| 605 | Ga0501033_0000698 | 3300049570 | Bacteria | 31022 |
| 606 | Ga0501033_0006732 | 3300049570 | Bacteria | 8975 |
| 607 | Ga0501034_0021687 | 3300049571 | Bacteria | 6543 |
| 608 | Ga0501034_0169786 | 3300049571 | Bacteria | 2149 |
| 609 | Ga0501036_0002118 | 3300049572 | Bacteria | 15497 |
| 610 | Ga0501036_0006165 | 3300049572 | Bacteria | 9728 |
| 611 | Ga0501037_0000612 | 3300049573 | Bacteria | 27713 |
| 612 | Ga0501037_0018046 | 3300049573 | Bacteria | 5196 |
| 613 | Ga0501038_0000193 | 3300049574 | Bacteria | 52887 |
| 614 | Ga0501038_0004891 | 3300049574 | Bacteria | 12444 |
| 615 | Ga0501039_0006974 | 3300049575 | Bacteria | 8604 |
| 616 | Ga0501040_0000044 | 3300049576 | Bacteria | 57546 |
| 617 | Ga0501040_0000718 | 3300049576 | Bacteria | 20451 |
| 618 | Ga0501040_0010244 | 3300049576 | Bacteria | 6131 |
| 619 | Ga0501041_0000091 | 3300049577 | Bacteria | 36285 |
| 620 | Ga0501041_0001848 | 3300049577 | Bacteria | 11868 |
| 621 | Ga0501041_0035202 | 3300049577 | Bacteria | 3033 |
| 622 | Ga0501042_0000016 | 3300049578 | Bacteria | 51701 |
| 623 | Ga0501042_0001180 | 3300049578 | Bacteria | 15129 |
| 624 | Ga0501042_0200868 | 3300049578 | Unclassified | 1437 |
| 625 | Ga0501043_0000630 | 3300049579 | Bacteria | 31159 |
| 626 | Ga0501043_0032227 | 3300049579 | Bacteria | 4119 |
| 627 | Ga0501046_0000264 | 3300049580 | Bacteria | 53355 |
| 628 | Ga0501046_0002496 | 3300049580 | Bacteria | 17221 |
| 629 | Ga0501047_0000171 | 3300049581 | Bacteria | 79570 |
| 630 | Ga0501047_0099208 | 3300049581 | Bacteria | 2791 |
| 631 | Ga0501047_0158254 | 3300049581 | Unclassified | 2137 |
| 632 | Ga0501048_0001526 | 3300049582 | Bacteria | 17568 |
| 633 | Ga0501048_0001748 | 3300049582 | Bacteria | 16526 |
| 634 | Ga0501048_0281952 | 3300049582 | Unclassified | 1181 |
| 635 | Ga0501067_0000495 | 3300049583 | Bacteria | 21600 |
| 636 | Ga0501067_0013586 | 3300049583 | Bacteria | 4509 |
| 637 | Ga0501067_0269529 | 3300049583 | Bacteria | 948 |
| 638 | Ga0501068_0000025 | 3300049584 | Bacteria | 56674 |
| 639 | Ga0501068_0015392 | 3300049584 | Bacteria | 4391 |
| 640 | Ga0501069_0000196 | 3300049585 | Bacteria | 26733 |
| 641 | Ga0501069_0003131 | 3300049585 | Bacteria | 8476 |
| 642 | Ga0501069_0010875 | 3300049585 | Bacteria | 4821 |
| 643 | Ga0501069_0014233 | 3300049585 | Bacteria | 4249 |
| 644 | Ga0501069_0064078 | 3300049585 | Bacteria | 2054 |
| 645 | Ga0501070_0000514 | 3300049586 | Bacteria | 35487 |
| 646 | Ga0501070_0001651 | 3300049586 | Bacteria | 19790 |
| 647 | Ga0501070_0007569 | 3300049586 | Bacteria | 9227 |
| 648 | Ga0501070_0014550 | 3300049586 | Bacteria | 6620 |
| 649 | Ga0501070_0064405 | 3300049586 | Bacteria | 3036 |
| 650 | Ga0501070_0100237 | 3300049586 | Bacteria | 2396 |
| 651 | Ga0501070_0238137 | 3300049586 | Bacteria | 1490 |
| 652 | Ga0501071_0000006 | 3300049587 | Bacteria | 76967 |
| 653 | Ga0501071_0088379 | 3300049587 | Unclassified | 2273 |
| 654 | Ga0501071_0240768 | 3300049587 | Bacteria | 1364 |
| 655 | Ga0501072_0000143 | 3300049588 | Bacteria | 53349 |
| 656 | Ga0501072_0002757 | 3300049588 | Bacteria | 13205 |
| 657 | Ga0501072_0487286 | 3300049588 | Bacteria | 975 |
| 658 | Ga0501073_0000279 | 3300049589 | Bacteria | 33733 |
| 659 | Ga0501073_0002058 | 3300049589 | Bacteria | 15033 |
| 660 | Ga0501074_0000078 | 3300049590 | Bacteria | 47463 |
| 661 | Ga0501074_0004760 | 3300049590 | Bacteria | 9728 |
| 662 | Ga0501075_0000044 | 3300049591 | Bacteria | 51077 |
| 663 | Ga0501075_0002360 | 3300049591 | Bacteria | 12538 |
| 664 | Ga0501076_0000334 | 3300049592 | Bacteria | 29117 |
| 665 | Ga0501076_0008077 | 3300049592 | Bacteria | 7691 |
| 666 | Ga0501077_0006572 | 3300049593 | Bacteria | 7138 |
| 667 | Ga0501077_0014651 | 3300049593 | Bacteria | 4928 |
| 668 | Ga0501077_0143669 | 3300049593 | Bacteria | 1514 |
| 669 | Ga0501225_0052482 | 3300049705 | Bacteria | 1137 |
| 670 | Ga0501079_0000008 | 3300049741 | Bacteria | 75650 |
| 671 | Ga0501079_0000286 | 3300049741 | Bacteria | 31231 |
| 672 | Ga0501079_0138880 | 3300049741 | Bacteria | 1893 |
| 673 | Ga0501079_0577230 | 3300049741 | Unclassified | 884 |
| 674 | Ga0501080_0001884 | 3300049742 | Bacteria | 18045 |
| 675 | Ga0501080_0008885 | 3300049742 | Bacteria | 9136 |
| 676 | Ga0501080_0188321 | 3300049742 | Bacteria | 1897 |
| 677 | Ga0501081_0000020 | 3300049743 | Bacteria | 56347 |
| 678 | Ga0501081_0001702 | 3300049743 | Bacteria | 13646 |
| 679 | Ga0501083_0000175 | 3300049744 | Bacteria | 41315 |
| 680 | Ga0501083_0002332 | 3300049744 | Bacteria | 12983 |
| 681 | Ga0501035_0000993 | 3300049822 | Bacteria | 29972 |
| 682 | Ga0501035_0004199 | 3300049822 | Bacteria | 13689 |
| 683 | Ga0501035_0325760 | 3300049822 | Bacteria | 1290 |
| 684 | Ga0501044_0001032 | 3300049823 | Bacteria | 33566 |
| 685 | Ga0501044_0004011 | 3300049823 | Bacteria | 16495 |
| 686 | Ga0501044_0183089 | 3300049823 | Bacteria | 2061 |
| 687 | Ga0501044_0288177 | 3300049823 | Unclassified | 1574 |
| 688 | Ga0501045_0000036 | 3300049824 | Bacteria | 57085 |
| 689 | Ga0501045_0001036 | 3300049824 | Bacteria | 18271 |
| 690 | Ga0501045_0122534 | 3300049824 | Bacteria | 1930 |
| 691 | nmdc:mga0yw44_239705_c1 | 3300050492 | Unclassified | 1205 |
| 692 | nmdc:mga05p37_573705_c1 | 3300050507 | Unclassified | 1279 |
| 693 | nmdc:mga05p37_7413_c1 | 3300050507 | Bacteria | 12942 |
| 694 | nmdc:mga05p37_85942_c1 | 3300050507 | Bacteria | 3877 |
| 695 | nmdc:mga08y16_22314_c1 | 3300050511 | Bacteria | 6680 |
| 696 | nmdc:mga08y16_67021_c1 | 3300050511 | Bacteria | 3746 |
| 697 | nmdc:mga0n895_18845_c1 | 3300050512 | Bacteria | 6398 |
| 698 | nmdc:mga0n895_75211_c1 | 3300050512 | Bacteria | 3357 |
| 699 | nmdc:mga0rr50_17983_c1 | 3300050513 | Bacteria | 4736 |
| 700 | nmdc:mga08x19_38995_c1 | 3300050514 | Bacteria | 3019 |
| 701 | nmdc:mga0a205_138633_c1 | 3300050515 | Bacteria | 2333 |
| 702 | Ga0495601_0174520 | 3300053077 | Unclassified | 1405 |
| 703 | Ga0495595_0001549 | 3300053084 | Bacteria | 8957 |
| 704 | Ga0495619_0002214 | 3300053085 | Bacteria | 12875 |
| 705 | Ga0495619_0033154 | 3300053085 | Bacteria | 3353 |
| 706 | Ga0495619_0135566 | 3300053085 | Unclassified | 1693 |
| 707 | Ga0495619_0169063 | 3300053085 | Bacteria | 1511 |
| 708 | Ga0501084_0000083 | 3300054114 | Bacteria | 69431 |
| 709 | Ga0501084_0002951 | 3300054114 | Bacteria | 13773 |
| 710 | Ga0501084_0108986 | 3300054114 | Bacteria | 2327 |
| 711 | Ga0501084_0660308 | 3300054114 | Unclassified | 883 |
| 712 | Ga0501082_0000472 | 3300060353 | Bacteria | 35547 |
| 713 | Ga0501082_0004484 | 3300060353 | Bacteria | 12197 |
| 714 | Ga0530510_0000031 | 3300061734 | Bacteria | 63666 |
| 715 | Ga0530510_0002746 | 3300061734 | Bacteria | 12093 |
| 716 | Ga0530510_0011304 | 3300061734 | Bacteria | 6266 |
| 717 | Ga0530510_0061749 | 3300061734 | Unclassified | 2713 |
| 718 | Ga0530510_0077770 | 3300061734 | Bacteria | 2411 |
| 719 | Ga0105239_10205652 | |||
| 720 | Ga0058863_11972964 | |||
| 721 | Ga0070658_10004765 | |||
| 722 | Ga0070658_10141272 | |||
| 723 | Ga0070658_10485368 | |||
| 724 | Ga0070683_100027337 | |||
| 725 | Ga0070683_100050164 | |||
| 726 | Ga0070683_100101969 | |||
| 727 | Ga0070683_100110700 | |||
| 728 | Ga0070683_100206559 | |||
| 729 | Ga0070680_100005763 | |||
| 730 | Ga0070680_100156525 | |||
| 731 | Ga0070680_100183912 | |||
| 732 | Ga0068868_100068586 | |||
| 733 | Ga0068868_100260239 | |||
| 734 | Ga0070660_100001363 | |||
| 735 | Ga0070660_100024109 | |||
| 736 | Ga0070660_100039863 | |||
| 737 | Ga0070660_100116416 | |||
| 738 | Ga0070660_100186467 | |||
| 739 | Ga0070689_100370653 | |||
| 740 | Ga0070661_100113013 | |||
| 741 | Ga0070692_10038517 | |||
| 742 | Ga0070674_100074108 | |||
| 743 | Ga0070674_100446954 | |||
| 744 | Ga0070659_100035834 | |||
| 745 | Ga0070659_100046644 | |||
| 746 | Ga0070667_100193371 | |||
| 747 | Ga0070709_10053812 | |||
| 748 | Ga0070714_100112610 | |||
| 749 | Ga0070710_10158296 | |||
| 750 | Ga0070701_10109210 | |||
| 751 | Ga0070711_100320321 | |||
| 752 | Ga0070705_100567472 | |||
| 753 | Ga0070694_100203240 | |||
| 754 | Ga0070708_100016662 | |||
| 755 | Ga0070708_100071410 | |||
| 756 | Ga0070708_100408321 | |||
| 757 | Ga0070708_100427751 | |||
| 758 | Ga0070663_100248669 | |||
| 759 | Ga0070678_100084189 | |||
| 760 | Ga0070678_100173152 | |||
| 761 | Ga0070678_100222760 | |||
| 762 | Ga0070662_100323530 | |||
| 763 | Ga0070681_10000568 | |||
| 764 | Ga0070681_10001517 | |||
| 765 | Ga0070681_10036756 | |||
| 766 | Ga0070681_10109041 | |||
| 767 | Ga0070681_10212496 | |||
| 768 | Ga0070681_10214587 | |||
| 769 | Ga0070681_10248719 | |||
| 770 | Ga0070706_100500434 | |||
| 771 | Ga0070707_100010491 | |||
| 772 | Ga0070707_100084210 | |||
| 773 | Ga0070707_100161676 | |||
| 774 | Ga0070698_100003138 | |||
| 775 | Ga0070698_100255543 | |||
| 776 | Ga0070699_100238776 | |||
| 777 | Ga0070699_100391542 | |||
| 778 | Ga0070679_100006546 | |||
| 779 | Ga0070679_100016991 | |||
| 780 | Ga0070679_100141564 | |||
| 781 | Ga0070679_100234800 | |||
| 782 | Ga0070679_100327157 | |||
| 783 | Ga0070684_100024169 | |||
| 784 | Ga0070684_100043239 | |||
| 785 | Ga0070684_100065525 | |||
| 786 | Ga0070684_100085591 | |||
| 787 | Ga0070684_100094422 | |||
| 788 | Ga0070684_100299747 | |||
| 789 | Ga0070697_100119828 | |||
| 790 | Ga0070686_100319123 | |||
| 791 | Ga0070696_100028317 | |||
| 792 | Ga0070665_100023734 | |||
| 793 | Ga0070704_100032063 | |||
| 794 | Ga0070704_100155329 | |||
| 795 | Ga0070704_100522237 | |||
| 796 | Ga0068855_100016986 | |||
| 797 | Ga0068855_100049088 | |||
| 798 | Ga0068855_100050501 | |||
| 799 | Ga0068855_100067944 | |||
| 800 | Ga0068855_100089909 | |||
| 801 | Ga0068855_100351002 | |||
| 802 | Ga0070664_100161016 | |||
| 803 | Ga0070664_100300751 | |||
| 804 | Ga0068854_100154724 | |||
| 805 | Ga0068856_100375908 | |||
| 806 | Ga0070702_100068046 | |||
| 807 | Ga0068852_100029065 | |||
| 808 | Ga0068852_100137871 | |||
| 809 | Ga0068852_100224496 | |||
| 810 | Ga0068852_100633444 | |||
| 811 | Ga0068864_100577624 | |||
| 812 | Ga0068861_100301737 | |||
| 813 | Ga0068870_10046637 | |||
| 814 | Ga0068863_100510098 | |||
| 815 | Ga0068858_100241538 | |||
| 816 | Ga0068862_100151888 | |||
| 817 | Ga0068862_100195026 | |||
| 818 | Ga0081455_10004326 | |||
| 819 | Ga0081455_10022328 | |||
| 820 | Ga0081455_10053756 | |||
| 821 | Ga0081455_10100202 | |||
| 822 | Ga0081538_10064751 | |||
| 823 | Ga0081540_1010951 | |||
| 824 | Ga0081539_10005523 | |||
| 825 | Ga0081539_10007543 | |||
| 826 | Ga0070717_10196931 | |||
| 827 | Ga0070717_10207394 | |||
| 828 | Ga0070715_10016269 | |||
| 829 | Ga0070716_100034368 | |||
| 830 | Ga0070712_100036751 | |||
| 831 | Ga0070712_100088083 | |||
| 832 | Ga0070712_100269789 | |||
| 833 | Ga0070712_100428510 | |||
| 834 | Ga0075428_100033962 | |||
| 835 | Ga0075428_100051185 | |||
| 836 | Ga0075431_100165961 | |||
| 837 | Ga0075434_100044743 | |||
| 838 | Ga0075435_100070349 | |||
| 839 | Ga0105250_10039888 | |||
| 840 | Ga0105240_10021422 | |||
| 841 | Ga0105240_10223201 | |||
| 842 | Ga0105240_10249758 | |||
| 843 | Ga0111539_10005856 | |||
| 844 | Ga0111539_10010125 | |||
| 845 | Ga0111539_10011388 | |||
| 846 | Ga0111539_10029299 | |||
| 847 | Ga0105245_10334441 | |||
| 848 | Ga0105245_10703291 | |||
| 849 | Ga0105247_10240089 | |||
| 850 | Ga0114129_10058515 | |||
| 851 | Ga0114129_10064758 | |||
| 852 | Ga0114129_10136272 | |||
| 853 | Ga0114129_10254041 | |||
| 854 | Ga0114129_10517383 | |||
| 855 | Ga0114129_10602776 | |||
| 856 | Ga0105242_10046730 | |||
| 857 | Ga0105242_10338947 | |||
| 858 | Ga0105242_10691359 | |||
| 859 | Ga0105248_10399940 | |||
| 860 | Ga0105237_10062693 | |||
| 861 | Ga0105238_10033143 | |||
| 862 | Ga0105238_10111035 | |||
| 863 | Ga0105249_10152789 | |||
| 864 | Ga0105249_10203964 | |||
| 865 | Ga0105249_10248125 | |||
| 866 | Ga0105239_10133101 | |||
| 867 | Ga0105239_10341078 | |||
| 868 | Ga0105239_10575954 | |||
| 869 | Ga0157371_10429976 | |||
| 870 | Ga0157370_10016279 | |||
| 871 | Ga0157370_10097764 | |||
| 872 | Ga0157370_10144874 | |||
| 873 | Ga0157370_10190051 | |||
| 874 | Ga0157370_10205317 | |||
| 875 | Ga0157369_10001416 | |||
| 876 | Ga0157369_10017845 | |||
| 877 | Ga0157369_10051321 | |||
| 878 | Ga0157369_10286545 | |||
| 879 | Ga0157369_10334865 | |||
| 880 | Ga0157369_10445738 | |||
| 881 | Ga0157374_10048009 | |||
| 882 | Ga0157374_10525385 | |||
| 883 | Ga0157378_10103510 | |||
| 884 | Ga0157372_10152133 | |||
| 885 | Ga0157372_10270280 | |||
| 886 | Ga0157375_11329889 | |||
| 887 | Ga0157380_10025891 | |||
| 888 | Ga0157379_10120272 | |||
| 889 | Ga0157376_10177205 | |||
| 890 | Ga0163161_10178180 | |||
| 891 | Ga0197907_10672060 | |||
| 892 | Ga0197907_11289452 | |||
| 893 | Ga0206356_10249027 | |||
| 894 | Ga0206356_11002235 | |||
| 895 | Ga0206356_11771681 | |||
| 896 | Ga0206355_1120413 | |||
| 897 | Ga0206354_10148756 | |||
| 898 | Ga0206353_10409533 | |||
| 899 | Ga0206353_10667668 | |||
| 900 | Ga0206353_10850478 | |||
| 901 | Ga0206353_10875716 | |||
| 902 | Ga0154015_1542097 | |||
| 903 | Ga0213876_10182906 | |||
| 904 | Ga0207653_10004076 | |||
| 905 | Ga0207692_10057117 | |||
| 906 | Ga0207692_10238673 | |||
| 907 | Ga0207688_10004395 | |||
| 908 | Ga0207643_10011529 | |||
| 909 | Ga0207705_10039721 | |||
| 910 | Ga0207705_10044602 | |||
| 911 | Ga0207705_10063843 | |||
| 912 | Ga0207705_10157391 | |||
| 913 | Ga0207684_10090447 | |||
| 914 | Ga0207684_10133837 | |||
| 915 | Ga0207684_10203998 | |||
| 916 | Ga0207684_10432324 | |||
| 917 | Ga0207654_10138518 | |||
| 918 | Ga0207707_10002326 | |||
| 919 | Ga0207707_10014539 | |||
| 920 | Ga0207707_10067104 | |||
| 921 | Ga0207707_10094537 | |||
| 922 | Ga0207707_10105274 | |||
| 923 | Ga0207707_10112439 | |||
| 924 | Ga0207693_10002056 | |||
| 925 | Ga0207663_10061187 | |||
| 926 | Ga0207663_10069533 | |||
| 927 | Ga0207663_10292035 | |||
| 928 | Ga0207660_10111565 | |||
| 929 | Ga0207660_10205137 | |||
| 930 | Ga0207662_10060958 | |||
| 931 | Ga0207657_10000331 | |||
| 932 | Ga0207657_10007492 | |||
| 933 | Ga0207657_10037460 | |||
| 934 | Ga0207657_10165974 | |||
| 935 | Ga0207649_10107427 | |||
| 936 | Ga0207652_10007548 | |||
| 937 | Ga0207652_10023727 | |||
| 938 | Ga0207652_10031089 | |||
| 939 | Ga0207652_10046367 | |||
| 940 | Ga0207652_10244967 | |||
| 941 | Ga0207646_10002821 | |||
| 942 | Ga0207646_10086109 | |||
| 943 | Ga0207646_10123767 | |||
| 944 | Ga0207646_10245698 | |||
| 945 | Ga0207700_10154794 | |||
| 946 | Ga0207700_10330494 | |||
| 947 | Ga0207664_10411948 | |||
| 948 | Ga0207706_10052787 | |||
| 949 | Ga0207706_10091667 | |||
| 950 | Ga0207709_10039217 | |||
| 951 | Ga0207709_10208895 | |||
| 952 | Ga0207670_10024520 | |||
| 953 | Ga0207704_10188495 | |||
| 954 | Ga0207665_10020792 | |||
| 955 | Ga0207689_10198934 | |||
| 956 | Ga0207661_10017520 | |||
| 957 | Ga0207661_10050866 | |||
| 958 | Ga0207661_10168478 | |||
| 959 | Ga0207661_10224762 | |||
| 960 | Ga0207661_10288400 | |||
| 961 | Ga0207679_10529355 | |||
| 962 | Ga0207667_10127836 | |||
| 963 | Ga0207667_10171349 | |||
| 964 | Ga0207667_10202628 | |||
| 965 | Ga0207667_10276277 | |||
| 966 | Ga0207667_10309772 | |||
| 967 | Ga0207667_10632783 | |||
| 968 | Ga0207712_10211403 | |||
| 969 | Ga0207640_10048646 | |||
| 970 | Ga0207658_10066502 | |||
| 971 | Ga0207677_10152144 | |||
| 972 | Ga0207703_10075577 | |||
| 973 | Ga0207678_10229610 | |||
| 974 | Ga0207708_10106658 | |||
| 975 | Ga0207708_10323231 | |||
| 976 | Ga0207702_10189255 | |||
| 977 | Ga0207641_10617967 | |||
| 978 | Ga0207674_10113718 | |||
| 979 | Ga0207675_100023645 | |||
| 980 | Ga0207675_100174178 | |||
| 981 | Ga0207683_10077641 | |||
| 982 | Ga0207698_10430687 | |||
| 983 | Ga0207428_10064900 | |||
| 984 | Ga0207428_10123483 | |||
| 985 | Ga0207428_10270014 | |||
| 986 | Ga0268265_10199209 | |||
| 987 | Ga0268265_10319183 | |||
| 988 | Ga0268264_10580102 | |||
| 989 | Ga0265318_10068149 | |||
| 990 | Ga0265338_10048183 | |||
| 991 | Ga0265330_10061397 | |||
| 992 | Ga0265339_10052350 | |||
| 993 | Ga0265327_10020702 | |||
| 994 | Ga0265316_10080186 | |||
| 995 | Ga0307408_100116923 | |||
| 996 | Ga0265313_10025499 | |||
| 997 | Ga0265314_10007254 | |||
| 998 | Ga0265342_10063214 | |||
| 999 | Ga0307405_10006258 | |||
| 1000 | Ga0307405_10069514 | |||
| 1001 | Ga0307405_10097403 | |||
| 1002 | Ga0307405_10311084 | |||
| 1003 | Ga0307410_10006439 | |||
| 1004 | Ga0307410_10388948 | |||
| 1005 | Ga0307406_10155230 | |||
| 1006 | Ga0307406_10472807 | |||
| 1007 | Ga0307407_10115005 | |||
| 1008 | Ga0307412_10016331 | |||
| 1009 | Ga0307412_10264840 | |||
| 1010 | Ga0307409_100039272 | |||
| 1011 | Ga0307409_100096010 | |||
| 1012 | Ga0307416_100083345 | |||
| 1013 | Ga0307416_100170118 | |||
| 1014 | Ga0307416_100243881 | |||
| 1015 | Ga0307414_10492618 | |||
| 1016 | Ga0307411_10052108 | |||
| 1017 | Ga0307415_100007518 | |||
| 1018 | Ga0307415_100040998 | |||
| 1019 | Ga0307415_100304675 | |||
| 1020 | Ga0373948_0001620 | |||
| 1021 | Ga0373926_0032926 | |||
| 1022 | Ga0373926_0035784 | |||
| 1023 | Ga0373944_0007792 | |||
| 1024 | Ga0373949_0019618 | |||
| 1025 | Ga0373951_0002727 | |||
| 1026 | Ga0373936_0014314 | |||
| 1027 | Ga0373941_0011974 | |||
| 1028 | Ga0373945_0003422 | |||
| 1029 | Ga0373945_0013486 | |||
| 1030 | Ga0373954_0084119 | |||
| 1031 | Ga0373956_0050165 | |||
| 1032 | Ga0373957_0053652 | |||
| 1033 | Ga0373960_0011429 | |||
| 1034 | Ga0373943_0000896 | |||
| 1035 | Ga0373943_0003423 | |||
| 1036 | Ga0373943_0012785 | |||
| 1037 | Ga0373946_0005596 | |||
| 1038 | Ga0373946_0062301 | |||
| 1039 | Ga0373955_0073204 | |||
| 1040 | Ga0373942_0002046 | |||
| 1041 | Ga0373961_0084766 | |||
| 1042 | Ga0373962_0012237 | |||
| 1043 | Ga0373931_0004257 | |||
| 1044 | Ga0373935_0014820 | |||
| 1045 | Ga0373935_0179712 | |||
| 1046 | Ga0373947_0012053 | |||
| 1047 | Ga0373947_0026069 | |||
| 1048 | Ga0373947_0144032 | |||
| 1049 | Ga0373937_0047884 | |||
| 1050 | Ga0373925_0001681 | |||
| 1051 | Ga0373925_0008347 | |||
| 1052 | Ga0395899_0000727 | |||
| 1053 | Ga0395899_0018343 | |||
| 1054 | Ga0395899_0025523 | |||
| 1055 | Ga0395899_0031204 | |||
| 1056 | Ga0395899_0038751 | |||
| 1057 | Ga0395899_0174170 | |||
| 1058 | Ga0395900_0005981 | |||
| 1059 | Ga0395900_0006517 | |||
| 1060 | Ga0395900_0011622 | |||
| 1061 | Ga0395900_0023255 | |||
| 1062 | Ga0395900_0023967 | |||
| 1063 | Ga0395900_0046407 | |||
| 1064 | Ga0395900_0051599 | |||
| 1065 | Ga0395900_0060520 | |||
| 1066 | Ga0395900_0119757 | |||
| 1067 | Ga0395900_0154041 | |||
| 1068 | Ga0395900_0160386 | |||
| 1069 | Ga0395900_0294349 | |||
| 1070 | Ga0395900_0355165 | |||
| 1071 | Ga0395898_0007522 | |||
| 1072 | Ga0395898_0022336 | |||
| 1073 | Ga0395898_0045062 | |||
| 1074 | Ga0395898_0067737 | |||
| 1075 | Ga0395898_0070596 | |||
| 1076 | Ga0395898_0082474 | |||
| 1077 | Ga0395898_0116146 | |||
| 1078 | Ga0395898_0204673 | |||
| 1079 | Ga0395898_0296706 | |||
| 1080 | Ga0395898_0439523 | |||
| 1081 | Ga0395905_0002457 | |||
| 1082 | Ga0395905_0010592 | |||
| 1083 | Ga0395905_0028622 | |||
| 1084 | Ga0395905_0032610 | |||
| 1085 | Ga0395905_0037496 | |||
| 1086 | Ga0395905_0046598 | |||
| 1087 | Ga0395905_0053398 | |||
| 1088 | Ga0395905_0063264 | |||
| 1089 | Ga0395905_0172691 | |||
| 1090 | Ga0395905_0282512 | |||
| 1091 | Ga0395905_0317863 | |||
| 1092 | Ga0395905_0610102 | |||
| 1093 | Ga0395901_0003418 | |||
| 1094 | Ga0395901_0007676 | |||
| 1095 | Ga0395901_0009332 | |||
| 1096 | Ga0395901_0009579 | |||
| 1097 | Ga0395901_0011618 | |||
| 1098 | Ga0395901_0012040 | |||
| 1099 | Ga0395901_0013640 | |||
| 1100 | Ga0395901_0014388 | |||
| 1101 | Ga0395901_0015943 | |||
| 1102 | Ga0395901_0020472 | |||
| 1103 | Ga0395901_0032261 | |||
| 1104 | Ga0395901_0058602 | |||
| 1105 | Ga0395901_0062685 | |||
| 1106 | Ga0395901_0066779 | |||
| 1107 | Ga0395901_0072874 | |||
| 1108 | Ga0395901_0104240 | |||
| 1109 | Ga0395901_0113815 | |||
| 1110 | Ga0395901_0184873 | |||
| 1111 | Ga0436365_0152440 | |||
| 1112 | Ga0436365_1603605 | |||
| 1113 | Ga0439451_001447 | |||
| 1114 | Ga0439458_0002517 | |||
| 1115 | Ga0450918_006233 | |||
| 1116 | Ga0466969_0036211 | |||
| 1117 | Ga0466965_0024340 | |||
| 1118 | Ga0466965_0213116 | |||
| 1119 | Ga0466966_0004783 | |||
| 1120 | Ga0466966_0015008 | |||
| 1121 | Ga0466961_0003118 | |||
| 1122 | Ga0466961_0009477 | |||
| 1123 | Ga0466961_0069788 | |||
| 1124 | Ga0466963_0002364 | |||
| 1125 | Ga0466963_0010083 | |||
| 1126 | Ga0466963_0034714 | |||
| 1127 | Ga0466963_0073576 | |||
| 1128 | Ga0466963_0075203 | |||
| 1129 | Ga0466963_0079497 | |||
| 1130 | Ga0466963_0113336 | |||
| 1131 | Ga0466963_0142401 | |||
| 1132 | Ga0466963_0321393 | |||
| 1133 | Ga0466963_0380074 | |||
| 1134 | Ga0466964_0000962 | |||
| 1135 | Ga0466964_0008547 | |||
| 1136 | Ga0466964_0198219 | |||
| 1137 | Ga0466971_0026919 | |||
| 1138 | Ga0466968_0092963 | |||
| 1139 | Ga0466970_0055482 | |||
| 1140 | Ga0466970_0059078 | |||
| 1141 | Ga0466970_0149514 | |||
| 1142 | Ga0466957_0014153 | |||
| 1143 | Ga0466957_0026965 | |||
| 1144 | Ga0466957_0039452 | |||
| 1145 | Ga0466960_0101967 | |||
| 1146 | Ga0466959_0005640 | |||
| 1147 | Ga0466959_0007161 | |||
| 1148 | Ga0466959_0023477 | |||
| 1149 | Ga0466959_0120779 | |||
| 1150 | Ga0466959_0234141 | |||
| 1151 | Ga0451576_0425039 | |||
| 1152 | Ga0451576_0480834 | |||
| 1153 | Ga0466958_0006317 | |||
| 1154 | Ga0466958_0011009 | |||
| 1155 | Ga0466958_0029630 | |||
| 1156 | Ga0466958_0085286 | |||
| 1157 | Ga0466958_0124907 | |||
| 1158 | Ga0466967_0000274 | |||
| 1159 | Ga0466967_0004211 | |||
| 1160 | Ga0466967_0012534 | |||
| 1161 | Ga0466967_0101630 | |||
| 1162 | Ga0466967_0143139 | |||
| 1163 | Ga0466967_0235771 | |||
| 1164 | Ga0495592_0126513 | |||
| 1165 | Ga0495592_0252611 | |||
| 1166 | Ga0495629_0009665 | |||
| 1167 | Ga0495629_0027009 | |||
| 1168 | Ga0495641_0011337 | |||
| 1169 | Ga0495641_0027081 | |||
| 1170 | Ga0495651_0031660 | |||
| 1171 | Ga0495651_0086137 | |||
| 1172 | Ga0495653_0025779 | |||
| 1173 | Ga0495653_0028795 | |||
| 1174 | Ga0495653_0112838 | |||
| 1175 | Ga0495582_0000050 | |||
| 1176 | Ga0495582_0135719 | |||
| 1177 | Ga0495605_0092506 | |||
| 1178 | Ga0495605_0141309 | |||
| 1179 | Ga0495639_0001750 | |||
| 1180 | Ga0495662_0004271 | |||
| 1181 | Ga0495664_0054505 | |||
| 1182 | Ga0495664_0105999 | |||
| 1183 | Ga0495664_0180185 | |||
| 1184 | Ga0495594_0057551 | |||
| 1185 | Ga0495596_0043683 | |||
| 1186 | Ga0495607_0122319 | |||
| 1187 | Ga0495608_0001715 | |||
| 1188 | Ga0495608_0013267 | |||
| 1189 | Ga0495616_0055272 | |||
| 1190 | Ga0495618_0042286 | |||
| 1191 | Ga0495618_0126144 | |||
| 1192 | Ga0495618_0206067 | |||
| 1193 | Ga0495628_0035111 | |||
| 1194 | Ga0495628_0195811 | |||
| 1195 | Ga0495630_0009961 | |||
| 1196 | Ga0495630_0077032 | |||
| 1197 | Ga0495643_0180867 | |||
| 1198 | Ga0495663_0004137 | |||
| 1199 | Ga0495666_0024194 | |||
| 1200 | Ga0495666_0084513 | |||
| 1201 | Ga0495652_0238094 | |||
| 1202 | Ga0495665_0044867 | |||
| 1203 | Ga0495640_0005917 | |||
| 1204 | Ga0495640_0023452 | |||
| 1205 | Ga0495640_0097540 | |||
| 1206 | Ga0495597_0034082 | |||
| 1207 | Ga0495645_0054213 | |||
| 1208 | Ga0495645_0109769 | |||
| 1209 | Ga0495667_0007872 | |||
| 1210 | Ga0495667_0033197 | |||
| 1211 | Ga0495667_0048616 | |||
| 1212 | Ga0495667_0180588 | |||
| 1213 | Ga0495634_0009879 | |||
| 1214 | Ga0495634_0016648 | |||
| 1215 | Ga0495634_0075449 | |||
| 1216 | Ga0495611_0113015 | |||
| 1217 | Ga0495635_0011303 | |||
| 1218 | Ga0495659_0029846 | |||
| 1219 | Ga0495657_0048654 | |||
| 1220 | Ga0495657_0078052 | |||
| 1221 | Ga0495599_0028024 | |||
| 1222 | Ga0495599_0055552 | |||
| 1223 | Ga0495646_0035446 | |||
| 1224 | Ga0495658_0000020 | |||
| 1225 | Ga0495658_0194097 | |||
| 1226 | Ga0495658_0214598 | |||
| 1227 | Ga0495669_0057228 | |||
| 1228 | Ga0495613_0009224 | |||
| 1229 | Ga0495624_0112428 | |||
| 1230 | Ga0495670_0052006 | |||
| 1231 | Ga0495589_0064836 | |||
| 1232 | Ga0495600_0074456 | |||
| 1233 | Ga0495600_0124381 | |||
| 1234 | Ga0495581_0009383 | |||
| 1235 | Ga0495581_0162157 | |||
| 1236 | Ga0495604_0096696 | |||
| 1237 | Ga0495604_0105022 | |||
| 1238 | Ga0495604_0114215 | |||
| 1239 | Ga0495674_0001037 | |||
| 1240 | Ga0495674_0025803 | |||
| 1241 | Ga0495674_0041714 | |||
| 1242 | Ga0495674_0217454 | |||
| 1243 | Ga0495676_0000506 | |||
| 1244 | Ga0495676_0035591 | |||
| 1245 | Ga0495680_0002190 | |||
| 1246 | Ga0495680_0092950 | |||
| 1247 | Ga0495680_0202417 | |||
| 1248 | Ga0495683_0087730 | |||
| 1249 | Ga0495675_0069998 | |||
| 1250 | Ga0495675_0082335 | |||
| 1251 | Ga0495681_0084052 | |||
| 1252 | Ga0495684_0004005 | |||
| 1253 | Ga0495684_0020811 | |||
| 1254 | Ga0495684_0080790 | |||
| 1255 | Ga0495684_0298972 | |||
| 1256 | Ga0495593_0084994 | |||
| 1257 | Ga0495593_0103371 | |||
| 1258 | Ga0495602_0029350 | |||
| 1259 | Ga0495602_0073284 | |||
| 1260 | Ga0495602_0210742 | |||
| 1261 | Ga0495615_0025802 | |||
| 1262 | Ga0495626_0074170 | |||
| 1263 | Ga0496100_0118214 | |||
| 1264 | Ga0496100_0307916 | |||
| 1265 | Ga0496101_0003495 | |||
| 1266 | Ga0496101_0020946 | |||
| 1267 | Ga0496102_0275912 | |||
| 1268 | Ga0496102_0418130 | |||
| 1269 | Ga0496103_0112072 | |||
| 1270 | Ga0496104_0011816 | |||
| 1271 | Ga0496104_0152638 | |||
| 1272 | Ga0496104_0168650 | |||
| 1273 | Ga0496104_0193011 | |||
| 1274 | Ga0496105_0005669 | |||
| 1275 | Ga0496105_0064450 | |||
| 1276 | Ga0496105_0106504 | |||
| 1277 | Ga0496105_0268819 | |||
| 1278 | Ga0496106_0014672 | |||
| 1279 | Ga0496106_0051381 | |||
| 1280 | Ga0496106_0090498 | |||
| 1281 | Ga0496106_0163011 | |||
| 1282 | Ga0496106_0246547 | |||
| 1283 | Ga0496106_0485236 | |||
| 1284 | Ga0496107_0002933 | |||
| 1285 | Ga0496107_0054382 | |||
| 1286 | Ga0496107_0089191 | |||
| 1287 | Ga0496107_0217345 | |||
| 1288 | Ga0496108_0005600 | |||
| 1289 | Ga0496108_0008011 | |||
| 1290 | Ga0496108_0078291 | |||
| 1291 | Ga0496109_0002295 | |||
| 1292 | Ga0496109_0023166 | |||
| 1293 | Ga0496109_0031992 | |||
| 1294 | Ga0496109_0067373 | |||
| 1295 | Ga0496109_0105115 | |||
| 1296 | Ga0496109_0609049 | |||
| 1297 | Ga0496110_0001066 | |||
| 1298 | Ga0496110_0125325 | |||
| 1299 | Ga0496110_0316935 | |||
| 1300 | Ga0496111_0200515 | |||
| 1301 | Ga0496111_0334950 | |||
| 1302 | Ga0496112_0023125 | |||
| 1303 | Ga0496112_0030821 | |||
| 1304 | Ga0496112_0047360 | |||
| 1305 | Ga0496112_0115948 | |||
| 1306 | Ga0496112_0140078 | |||
| 1307 | Ga0496112_0173396 | |||
| 1308 | Ga0496112_0313618 | |||
| 1309 | Ga0496112_0447654 | |||
| 1310 | Ga0496113_0032205 | |||
| 1311 | Ga0496113_0068157 | |||
| 1312 | Ga0496114_0005004 | |||
| 1313 | Ga0496114_0015601 | |||
| 1314 | Ga0496114_0069959 | |||
| 1315 | Ga0496115_0007400 | |||
| 1316 | Ga0496115_0016446 | |||
| 1317 | Ga0496115_0017710 | |||
| 1318 | Ga0496115_0019498 | |||
| 1319 | Ga0501031_0000045 | |||
| 1320 | Ga0501031_0009046 | |||
| 1321 | Ga0501032_0000545 | |||
| 1322 | Ga0501032_0065513 | |||
| 1323 | Ga0501033_0000698 | |||
| 1324 | Ga0501033_0006732 | |||
| 1325 | Ga0501034_0021687 | |||
| 1326 | Ga0501034_0169786 | |||
| 1327 | Ga0501036_0002118 | |||
| 1328 | Ga0501036_0006165 | |||
| 1329 | Ga0501037_0000612 | |||
| 1330 | Ga0501037_0018046 | |||
| 1331 | Ga0501038_0000193 | |||
| 1332 | Ga0501038_0004891 | |||
| 1333 | Ga0501039_0006974 | |||
| 1334 | Ga0501040_0000044 | |||
| 1335 | Ga0501040_0000718 | |||
| 1336 | Ga0501040_0010244 | |||
| 1337 | Ga0501041_0000091 | |||
| 1338 | Ga0501041_0001848 | |||
| 1339 | Ga0501041_0035202 | |||
| 1340 | Ga0501042_0000016 | |||
| 1341 | Ga0501042_0001180 | |||
| 1342 | Ga0501042_0200868 | |||
| 1343 | Ga0501043_0000630 | |||
| 1344 | Ga0501043_0032227 | |||
| 1345 | Ga0501046_0000264 | |||
| 1346 | Ga0501046_0002496 | |||
| 1347 | Ga0501047_0000171 | |||
| 1348 | Ga0501047_0099208 | |||
| 1349 | Ga0501047_0158254 | |||
| 1350 | Ga0501048_0001526 | |||
| 1351 | Ga0501048_0001748 | |||
| 1352 | Ga0501048_0281952 | |||
| 1353 | Ga0501067_0000495 | |||
| 1354 | Ga0501067_0013586 | |||
| 1355 | Ga0501067_0269529 | |||
| 1356 | Ga0501068_0000025 | |||
| 1357 | Ga0501068_0015392 | |||
| 1358 | Ga0501069_0000196 | |||
| 1359 | Ga0501069_0003131 | |||
| 1360 | Ga0501069_0010875 | |||
| 1361 | Ga0501069_0014233 | |||
| 1362 | Ga0501069_0064078 | |||
| 1363 | Ga0501070_0000514 | |||
| 1364 | Ga0501070_0001651 | |||
| 1365 | Ga0501070_0007569 | |||
| 1366 | Ga0501070_0014550 | |||
| 1367 | Ga0501070_0064405 | |||
| 1368 | Ga0501070_0100237 | |||
| 1369 | Ga0501070_0238137 | |||
| 1370 | Ga0501071_0000006 | |||
| 1371 | Ga0501071_0088379 | |||
| 1372 | Ga0501071_0240768 | |||
| 1373 | Ga0501072_0000143 | |||
| 1374 | Ga0501072_0002757 | |||
| 1375 | Ga0501072_0487286 | |||
| 1376 | Ga0501073_0000279 | |||
| 1377 | Ga0501073_0002058 | |||
| 1378 | Ga0501074_0000078 | |||
| 1379 | Ga0501074_0004760 | |||
| 1380 | Ga0501075_0000044 | |||
| 1381 | Ga0501075_0002360 | |||
| 1382 | Ga0501076_0000334 | |||
| 1383 | Ga0501076_0008077 | |||
| 1384 | Ga0501077_0006572 | |||
| 1385 | Ga0501077_0014651 | |||
| 1386 | Ga0501077_0143669 | |||
| 1387 | Ga0501225_0052482 | |||
| 1388 | Ga0501079_0000008 | |||
| 1389 | Ga0501079_0000286 | |||
| 1390 | Ga0501079_0138880 | |||
| 1391 | Ga0501079_0577230 | |||
| 1392 | Ga0501080_0001884 | |||
| 1393 | Ga0501080_0008885 | |||
| 1394 | Ga0501080_0188321 | |||
| 1395 | Ga0501081_0000020 | |||
| 1396 | Ga0501081_0001702 | |||
| 1397 | Ga0501083_0000175 | |||
| 1398 | Ga0501083_0002332 | |||
| 1399 | Ga0501035_0000993 | |||
| 1400 | Ga0501035_0004199 | |||
| 1401 | Ga0501035_0325760 | |||
| 1402 | Ga0501044_0001032 | |||
| 1403 | Ga0501044_0004011 | |||
| 1404 | Ga0501044_0183089 | |||
| 1405 | Ga0501044_0288177 | |||
| 1406 | Ga0501045_0000036 | |||
| 1407 | Ga0501045_0001036 | |||
| 1408 | Ga0501045_0122534 | |||
| 1409 | nmdc:mga0yw44_239705_c1 | |||
| 1410 | nmdc:mga05p37_573705_c1 | |||
| 1411 | nmdc:mga05p37_7413_c1 | |||
| 1412 | nmdc:mga05p37_85942_c1 | |||
| 1413 | nmdc:mga08y16_22314_c1 | |||
| 1414 | nmdc:mga08y16_67021_c1 | |||
| 1415 | nmdc:mga0n895_18845_c1 | |||
| 1416 | nmdc:mga0n895_75211_c1 | |||
| 1417 | nmdc:mga0rr50_17983_c1 | |||
| 1418 | nmdc:mga08x19_38995_c1 | |||
| 1419 | nmdc:mga0a205_138633_c1 | |||
| 1420 | Ga0495601_0174520 | |||
| 1421 | Ga0495595_0001549 | |||
| 1422 | Ga0495619_0002214 | |||
| 1423 | Ga0495619_0033154 | |||
| 1424 | Ga0495619_0135566 | |||
| 1425 | Ga0495619_0169063 | |||
| 1426 | Ga0501084_0000083 | |||
| 1427 | Ga0501084_0002951 | |||
| 1428 | Ga0501084_0108986 | |||
| 1429 | Ga0501084_0660308 | |||
| 1430 | Ga0501082_0000472 | |||
| 1431 | Ga0501082_0004484 | |||
| 1432 | Ga0530510_0000031 | |||
| 1433 | Ga0530510_0002746 | |||
| 1434 | Ga0530510_0011304 | |||
| 1435 | Ga0530510_0061749 | |||
| 1436 | Ga0530510_0077770 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k52-assembly4.cif.gz_D | crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012 | 0.7753 | 56 | 264 |
| 5ffc-assembly1.cif.gz_A | copm in the cu(ii)-bound form | 0.7732 | 62 | 193 |
| 4etr-assembly1.cif.gz_A | x-ray structure of pa2169 from pseudomonas aeruginosa | 0.7504 | 58 | 200 |
| 5ffd-assembly1.cif.gz_A | copm in the ag-bound form (by co-crystallization) | 0.7487 | 65 | 199 |
| 5fej-assembly2.cif.gz_B | copm in the cu(i)-bound form | 0.7486 | 65 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ5_6_314_1.10.620.20 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.7901 | 16 | 261 | 1.10.620.20 |
| 5ffcA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7732 | 62 | 193 | 1.20.1260.10 |
| 3fseA02 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7604 | 65 | 199 | 1.20.1260.10 |
| 5fejA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7548 | 65 | 200 | 1.20.1260.10 |
| 4etrA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7504 | 58 | 200 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9DFD6-F1-model_v4 | Ferritin-like domain-containing protein | 0.9916 | 17 | 196 |
|
| AF-A0A538GF55-F1-model_v4 | Ferritin-like domain-containing protein | 0.9897 | 34 | 268 |
|
| AF-A0A538LL63-F1-model_v4 | Ferritin-like domain-containing protein | 0.986 | 16 | 268 |
|
| AF-A0A1Q7WID7-F1-model_v4 | Ferritin-like domain-containing protein | 0.9845 | 65 | 269 |
|
| AF-A0A1Q7WID7-F1-model_v4 | Ferritin-like domain-containing protein | 0.9751 | 65 | 269 |
|