F477121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 310 | 702 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0265920|Ga0496102_0265920_485_1555 |
| Length | 356 |
| Sequence | MSATSRGSFCDSRNDLTETQASPEKYSKGNYMRLAMIGLGRMGGNIARRLMLGNHEIVAFDRDDGAVAELISEGATGADTLEDVVAKLNTPRIFWVMLPAGGPTQETVDRLIELAAPGDIIIDGGNSFYKDDITRAAAAREKQIHYVDVGTSGGVWGLDRGYCMMIGGDKETVDLLDPIFDTLAPGYGTIPRTPGRGTTDDRAERGYIHAGPNGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKASEKLPAEERYDINLPDVAEVWRRGSVISSWLLDLCAIGLARDSMLEQFTGRVADSGEGRWTIDAAMEEAVPAHVLTAALFARYRSRVDTTFGDKLLSAMRFGFGGHVEMPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 4 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 5 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 6 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 7 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 8 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 9 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 10 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 11 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 210 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 211 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 212 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 213 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 214 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 270 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 301 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 307 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 0 |
| Rhizoplane | 2.37 |
| Rhizosphere | 89.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005372 | 3300001979 | Bacteria | 5427 |
| 2 | JGI24739J22299_10004790 | 3300001989 | Bacteria | 5167 |
| 3 | JGI24739J22299_10009552 | 3300001989 | Bacteria | 3611 |
| 4 | JGI24739J22299_10049772 | 3300001989 | Bacteria | 1357 |
| 5 | JGI24737J22298_10000687 | 3300001990 | Bacteria | 11875 |
| 6 | JGI24735J21928_10027297 | 3300002067 | Bacteria | 1711 |
| 7 | JGI24738J21930_10002091 | 3300002075 | Bacteria | 5342 |
| 8 | JGI24738J21930_10007677 | 3300002075 | Bacteria | 2478 |
| 9 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 10 | JGI25151J46595_10055943 | 3300003187 | Bacteria | 1297 |
| 11 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 12 | rootH2_10075661 | 3300003320 | Bacteria | 6877 |
| 13 | Ga0055536_1011158 | 3300003781 | Bacteria | 3484 |
| 14 | Ga0055530_10016424 | 3300003791 | Bacteria | 2365 |
| 15 | Ga0055540_1005503 | 3300003792 | Bacteria | 5300 |
| 16 | Ga0065165_1000625 | 3300005262 | Bacteria | 51321 |
| 17 | Ga0065714_10109070 | 3300005288 | Bacteria | 1505 |
| 18 | Ga0070658_10008641 | 3300005327 | Bacteria | 8186 |
| 19 | Ga0070658_10038050 | 3300005327 | Bacteria | 3880 |
| 20 | Ga0070658_10040306 | 3300005327 | Bacteria | 3767 |
| 21 | Ga0070658_10222296 | 3300005327 | Bacteria | 1597 |
| 22 | Ga0070658_10246114 | 3300005327 | Bacteria | 1516 |
| 23 | Ga0070658_10318277 | 3300005327 | Bacteria | 1328 |
| 24 | Ga0070676_10004172 | 3300005328 | Bacteria | 7587 |
| 25 | Ga0070683_100025567 | 3300005329 | Bacteria | 5304 |
| 26 | Ga0070683_100218535 | 3300005329 | Bacteria | 1811 |
| 27 | Ga0070690_100091417 | 3300005330 | Bacteria | 2005 |
| 28 | Ga0070670_100016900 | 3300005331 | Bacteria | 6263 |
| 29 | Ga0070670_100025510 | 3300005331 | Bacteria | 5085 |
| 30 | Ga0068869_100003116 | 3300005334 | Bacteria | 10111 |
| 31 | Ga0070666_10062831 | 3300005335 | Bacteria | 2517 |
| 32 | Ga0070680_100000777 | 3300005336 | Bacteria | 22371 |
| 33 | Ga0070680_100001609 | 3300005336 | Bacteria | 16497 |
| 34 | Ga0070680_100008701 | 3300005336 | Bacteria | 7780 |
| 35 | Ga0070680_100255725 | 3300005336 | Bacteria | 1481 |
| 36 | Ga0070680_100310653 | 3300005336 | Bacteria | 1337 |
| 37 | Ga0070682_100035315 | 3300005337 | Bacteria | 3051 |
| 38 | Ga0068868_100011184 | 3300005338 | Bacteria | 6534 |
| 39 | Ga0070660_100003291 | 3300005339 | Bacteria | 11105 |
| 40 | Ga0070660_100004065 | 3300005339 | Bacteria | 10092 |
| 41 | Ga0070660_100017639 | 3300005339 | Bacteria | 5205 |
| 42 | Ga0070660_100029155 | 3300005339 | Bacteria | 4133 |
| 43 | Ga0070660_100047766 | 3300005339 | Bacteria | 3285 |
| 44 | Ga0070660_100160963 | 3300005339 | Bacteria | 1809 |
| 45 | Ga0070660_100186491 | 3300005339 | Bacteria | 1679 |
| 46 | Ga0070660_100266557 | 3300005339 | Bacteria | 1399 |
| 47 | Ga0070660_100310240 | 3300005339 | Bacteria | 1294 |
| 48 | Ga0070660_100362680 | 3300005339 | Bacteria | 1194 |
| 49 | Ga0070691_10008548 | 3300005341 | Bacteria | 4688 |
| 50 | Ga0070691_10123756 | 3300005341 | Bacteria | 1304 |
| 51 | Ga0070661_100001494 | 3300005344 | Bacteria | 16268 |
| 52 | Ga0070661_100040130 | 3300005344 | Bacteria | 3413 |
| 53 | Ga0070661_100061923 | 3300005344 | Bacteria | 2747 |
| 54 | Ga0070661_100108664 | 3300005344 | Bacteria | 2070 |
| 55 | Ga0070661_100169133 | 3300005344 | Bacteria | 1659 |
| 56 | Ga0070661_100182187 | 3300005344 | Bacteria | 1598 |
| 57 | Ga0070692_10041405 | 3300005345 | Bacteria | 2360 |
| 58 | Ga0070668_100043360 | 3300005347 | Bacteria | 3450 |
| 59 | Ga0070669_100000138 | 3300005353 | Bacteria | 65433 |
| 60 | Ga0070669_100041151 | 3300005353 | Bacteria | 3360 |
| 61 | Ga0070675_100021410 | 3300005354 | Bacteria | 5167 |
| 62 | Ga0070671_100021780 | 3300005355 | Bacteria | 5235 |
| 63 | Ga0070671_100027056 | 3300005355 | Bacteria | 4718 |
| 64 | Ga0070671_100104838 | 3300005355 | Bacteria | 2373 |
| 65 | Ga0070671_100232034 | 3300005355 | Bacteria | 1566 |
| 66 | Ga0070674_100033254 | 3300005356 | Bacteria | 3431 |
| 67 | Ga0070673_100002586 | 3300005364 | Bacteria | 11053 |
| 68 | Ga0070673_100004948 | 3300005364 | Bacteria | 8490 |
| 69 | Ga0070659_100001040 | 3300005366 | Bacteria | 20295 |
| 70 | Ga0070659_100003697 | 3300005366 | Bacteria | 10913 |
| 71 | Ga0070659_100007325 | 3300005366 | Bacteria | 8015 |
| 72 | Ga0070659_100015988 | 3300005366 | Bacteria | 5628 |
| 73 | Ga0070659_100027275 | 3300005366 | Bacteria | 4400 |
| 74 | Ga0070659_100065256 | 3300005366 | Bacteria | 2883 |
| 75 | Ga0070659_100075317 | 3300005366 | Bacteria | 2690 |
| 76 | Ga0070659_100112163 | 3300005366 | Bacteria | 2202 |
| 77 | Ga0070667_100047812 | 3300005367 | Bacteria | 3600 |
| 78 | Ga0070667_100227132 | 3300005367 | Bacteria | 1663 |
| 79 | Ga0070709_10202436 | 3300005434 | Bacteria | 1407 |
| 80 | Ga0070694_100020574 | 3300005444 | Bacteria | 4209 |
| 81 | Ga0070663_100048900 | 3300005455 | Bacteria | 3001 |
| 82 | Ga0070663_100109285 | 3300005455 | Bacteria | 2076 |
| 83 | Ga0070663_100276188 | 3300005455 | Bacteria | 1337 |
| 84 | Ga0070663_100398467 | 3300005455 | Bacteria | 1124 |
| 85 | Ga0070662_100001837 | 3300005457 | Bacteria | 13006 |
| 86 | Ga0070662_100001928 | 3300005457 | Bacteria | 12750 |
| 87 | Ga0070662_100080350 | 3300005457 | Bacteria | 2427 |
| 88 | Ga0070681_10006985 | 3300005458 | Bacteria | 10988 |
| 89 | Ga0070681_10093219 | 3300005458 | Bacteria | 2960 |
| 90 | Ga0070681_10113562 | 3300005458 | Bacteria | 2648 |
| 91 | Ga0070681_10315254 | 3300005458 | Bacteria | 1473 |
| 92 | Ga0070681_10332708 | 3300005458 | Bacteria | 1428 |
| 93 | Ga0068867_100010664 | 3300005459 | Bacteria | 6482 |
| 94 | Ga0068867_100016740 | 3300005459 | Bacteria | 5209 |
| 95 | Ga0070698_100063579 | 3300005471 | Bacteria | 3721 |
| 96 | Ga0070679_100004635 | 3300005530 | Bacteria | 12688 |
| 97 | Ga0070679_100075528 | 3300005530 | Bacteria | 3359 |
| 98 | Ga0070679_100077512 | 3300005530 | Bacteria | 3313 |
| 99 | Ga0070679_100320061 | 3300005530 | Bacteria | 1500 |
| 100 | Ga0070679_100330242 | 3300005530 | Bacteria | 1473 |
| 101 | Ga0070679_100419467 | 3300005530 | Bacteria | 1284 |
| 102 | Ga0070679_100479188 | 3300005530 | Bacteria | 1188 |
| 103 | Ga0070684_100027737 | 3300005535 | Bacteria | 4783 |
| 104 | Ga0070684_100124210 | 3300005535 | Bacteria | 2324 |
| 105 | Ga0070684_100345018 | 3300005535 | Bacteria | 1369 |
| 106 | Ga0070697_100000139 | 3300005536 | Bacteria | 58838 |
| 107 | Ga0070697_100018866 | 3300005536 | Bacteria | 5443 |
| 108 | Ga0068853_100004994 | 3300005539 | Bacteria | 10339 |
| 109 | Ga0068853_100027359 | 3300005539 | Bacteria | 4791 |
| 110 | Ga0068853_100027704 | 3300005539 | Bacteria | 4762 |
| 111 | Ga0068853_100033891 | 3300005539 | Bacteria | 4333 |
| 112 | Ga0068853_100113339 | 3300005539 | Bacteria | 2411 |
| 113 | Ga0068853_100116126 | 3300005539 | Bacteria | 2383 |
| 114 | Ga0068853_100134100 | 3300005539 | Bacteria | 2219 |
| 115 | Ga0070672_100000868 | 3300005543 | Bacteria | 18094 |
| 116 | Ga0070693_100284404 | 3300005547 | Bacteria | 1109 |
| 117 | Ga0070665_100000380 | 3300005548 | Bacteria | 65676 |
| 118 | Ga0070665_100138367 | 3300005548 | Bacteria | 2438 |
| 119 | Ga0068855_100001148 | 3300005563 | Bacteria | 32786 |
| 120 | Ga0068855_100008821 | 3300005563 | Bacteria | 12188 |
| 121 | Ga0068855_100010741 | 3300005563 | Bacteria | 11051 |
| 122 | Ga0068855_100394571 | 3300005563 | Bacteria | 1517 |
| 123 | Ga0068855_100395925 | 3300005563 | Bacteria | 1514 |
| 124 | Ga0068855_100709803 | 3300005563 | Bacteria | 1075 |
| 125 | Ga0070664_100002792 | 3300005564 | Bacteria | 14105 |
| 126 | Ga0070664_100004946 | 3300005564 | Bacteria | 10677 |
| 127 | Ga0070664_100006300 | 3300005564 | Bacteria | 9572 |
| 128 | Ga0070664_100043512 | 3300005564 | Bacteria | 3789 |
| 129 | Ga0070664_100057463 | 3300005564 | Bacteria | 3307 |
| 130 | Ga0068857_100007132 | 3300005577 | Bacteria | 9625 |
| 131 | Ga0068857_100021844 | 3300005577 | Bacteria | 5631 |
| 132 | Ga0068857_100041994 | 3300005577 | Bacteria | 4055 |
| 133 | Ga0068857_100107278 | 3300005577 | Bacteria | 2508 |
| 134 | Ga0068857_100135940 | 3300005577 | Bacteria | 2219 |
| 135 | Ga0068857_100189409 | 3300005577 | Bacteria | 1873 |
| 136 | Ga0068857_100313261 | 3300005577 | Bacteria | 1448 |
| 137 | Ga0068854_100005266 | 3300005578 | Bacteria | 8161 |
| 138 | Ga0068854_100014636 | 3300005578 | Bacteria | 5176 |
| 139 | Ga0068854_100072173 | 3300005578 | Bacteria | 2527 |
| 140 | Ga0068854_100072875 | 3300005578 | Bacteria | 2516 |
| 141 | Ga0068854_100240021 | 3300005578 | Bacteria | 1443 |
| 142 | Ga0068856_100009932 | 3300005614 | Bacteria | 9245 |
| 143 | Ga0068856_100047053 | 3300005614 | Bacteria | 4249 |
| 144 | Ga0068856_100057631 | 3300005614 | Bacteria | 3835 |
| 145 | Ga0068856_100347459 | 3300005614 | Bacteria | 1502 |
| 146 | Ga0068856_100618558 | 3300005614 | Bacteria | 1104 |
| 147 | Ga0068852_100000946 | 3300005616 | Bacteria | 19100 |
| 148 | Ga0068852_100005893 | 3300005616 | Bacteria | 8811 |
| 149 | Ga0068852_100018079 | 3300005616 | Bacteria | 5546 |
| 150 | Ga0068852_100102314 | 3300005616 | Bacteria | 2588 |
| 151 | Ga0068852_100112815 | 3300005616 | Bacteria | 2474 |
| 152 | Ga0068852_100125607 | 3300005616 | Bacteria | 2355 |
| 153 | Ga0068852_100225606 | 3300005616 | Bacteria | 1784 |
| 154 | Ga0068852_100505068 | 3300005616 | Bacteria | 1204 |
| 155 | Ga0068859_100000550 | 3300005617 | Bacteria | 37222 |
| 156 | Ga0068859_100006426 | 3300005617 | Bacteria | 11926 |
| 157 | Ga0068859_100073328 | 3300005617 | Bacteria | 3461 |
| 158 | Ga0068859_100155178 | 3300005617 | Bacteria | 2366 |
| 159 | Ga0068864_100003528 | 3300005618 | Bacteria | 12934 |
| 160 | Ga0068864_100005190 | 3300005618 | Bacteria | 10669 |
| 161 | Ga0068851_10012796 | 3300005834 | Bacteria | 3963 |
| 162 | Ga0068851_10014173 | 3300005834 | Bacteria | 3782 |
| 163 | Ga0068863_100004087 | 3300005841 | Bacteria | 14417 |
| 164 | Ga0068863_100009309 | 3300005841 | Bacteria | 9584 |
| 165 | Ga0068863_100048341 | 3300005841 | Bacteria | 4034 |
| 166 | Ga0068863_100226573 | 3300005841 | Bacteria | 1802 |
| 167 | Ga0068858_100002589 | 3300005842 | Bacteria | 18214 |
| 168 | Ga0068858_100004956 | 3300005842 | Bacteria | 13043 |
| 169 | Ga0068858_100023934 | 3300005842 | Bacteria | 5690 |
| 170 | Ga0068858_100025161 | 3300005842 | Bacteria | 5539 |
| 171 | Ga0068858_100235315 | 3300005842 | Bacteria | 1737 |
| 172 | Ga0068860_100004406 | 3300005843 | Bacteria | 14383 |
| 173 | Ga0068860_100006884 | 3300005843 | Bacteria | 11399 |
| 174 | Ga0068860_100284558 | 3300005843 | Bacteria | 1616 |
| 175 | Ga0068862_100006635 | 3300005844 | Bacteria | 9599 |
| 176 | Ga0068862_100021749 | 3300005844 | Bacteria | 5364 |
| 177 | Ga0081538_10018384 | 3300005981 | Bacteria | 5251 |
| 178 | Ga0075368_10087558 | 3300006042 | Bacteria | 1272 |
| 179 | Ga0070712_100185284 | 3300006175 | Bacteria | 1625 |
| 180 | Ga0075366_10026901 | 3300006195 | Bacteria | 3372 |
| 181 | Ga0075366_10067766 | 3300006195 | Bacteria | 2124 |
| 182 | Ga0075366_10180035 | 3300006195 | Bacteria | 1284 |
| 183 | Ga0075370_10000001 | 3300006353 | Bacteria | 239876 |
| 184 | Ga0068871_100405905 | 3300006358 | Bacteria | 1214 |
| 185 | Ga0075428_100131976 | 3300006844 | Bacteria | 2716 |
| 186 | Ga0075431_100288808 | 3300006847 | Bacteria | 1660 |
| 187 | Ga0075433_10010202 | 3300006852 | Bacteria | 7533 |
| 188 | Ga0068865_100005976 | 3300006881 | Bacteria | 7418 |
| 189 | Ga0097620_100000550 | 3300006931 | Bacteria | 37222 |
| 190 | Ga0097620_100006426 | 3300006931 | Bacteria | 11926 |
| 191 | Ga0097620_100073329 | 3300006931 | Bacteria | 3461 |
| 192 | Ga0097620_100155181 | 3300006931 | Bacteria | 2366 |
| 193 | Ga0105240_10010679 | 3300009093 | Bacteria | 12886 |
| 194 | Ga0105240_10015147 | 3300009093 | Bacteria | 10494 |
| 195 | Ga0105240_10018070 | 3300009093 | Bacteria | 9481 |
| 196 | Ga0105240_10065883 | 3300009093 | Bacteria | 4495 |
| 197 | Ga0105240_10085276 | 3300009093 | Bacteria | 3870 |
| 198 | Ga0105240_10150136 | 3300009093 | Bacteria | 2776 |
| 199 | Ga0105245_10000198 | 3300009098 | Bacteria | 57372 |
| 200 | Ga0105245_10063705 | 3300009098 | Bacteria | 3330 |
| 201 | Ga0105247_10018070 | 3300009101 | Bacteria | 4229 |
| 202 | Ga0105243_10010602 | 3300009148 | Bacteria | 6996 |
| 203 | Ga0105243_10298211 | 3300009148 | Bacteria | 1460 |
| 204 | Ga0105241_10027469 | 3300009174 | Bacteria | 4239 |
| 205 | Ga0105241_10284753 | 3300009174 | Bacteria | 1413 |
| 206 | Ga0105248_10000391 | 3300009177 | Bacteria | 50565 |
| 207 | Ga0105248_10031695 | 3300009177 | Bacteria | 5906 |
| 208 | Ga0105237_10243467 | 3300009545 | Bacteria | 1800 |
| 209 | Ga0105238_10007731 | 3300009551 | Bacteria | 10750 |
| 210 | Ga0105238_10014401 | 3300009551 | Bacteria | 7994 |
| 211 | Ga0105238_10052170 | 3300009551 | Bacteria | 4112 |
| 212 | Ga0105239_10053714 | 3300010375 | Bacteria | 4419 |
| 213 | Ga0105239_10477424 | 3300010375 | Bacteria | 1416 |
| 214 | Ga0105239_10732565 | 3300010375 | Bacteria | 1131 |
| 215 | Ga0105246_10073297 | 3300011119 | Bacteria | 2417 |
| 216 | Ga0105246_10368332 | 3300011119 | Bacteria | 1183 |
| 217 | Ga0157373_10010344 | 3300013100 | Bacteria | 6869 |
| 218 | Ga0157373_10031653 | 3300013100 | Bacteria | 3807 |
| 219 | Ga0157373_10076574 | 3300013100 | Bacteria | 2360 |
| 220 | Ga0157373_10081004 | 3300013100 | Bacteria | 2289 |
| 221 | Ga0157373_10142136 | 3300013100 | Bacteria | 1688 |
| 222 | Ga0157371_10002789 | 3300013102 | Bacteria | 16391 |
| 223 | Ga0157371_10002797 | 3300013102 | Bacteria | 16362 |
| 224 | Ga0157371_10293365 | 3300013102 | Bacteria | 1176 |
| 225 | Ga0157370_10006108 | 3300013104 | Bacteria | 13365 |
| 226 | Ga0157370_10025395 | 3300013104 | Bacteria | 5864 |
| 227 | Ga0157370_10032238 | 3300013104 | Bacteria | 5118 |
| 228 | Ga0157370_10069403 | 3300013104 | Bacteria | 3329 |
| 229 | Ga0157370_10097207 | 3300013104 | Bacteria | 2762 |
| 230 | Ga0157370_10130551 | 3300013104 | Bacteria | 2343 |
| 231 | Ga0157370_10204812 | 3300013104 | Bacteria | 1830 |
| 232 | Ga0157370_10284948 | 3300013104 | Bacteria | 1526 |
| 233 | Ga0157370_10295723 | 3300013104 | Bacteria | 1495 |
| 234 | Ga0157370_10349859 | 3300013104 | Bacteria | 1362 |
| 235 | Ga0157369_10002441 | 3300013105 | Bacteria | 22331 |
| 236 | Ga0157369_10007310 | 3300013105 | Bacteria | 12712 |
| 237 | Ga0157369_10085210 | 3300013105 | Bacteria | 3377 |
| 238 | Ga0157369_10098789 | 3300013105 | Bacteria | 3112 |
| 239 | Ga0157369_10102744 | 3300013105 | Bacteria | 3045 |
| 240 | Ga0157369_10290820 | 3300013105 | Bacteria | 1701 |
| 241 | Ga0157369_10504471 | 3300013105 | Bacteria | 1252 |
| 242 | Ga0157374_10086272 | 3300013296 | Bacteria | 2986 |
| 243 | Ga0157378_10001311 | 3300013297 | Bacteria | 22380 |
| 244 | Ga0157378_10437162 | 3300013297 | Bacteria | 1296 |
| 245 | Ga0163162_10064438 | 3300013306 | Bacteria | 3710 |
| 246 | Ga0163162_10072048 | 3300013306 | Bacteria | 3509 |
| 247 | Ga0163162_10122274 | 3300013306 | Bacteria | 2708 |
| 248 | Ga0163162_10511373 | 3300013306 | Bacteria | 1331 |
| 249 | Ga0157372_10003571 | 3300013307 | Bacteria | 16739 |
| 250 | Ga0157372_10012201 | 3300013307 | Bacteria | 9153 |
| 251 | Ga0157372_10244011 | 3300013307 | Bacteria | 2084 |
| 252 | Ga0157375_10026969 | 3300013308 | Bacteria | 5363 |
| 253 | Ga0157375_10100575 | 3300013308 | Bacteria | 2972 |
| 254 | Ga0163163_10003435 | 3300014325 | Bacteria | 13462 |
| 255 | Ga0157377_10022379 | 3300014745 | Bacteria | 3336 |
| 256 | Ga0157379_10006683 | 3300014968 | Bacteria | 9959 |
| 257 | Ga0206353_10434619 | 3300020082 | Bacteria | 3038 |
| 258 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 259 | Ga0209129_1000286 | 3300025258 | Bacteria | 48191 |
| 260 | Ga0209233_1013690 | 3300025261 | Bacteria | 2311 |
| 261 | Ga0209676_1009141 | 3300025292 | Bacteria | 4313 |
| 262 | Ga0209025_1001464 | 3300025294 | Bacteria | 30863 |
| 263 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 264 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 265 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 266 | Ga0209257_1011642 | 3300025304 | Bacteria | 4200 |
| 267 | Ga0207697_10000297 | 3300025315 | Bacteria | 27757 |
| 268 | Ga0207656_10008833 | 3300025321 | Bacteria | 3728 |
| 269 | Ga0207656_10013262 | 3300025321 | Bacteria | 3145 |
| 270 | Ga0207656_10026133 | 3300025321 | Bacteria | 2377 |
| 271 | Ga0207688_10000214 | 3300025901 | Bacteria | 25912 |
| 272 | Ga0207647_10000450 | 3300025904 | Bacteria | 33415 |
| 273 | Ga0207647_10000550 | 3300025904 | Bacteria | 29810 |
| 274 | Ga0207647_10001333 | 3300025904 | Bacteria | 18966 |
| 275 | Ga0207647_10051388 | 3300025904 | Bacteria | 2548 |
| 276 | Ga0207699_10175992 | 3300025906 | Bacteria | 1435 |
| 277 | Ga0207645_10047073 | 3300025907 | Bacteria | 2754 |
| 278 | Ga0207705_10000647 | 3300025909 | Bacteria | 28998 |
| 279 | Ga0207705_10000733 | 3300025909 | Bacteria | 27069 |
| 280 | Ga0207705_10012679 | 3300025909 | Bacteria | 6083 |
| 281 | Ga0207705_10016400 | 3300025909 | Bacteria | 5311 |
| 282 | Ga0207705_10021334 | 3300025909 | Bacteria | 4621 |
| 283 | Ga0207705_10036186 | 3300025909 | Bacteria | 3533 |
| 284 | Ga0207705_10038781 | 3300025909 | Bacteria | 3413 |
| 285 | Ga0207705_10043296 | 3300025909 | Bacteria | 3234 |
| 286 | Ga0207705_10044634 | 3300025909 | Bacteria | 3185 |
| 287 | Ga0207654_10129313 | 3300025911 | Bacteria | 1596 |
| 288 | Ga0207707_10004869 | 3300025912 | Bacteria | 11785 |
| 289 | Ga0207707_10012471 | 3300025912 | Bacteria | 7389 |
| 290 | Ga0207707_10031408 | 3300025912 | Bacteria | 4648 |
| 291 | Ga0207707_10271783 | 3300025912 | Bacteria | 1469 |
| 292 | Ga0207695_10024131 | 3300025913 | Bacteria | 6851 |
| 293 | Ga0207695_10048907 | 3300025913 | Bacteria | 4461 |
| 294 | Ga0207695_10105071 | 3300025913 | Bacteria | 2812 |
| 295 | Ga0207695_10292239 | 3300025913 | Bacteria | 1522 |
| 296 | Ga0207695_10458431 | 3300025913 | Bacteria | 1158 |
| 297 | Ga0207693_10067961 | 3300025915 | Bacteria | 2790 |
| 298 | Ga0207660_10000720 | 3300025917 | Bacteria | 22059 |
| 299 | Ga0207660_10000753 | 3300025917 | Bacteria | 21519 |
| 300 | Ga0207660_10002930 | 3300025917 | Bacteria | 11151 |
| 301 | Ga0207660_10002951 | 3300025917 | Bacteria | 11121 |
| 302 | Ga0207660_10004462 | 3300025917 | Bacteria | 9124 |
| 303 | Ga0207660_10026504 | 3300025917 | Bacteria | 3948 |
| 304 | Ga0207660_10400218 | 3300025917 | Bacteria | 1106 |
| 305 | Ga0207657_10002019 | 3300025919 | Bacteria | 21940 |
| 306 | Ga0207657_10002443 | 3300025919 | Bacteria | 20074 |
| 307 | Ga0207657_10003486 | 3300025919 | Bacteria | 16785 |
| 308 | Ga0207657_10003530 | 3300025919 | Bacteria | 16704 |
| 309 | Ga0207657_10009031 | 3300025919 | Bacteria | 10066 |
| 310 | Ga0207657_10010446 | 3300025919 | Bacteria | 9265 |
| 311 | Ga0207657_10011217 | 3300025919 | Bacteria | 8909 |
| 312 | Ga0207657_10016702 | 3300025919 | Bacteria | 7071 |
| 313 | Ga0207657_10028287 | 3300025919 | Bacteria | 5116 |
| 314 | Ga0207657_10065052 | 3300025919 | Bacteria | 3110 |
| 315 | Ga0207657_10296054 | 3300025919 | Bacteria | 1282 |
| 316 | Ga0207657_10317974 | 3300025919 | Bacteria | 1231 |
| 317 | Ga0207649_10008370 | 3300025920 | Bacteria | 5637 |
| 318 | Ga0207649_10010422 | 3300025920 | Bacteria | 5107 |
| 319 | Ga0207649_10021475 | 3300025920 | Bacteria | 3717 |
| 320 | Ga0207649_10028353 | 3300025920 | Bacteria | 3296 |
| 321 | Ga0207649_10056575 | 3300025920 | Bacteria | 2450 |
| 322 | Ga0207652_10001317 | 3300025921 | Bacteria | 22056 |
| 323 | Ga0207652_10002779 | 3300025921 | Bacteria | 14710 |
| 324 | Ga0207652_10052952 | 3300025921 | Bacteria | 3486 |
| 325 | Ga0207652_10115640 | 3300025921 | Bacteria | 2383 |
| 326 | Ga0207652_10287960 | 3300025921 | Bacteria | 1482 |
| 327 | Ga0207646_10162553 | 3300025922 | Bacteria | 2015 |
| 328 | Ga0207681_10002797 | 3300025923 | Bacteria | 11046 |
| 329 | Ga0207681_10045621 | 3300025923 | Bacteria | 2944 |
| 330 | Ga0207694_10001010 | 3300025924 | Bacteria | 24549 |
| 331 | Ga0207694_10009321 | 3300025924 | Bacteria | 7406 |
| 332 | Ga0207694_10102113 | 3300025924 | Bacteria | 2273 |
| 333 | Ga0207659_10011048 | 3300025926 | Bacteria | 5691 |
| 334 | Ga0207659_10277564 | 3300025926 | Bacteria | 1369 |
| 335 | Ga0207687_10004719 | 3300025927 | Bacteria | 9067 |
| 336 | Ga0207644_10021354 | 3300025931 | Bacteria | 4409 |
| 337 | Ga0207644_10021704 | 3300025931 | Bacteria | 4378 |
| 338 | Ga0207644_10028811 | 3300025931 | Bacteria | 3848 |
| 339 | Ga0207644_10067500 | 3300025931 | Bacteria | 2607 |
| 340 | Ga0207644_10178978 | 3300025931 | Bacteria | 1661 |
| 341 | Ga0207690_10004314 | 3300025932 | Bacteria | 8395 |
| 342 | Ga0207690_10004900 | 3300025932 | Bacteria | 7896 |
| 343 | Ga0207690_10031546 | 3300025932 | Bacteria | 3392 |
| 344 | Ga0207690_10061653 | 3300025932 | Bacteria | 2550 |
| 345 | Ga0207690_10069839 | 3300025932 | Bacteria | 2418 |
| 346 | Ga0207690_10174621 | 3300025932 | Bacteria | 1612 |
| 347 | Ga0207690_10247107 | 3300025932 | Bacteria | 1376 |
| 348 | Ga0207706_10001953 | 3300025933 | Bacteria | 20227 |
| 349 | Ga0207706_10002890 | 3300025933 | Bacteria | 16629 |
| 350 | Ga0207706_10019463 | 3300025933 | Bacteria | 6107 |
| 351 | Ga0207706_10109711 | 3300025933 | Bacteria | 2428 |
| 352 | Ga0207709_10069381 | 3300025935 | Bacteria | 2231 |
| 353 | Ga0207709_10101297 | 3300025935 | Bacteria | 1905 |
| 354 | Ga0207669_10052976 | 3300025937 | Bacteria | 2441 |
| 355 | Ga0207704_10043071 | 3300025938 | Bacteria | 2662 |
| 356 | Ga0207691_10000047 | 3300025940 | Bacteria | 99519 |
| 357 | Ga0207691_10073755 | 3300025940 | Bacteria | 3078 |
| 358 | Ga0207691_10228695 | 3300025940 | Bacteria | 1611 |
| 359 | Ga0207711_10001028 | 3300025941 | Bacteria | 26716 |
| 360 | Ga0207711_10003195 | 3300025941 | Bacteria | 14296 |
| 361 | Ga0207711_10003281 | 3300025941 | Bacteria | 14062 |
| 362 | Ga0207689_10000002 | 3300025942 | Bacteria | 198437 |
| 363 | Ga0207689_10014038 | 3300025942 | Bacteria | 6819 |
| 364 | Ga0207661_10047494 | 3300025944 | Bacteria | 3409 |
| 365 | Ga0207661_10322527 | 3300025944 | Bacteria | 1389 |
| 366 | Ga0207679_10034440 | 3300025945 | Bacteria | 3573 |
| 367 | Ga0207679_10058928 | 3300025945 | Bacteria | 2848 |
| 368 | Ga0207667_10004932 | 3300025949 | Bacteria | 16295 |
| 369 | Ga0207667_10007513 | 3300025949 | Bacteria | 13084 |
| 370 | Ga0207667_10015484 | 3300025949 | Bacteria | 8660 |
| 371 | Ga0207667_10017570 | 3300025949 | Bacteria | 8045 |
| 372 | Ga0207667_10029561 | 3300025949 | Bacteria | 5941 |
| 373 | Ga0207667_10051008 | 3300025949 | Bacteria | 4363 |
| 374 | Ga0207667_10061822 | 3300025949 | Bacteria | 3917 |
| 375 | Ga0207651_10010367 | 3300025960 | Bacteria | 5162 |
| 376 | Ga0207651_10027820 | 3300025960 | Bacteria | 3557 |
| 377 | Ga0207651_10254231 | 3300025960 | Bacteria | 1439 |
| 378 | Ga0207712_10000969 | 3300025961 | Bacteria | 20659 |
| 379 | Ga0207712_10095457 | 3300025961 | Bacteria | 2199 |
| 380 | Ga0207668_10113779 | 3300025972 | Bacteria | 2035 |
| 381 | Ga0207640_10010650 | 3300025981 | Bacteria | 5186 |
| 382 | Ga0207640_10024071 | 3300025981 | Bacteria | 3668 |
| 383 | Ga0207640_10283999 | 3300025981 | Bacteria | 1301 |
| 384 | Ga0207658_10003561 | 3300025986 | Bacteria | 10994 |
| 385 | Ga0207658_10023648 | 3300025986 | Bacteria | 4291 |
| 386 | Ga0207658_10230416 | 3300025986 | Bacteria | 1563 |
| 387 | Ga0207677_10361972 | 3300026023 | Bacteria | 1219 |
| 388 | Ga0207703_10002189 | 3300026035 | Bacteria | 17150 |
| 389 | Ga0207703_10030569 | 3300026035 | Bacteria | 4258 |
| 390 | Ga0207703_10065739 | 3300026035 | Bacteria | 2981 |
| 391 | Ga0207703_10204788 | 3300026035 | Bacteria | 1755 |
| 392 | Ga0207639_10000181 | 3300026041 | Bacteria | 49444 |
| 393 | Ga0207639_10002813 | 3300026041 | Bacteria | 11673 |
| 394 | Ga0207639_10013429 | 3300026041 | Bacteria | 5733 |
| 395 | Ga0207639_10014834 | 3300026041 | Bacteria | 5488 |
| 396 | Ga0207639_10028477 | 3300026041 | Bacteria | 4079 |
| 397 | Ga0207639_10030303 | 3300026041 | Bacteria | 3967 |
| 398 | Ga0207639_10088370 | 3300026041 | Bacteria | 2473 |
| 399 | Ga0207639_10111414 | 3300026041 | Bacteria | 2231 |
| 400 | Ga0207678_10001895 | 3300026067 | Bacteria | 19090 |
| 401 | Ga0207678_10003129 | 3300026067 | Bacteria | 14975 |
| 402 | Ga0207678_10047684 | 3300026067 | Bacteria | 3704 |
| 403 | Ga0207678_10061702 | 3300026067 | Bacteria | 3224 |
| 404 | Ga0207678_10062991 | 3300026067 | Bacteria | 3187 |
| 405 | Ga0207678_10172896 | 3300026067 | Bacteria | 1844 |
| 406 | Ga0207702_10025964 | 3300026078 | Bacteria | 4863 |
| 407 | Ga0207702_10031490 | 3300026078 | Bacteria | 4420 |
| 408 | Ga0207702_10045727 | 3300026078 | Bacteria | 3683 |
| 409 | Ga0207702_10196823 | 3300026078 | Bacteria | 1866 |
| 410 | Ga0207702_10314046 | 3300026078 | Bacteria | 1491 |
| 411 | Ga0207641_10000761 | 3300026088 | Bacteria | 34699 |
| 412 | Ga0207641_10002113 | 3300026088 | Bacteria | 18795 |
| 413 | Ga0207648_10001403 | 3300026089 | Bacteria | 26509 |
| 414 | Ga0207648_10017420 | 3300026089 | Bacteria | 6538 |
| 415 | Ga0207648_10048809 | 3300026089 | Bacteria | 3706 |
| 416 | Ga0207676_10000731 | 3300026095 | Bacteria | 25737 |
| 417 | Ga0207676_10012400 | 3300026095 | Bacteria | 6106 |
| 418 | Ga0207676_10565241 | 3300026095 | Bacteria | 1088 |
| 419 | Ga0207674_10000850 | 3300026116 | Bacteria | 39849 |
| 420 | Ga0207674_10011911 | 3300026116 | Bacteria | 9750 |
| 421 | Ga0207674_10012448 | 3300026116 | Bacteria | 9507 |
| 422 | Ga0207674_10016271 | 3300026116 | Bacteria | 8146 |
| 423 | Ga0207674_10035053 | 3300026116 | Bacteria | 5238 |
| 424 | Ga0207674_10036991 | 3300026116 | Bacteria | 5080 |
| 425 | Ga0207674_10054898 | 3300026116 | Bacteria | 4053 |
| 426 | Ga0207674_10422338 | 3300026116 | Bacteria | 1288 |
| 427 | Ga0207683_10115678 | 3300026121 | Bacteria | 2404 |
| 428 | Ga0207698_10006372 | 3300026142 | Bacteria | 7355 |
| 429 | Ga0207698_10009246 | 3300026142 | Bacteria | 6272 |
| 430 | Ga0207698_10046586 | 3300026142 | Bacteria | 3276 |
| 431 | Ga0207698_10050609 | 3300026142 | Bacteria | 3170 |
| 432 | Ga0207698_10069575 | 3300026142 | Bacteria | 2784 |
| 433 | Ga0207698_10093468 | 3300026142 | Bacteria | 2469 |
| 434 | Ga0207698_10147759 | 3300026142 | Bacteria | 2035 |
| 435 | Ga0207698_10319786 | 3300026142 | Bacteria | 1453 |
| 436 | Ga0209813_10005352 | 3300027866 | Bacteria | 3109 |
| 437 | Ga0268266_10000256 | 3300028379 | Bacteria | 89436 |
| 438 | Ga0268266_10102025 | 3300028379 | Bacteria | 2530 |
| 439 | Ga0268265_10007223 | 3300028380 | Bacteria | 7505 |
| 440 | Ga0268265_10047457 | 3300028380 | Bacteria | 3218 |
| 441 | Ga0268265_10232819 | 3300028380 | Bacteria | 1620 |
| 442 | Ga0268265_10245348 | 3300028380 | Bacteria | 1583 |
| 443 | Ga0268264_10000755 | 3300028381 | Bacteria | 36243 |
| 444 | Ga0268264_10032295 | 3300028381 | Bacteria | 4295 |
| 445 | Ga0265318_10069592 | 3300028577 | Bacteria | 1305 |
| 446 | Ga0307515_10000186 | 3300028794 | Bacteria | 153531 |
| 447 | Ga0307515_10030060 | 3300028794 | Bacteria | 9147 |
| 448 | Ga0265338_10006667 | 3300028800 | Bacteria | 14602 |
| 449 | Ga0265332_10042963 | 3300031238 | Bacteria | 1953 |
| 450 | Ga0265320_10000088 | 3300031240 | Bacteria | 77379 |
| 451 | Ga0265325_10019084 | 3300031241 | Bacteria | 3795 |
| 452 | Ga0265340_10001665 | 3300031247 | Bacteria | 12773 |
| 453 | Ga0265340_10003297 | 3300031247 | Bacteria | 9149 |
| 454 | Ga0265339_10084722 | 3300031249 | Bacteria | 1670 |
| 455 | Ga0265316_10006090 | 3300031344 | Bacteria | 11574 |
| 456 | Ga0265316_10018815 | 3300031344 | Bacteria | 5929 |
| 457 | Ga0265316_10085401 | 3300031344 | Bacteria | 2415 |
| 458 | Ga0265313_10034458 | 3300031595 | Bacteria | 2560 |
| 459 | Ga0316575_10008358 | 3300031665 | Bacteria | 3768 |
| 460 | Ga0316575_10032612 | 3300031665 | Bacteria | 2041 |
| 461 | Ga0265314_10008687 | 3300031711 | Bacteria | 8689 |
| 462 | Ga0265314_10011566 | 3300031711 | Bacteria | 7272 |
| 463 | Ga0265342_10009933 | 3300031712 | Bacteria | 6653 |
| 464 | Ga0265342_10013637 | 3300031712 | Bacteria | 5439 |
| 465 | Ga0316576_10228756 | 3300031727 | Bacteria | 1398 |
| 466 | Ga0316577_10094086 | 3300031733 | Bacteria | 1678 |
| 467 | Ga0307413_10033399 | 3300031824 | Bacteria | 2929 |
| 468 | Ga0307410_10103090 | 3300031852 | Bacteria | 2048 |
| 469 | Ga0307410_10440576 | 3300031852 | Bacteria | 1061 |
| 470 | Ga0307407_10088573 | 3300031903 | Bacteria | 1891 |
| 471 | Ga0307412_10019158 | 3300031911 | Bacteria | 4136 |
| 472 | Ga0307409_100018531 | 3300031995 | Bacteria | 4684 |
| 473 | Ga0307409_100074682 | 3300031995 | Bacteria | 2710 |
| 474 | Ga0307414_10009782 | 3300032004 | Bacteria | 5526 |
| 475 | Ga0307414_10010095 | 3300032004 | Bacteria | 5459 |
| 476 | Ga0307414_10044469 | 3300032004 | Bacteria | 3033 |
| 477 | Ga0307414_10154988 | 3300032004 | Bacteria | 1812 |
| 478 | Ga0307414_10465226 | 3300032004 | Bacteria | 1112 |
| 479 | Ga0307411_10000948 | 3300032005 | Bacteria | 11083 |
| 480 | Ga0307411_10020582 | 3300032005 | Bacteria | 3841 |
| 481 | Ga0307411_10025486 | 3300032005 | Bacteria | 3544 |
| 482 | Ga0307411_10027338 | 3300032005 | Bacteria | 3450 |
| 483 | Ga0307415_100001833 | 3300032126 | Bacteria | 10420 |
| 484 | Ga0307415_100033428 | 3300032126 | Bacteria | 3338 |
| 485 | Ga0373946_0001529 | 3300035171 | Bacteria | 8044 |
| 486 | Ga0373924_0129707 | 3300035410 | Bacteria | 1097 |
| 487 | Ga0373931_0177169 | 3300035691 | Bacteria | 1260 |
| 488 | Ga0373935_0016342 | 3300035692 | Bacteria | 4490 |
| 489 | Ga0373927_0006248 | 3300035695 | Bacteria | 8131 |
| 490 | Ga0373937_0060514 | 3300036401 | Bacteria | 3480 |
| 491 | Ga0395899_0000154 | 3300037312 | Bacteria | 104239 |
| 492 | Ga0395899_0105544 | 3300037312 | Bacteria | 2029 |
| 493 | Ga0395899_0275004 | 3300037312 | Bacteria | 1147 |
| 494 | Ga0395900_0000293 | 3300037418 | Bacteria | 75318 |
| 495 | Ga0395900_0000837 | 3300037418 | Bacteria | 40521 |
| 496 | Ga0395900_0001617 | 3300037418 | Bacteria | 26505 |
| 497 | Ga0395900_0005458 | 3300037418 | Bacteria | 13315 |
| 498 | Ga0395900_0014026 | 3300037418 | Bacteria | 8183 |
| 499 | Ga0395900_0023841 | 3300037418 | Bacteria | 6261 |
| 500 | Ga0395900_0039225 | 3300037418 | Bacteria | 4880 |
| 501 | Ga0395900_0070364 | 3300037418 | Bacteria | 3597 |
| 502 | Ga0395900_0073310 | 3300037418 | Bacteria | 3520 |
| 503 | Ga0395900_0102369 | 3300037418 | Bacteria | 2942 |
| 504 | Ga0395900_0194366 | 3300037418 | Bacteria | 2056 |
| 505 | Ga0395900_0218670 | 3300037418 | Bacteria | 1921 |
| 506 | Ga0395900_0297051 | 3300037418 | Bacteria | 1602 |
| 507 | Ga0395900_0509950 | 3300037418 | Bacteria | 1152 |
| 508 | Ga0395898_0000219 | 3300037466 | Bacteria | 146838 |
| 509 | Ga0395898_0001594 | 3300037466 | Bacteria | 30951 |
| 510 | Ga0395898_0022892 | 3300037466 | Bacteria | 6318 |
| 511 | Ga0395898_0033483 | 3300037466 | Bacteria | 5127 |
| 512 | Ga0395898_0038614 | 3300037466 | Bacteria | 4730 |
| 513 | Ga0395898_0121876 | 3300037466 | Bacteria | 2498 |
| 514 | Ga0395898_0127894 | 3300037466 | Bacteria | 2434 |
| 515 | Ga0395898_0166718 | 3300037466 | Bacteria | 2106 |
| 516 | Ga0395898_0243070 | 3300037466 | Bacteria | 1717 |
| 517 | Ga0395905_0000094 | 3300037471 | Bacteria | 147776 |
| 518 | Ga0395905_0001923 | 3300037471 | Bacteria | 23843 |
| 519 | Ga0395905_0004005 | 3300037471 | Bacteria | 15480 |
| 520 | Ga0395905_0014247 | 3300037471 | Bacteria | 7596 |
| 521 | Ga0395905_0016641 | 3300037471 | Bacteria | 6990 |
| 522 | Ga0395905_0016712 | 3300037471 | Bacteria | 6973 |
| 523 | Ga0395905_0021348 | 3300037471 | Bacteria | 6124 |
| 524 | Ga0395905_0024162 | 3300037471 | Bacteria | 5736 |
| 525 | Ga0395905_0028215 | 3300037471 | Bacteria | 5291 |
| 526 | Ga0395905_0066005 | 3300037471 | Bacteria | 3388 |
| 527 | Ga0395905_0120879 | 3300037471 | Bacteria | 2462 |
| 528 | Ga0395905_0160391 | 3300037471 | Bacteria | 2114 |
| 529 | Ga0395905_0203178 | 3300037471 | Bacteria | 1857 |
| 530 | Ga0395905_0213911 | 3300037471 | Bacteria | 1805 |
| 531 | Ga0395905_0380168 | 3300037471 | Bacteria | 1306 |
| 532 | Ga0395905_0397782 | 3300037471 | Bacteria | 1272 |
| 533 | Ga0395905_0439035 | 3300037471 | Bacteria | 1202 |
| 534 | Ga0395905_0466562 | 3300037471 | Bacteria | 1161 |
| 535 | Ga0395901_0000228 | 3300038443 | Bacteria | 70677 |
| 536 | Ga0395901_0002443 | 3300038443 | Bacteria | 18837 |
| 537 | Ga0395901_0003671 | 3300038443 | Bacteria | 15477 |
| 538 | Ga0395901_0008002 | 3300038443 | Bacteria | 10671 |
| 539 | Ga0395901_0012539 | 3300038443 | Bacteria | 8601 |
| 540 | Ga0395901_0041312 | 3300038443 | Bacteria | 4779 |
| 541 | Ga0395901_0044513 | 3300038443 | Bacteria | 4603 |
| 542 | Ga0395901_0061864 | 3300038443 | Bacteria | 3895 |
| 543 | Ga0395901_0075485 | 3300038443 | Bacteria | 3516 |
| 544 | Ga0395901_0076069 | 3300038443 | Bacteria | 3502 |
| 545 | Ga0395901_0086429 | 3300038443 | Bacteria | 3279 |
| 546 | Ga0395901_0139342 | 3300038443 | Bacteria | 2549 |
| 547 | Ga0395901_0197458 | 3300038443 | Bacteria | 2109 |
| 548 | Ga0395901_0234317 | 3300038443 | Bacteria | 1916 |
| 549 | Ga0395901_0240762 | 3300038443 | Bacteria | 1887 |
| 550 | Ga0395901_0287881 | 3300038443 | Bacteria | 1706 |
| 551 | Ga0395901_0455821 | 3300038443 | Bacteria | 1307 |
| 552 | Ga0395901_0529857 | 3300038443 | Bacteria | 1196 |
| 553 | Ga0395901_0624640 | 3300038443 | Bacteria | 1084 |
| 554 | Ga0395901_0752757 | 3300038443 | Bacteria | 967 |
| 555 | Ga0436360_0764336 | 3300039438 | Bacteria | 1608 |
| 556 | Ga0436363_1352830 | 3300039450 | Bacteria | 1624 |
| 557 | Ga0451807_0903417 | 3300041486 | Bacteria | 1196 |
| 558 | Ga0439448_0002573 | 3300042005 | Bacteria | 4944 |
| 559 | Ga0439449_0000498 | 3300042007 | Bacteria | 14738 |
| 560 | Ga0439452_011492 | 3300042010 | Bacteria | 2541 |
| 561 | Ga0439455_0000252 | 3300042012 | Bacteria | 6482 |
| 562 | Ga0439458_0000255 | 3300042157 | Bacteria | 12956 |
| 563 | Ga0439458_0006263 | 3300042157 | Bacteria | 2653 |
| 564 | Ga0450908_025005 | 3300042184 | Bacteria | 1043 |
| 565 | Ga0439464_0000114 | 3300042439 | Bacteria | 12425 |
| 566 | Ga0439460_0046173 | 3300042461 | Bacteria | 1294 |
| 567 | Ga0466963_0035095 | 3300044694 | Bacteria | 3266 |
| 568 | Ga0466963_0083554 | 3300044694 | Bacteria | 2165 |
| 569 | Ga0466957_0312078 | 3300044842 | Bacteria | 1059 |
| 570 | Ga0466960_0036053 | 3300044901 | Bacteria | 2315 |
| 571 | Ga0466959_0027362 | 3300045049 | Bacteria | 4230 |
| 572 | Ga0466958_0145877 | 3300045836 | Bacteria | 1491 |
| 573 | Ga0466967_0061960 | 3300045976 | Bacteria | 3319 |
| 574 | Ga0466967_0072406 | 3300045976 | Bacteria | 3089 |
| 575 | Ga0466967_0082937 | 3300045976 | Bacteria | 2898 |
| 576 | Ga0466967_0086492 | 3300045976 | Bacteria | 2840 |
| 577 | Ga0495627_000224 | 3300046453 | Bacteria | 60727 |
| 578 | Ga0495627_000650 | 3300046453 | Bacteria | 26905 |
| 579 | Ga0495592_0055356 | 3300046454 | Bacteria | 2935 |
| 580 | Ga0495638_0004955 | 3300046460 | Bacteria | 9998 |
| 581 | Ga0495651_0046190 | 3300046462 | Bacteria | 3371 |
| 582 | Ga0495653_0041584 | 3300046463 | Bacteria | 3587 |
| 583 | Ga0495650_0001756 | 3300046471 | Bacteria | 19720 |
| 584 | Ga0495582_0063922 | 3300046473 | Bacteria | 2032 |
| 585 | Ga0495639_0048020 | 3300046475 | Bacteria | 1935 |
| 586 | Ga0495664_0039770 | 3300046477 | Bacteria | 2779 |
| 587 | Ga0495594_0075152 | 3300046499 | Bacteria | 1883 |
| 588 | Ga0495596_0006414 | 3300046500 | Bacteria | 5412 |
| 589 | Ga0495608_0089155 | 3300046511 | Bacteria | 1996 |
| 590 | Ga0495610_0001358 | 3300046512 | Bacteria | 21731 |
| 591 | Ga0495610_0006803 | 3300046512 | Bacteria | 7759 |
| 592 | Ga0495618_0023989 | 3300046514 | Bacteria | 3776 |
| 593 | Ga0495618_0105126 | 3300046514 | Bacteria | 1808 |
| 594 | Ga0495628_0096379 | 3300046516 | Bacteria | 2285 |
| 595 | Ga0495637_0026938 | 3300046520 | Bacteria | 2575 |
| 596 | Ga0495643_0000007 | 3300046522 | Bacteria | 383435 |
| 597 | Ga0495643_0062327 | 3300046522 | Bacteria | 1974 |
| 598 | Ga0495648_0007929 | 3300046524 | Bacteria | 8425 |
| 599 | Ga0495666_0007474 | 3300046526 | Bacteria | 5471 |
| 600 | Ga0495652_0049977 | 3300046529 | Bacteria | 3577 |
| 601 | Ga0495640_0051265 | 3300046533 | Bacteria | 2837 |
| 602 | Ga0495633_0041501 | 3300046558 | Bacteria | 2188 |
| 603 | Ga0495667_0038098 | 3300046559 | Bacteria | 3202 |
| 604 | Ga0495668_0118643 | 3300046616 | Bacteria | 1447 |
| 605 | Ga0495625_0000025 | 3300046660 | Bacteria | 267383 |
| 606 | Ga0495625_0000665 | 3300046660 | Bacteria | 48983 |
| 607 | Ga0495625_0001685 | 3300046660 | Bacteria | 25771 |
| 608 | Ga0495635_0036810 | 3300046663 | Bacteria | 3389 |
| 609 | Ga0495588_0035246 | 3300046674 | Bacteria | 2535 |
| 610 | Ga0495657_0037685 | 3300046675 | Bacteria | 3330 |
| 611 | Ga0495599_0000776 | 3300046678 | Bacteria | 17964 |
| 612 | Ga0495646_0035166 | 3300046680 | Bacteria | 3108 |
| 613 | Ga0495669_0000556 | 3300046684 | Bacteria | 16545 |
| 614 | Ga0495669_0037764 | 3300046684 | Bacteria | 2138 |
| 615 | Ga0495670_0000014 | 3300046691 | Bacteria | 138993 |
| 616 | Ga0495649_0012204 | 3300046694 | Bacteria | 5009 |
| 617 | Ga0495674_0056993 | 3300047319 | Bacteria | 3420 |
| 618 | Ga0495680_0032197 | 3300047322 | Bacteria | 4260 |
| 619 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 620 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 621 | Ga0495684_0099297 | 3300047471 | Bacteria | 2201 |
| 622 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 623 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 624 | Ga0495686_0121210 | 3300047472 | Bacteria | 1558 |
| 625 | Ga0495686_0185313 | 3300047472 | Bacteria | 1203 |
| 626 | Ga0496101_0073859 | 3300048904 | Bacteria | 2506 |
| 627 | Ga0496102_0265920 | 3300048905 | Bacteria | 1617 |
| 628 | Ga0496102_0275836 | 3300048905 | Bacteria | 1585 |
| 629 | Ga0496107_0032008 | 3300048910 | Bacteria | 3757 |
| 630 | Ga0496107_0136217 | 3300048910 | Bacteria | 1814 |
| 631 | Ga0496108_0033094 | 3300048911 | Bacteria | 4294 |
| 632 | Ga0496108_0316070 | 3300048911 | Bacteria | 1361 |
| 633 | Ga0496109_0180520 | 3300048912 | Bacteria | 1982 |
| 634 | Ga0496110_0076090 | 3300048913 | Bacteria | 2984 |
| 635 | Ga0496110_0130977 | 3300048913 | Bacteria | 2265 |
| 636 | Ga0496111_0146163 | 3300048914 | Bacteria | 1753 |
| 637 | Ga0496112_0027433 | 3300048915 | Bacteria | 5490 |
| 638 | Ga0496112_0042055 | 3300048915 | Bacteria | 4472 |
| 639 | Ga0496112_0182833 | 3300048915 | Bacteria | 2060 |
| 640 | Ga0496112_0210036 | 3300048915 | Bacteria | 1904 |
| 641 | Ga0496114_0090799 | 3300048917 | Bacteria | 2593 |
| 642 | Ga0496117_0021492 | 3300048920 | Bacteria | 5217 |
| 643 | Ga0496118_0001617 | 3300048921 | Bacteria | 33315 |
| 644 | Ga0496120_0161911 | 3300048923 | Bacteria | 1115 |
| 645 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 646 | Ga0496121_0003131 | 3300048924 | Bacteria | 23873 |
| 647 | Ga0496123_0002459 | 3300048926 | Bacteria | 22941 |
| 648 | Ga0496124_0015727 | 3300048927 | Bacteria | 7234 |
| 649 | Ga0496124_0142495 | 3300048927 | Bacteria | 1890 |
| 650 | Ga0501031_0059130 | 3300049568 | Bacteria | 2498 |
| 651 | Ga0501032_0053364 | 3300049569 | Bacteria | 2723 |
| 652 | Ga0501033_0014079 | 3300049570 | Bacteria | 6082 |
| 653 | Ga0501033_0054652 | 3300049570 | Bacteria | 2953 |
| 654 | Ga0501033_0151270 | 3300049570 | Bacteria | 1674 |
| 655 | Ga0501034_0005027 | 3300049571 | Bacteria | 14533 |
| 656 | Ga0501034_0482573 | 3300049571 | Bacteria | 1155 |
| 657 | Ga0501036_0282734 | 3300049572 | Bacteria | 1388 |
| 658 | Ga0501038_0015781 | 3300049574 | Bacteria | 6864 |
| 659 | Ga0501043_0020865 | 3300049579 | Bacteria | 5139 |
| 660 | Ga0501043_0047606 | 3300049579 | Bacteria | 3371 |
| 661 | Ga0501047_0001117 | 3300049581 | Bacteria | 26643 |
| 662 | Ga0501047_0013021 | 3300049581 | Bacteria | 7877 |
| 663 | Ga0501047_0040926 | 3300049581 | Bacteria | 4480 |
| 664 | Ga0501067_0109079 | 3300049583 | Bacteria | 1539 |
| 665 | Ga0501069_0036991 | 3300049585 | Bacteria | 2693 |
| 666 | Ga0501070_0000020 | 3300049586 | Bacteria | 169025 |
| 667 | Ga0501070_0061488 | 3300049586 | Bacteria | 3111 |
| 668 | Ga0501080_0011676 | 3300049742 | Bacteria | 8046 |
| 669 | Ga0501080_0075002 | 3300049742 | Bacteria | 3147 |
| 670 | Ga0501083_0006223 | 3300049744 | Bacteria | 8467 |
| 671 | Ga0501035_0006911 | 3300049822 | Bacteria | 10599 |
| 672 | Ga0501035_0088838 | 3300049822 | Bacteria | 2722 |
| 673 | Ga0501044_0014571 | 3300049823 | Bacteria | 8481 |
| 674 | Ga0501044_0020893 | 3300049823 | Bacteria | 6989 |
| 675 | Ga0501044_0078876 | 3300049823 | Bacteria | 3337 |
| 676 | Ga0501044_0097527 | 3300049823 | Bacteria | 2960 |
| 677 | Ga0501044_0202547 | 3300049823 | Bacteria | 1942 |
| 678 | Ga0501044_0211422 | 3300049823 | Bacteria | 1894 |
| 679 | nmdc:mga0k408_161782_c1 | 3300050493 | Bacteria | 1334 |
| 680 | nmdc:mga0k408_25112_c1 | 3300050493 | Bacteria | 3372 |
| 681 | nmdc:mga0k408_34852_c2 | 3300050493 | Bacteria | 2192 |
| 682 | nmdc:mga04h51_59395_c1 | 3300050495 | Bacteria | 1307 |
| 683 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
| 684 | nmdc:mga06r32_145461_c1 | 3300050510 | Bacteria | 2348 |
| 685 | nmdc:mga08x19_143565_c1 | 3300050514 | Bacteria | 1613 |
| 686 | nmdc:mga0a205_5975_c1 | 3300050515 | Bacteria | 10970 |
| 687 | Ga0495601_0009915 | 3300053077 | Bacteria | 5644 |
| 688 | Ga0495601_0011636 | 3300053077 | Bacteria | 5272 |
| 689 | Ga0495595_0028222 | 3300053084 | Bacteria | 2506 |
| 690 | Ga0495619_0164263 | 3300053085 | Bacteria | 1534 |
| 691 | Ga0500641_0021781 | 3300053096 | Bacteria | 2448 |
| 692 | Ga0500562_002575 | 3300053108 | Bacteria | 4520 |
| 693 | Ga0500593_074444 | 3300053117 | Bacteria | 1468 |
| 694 | Ga0500597_024094 | 3300053120 | Bacteria | 2439 |
| 695 | Ga0500618_000514 | 3300053125 | Bacteria | 24477 |
| 696 | Ga0500559_0004706 | 3300053136 | Bacteria | 6423 |
| 697 | Ga0500559_0022361 | 3300053136 | Bacteria | 2681 |
| 698 | Ga0500616_0008861 | 3300053153 | Bacteria | 6182 |
| 699 | Ga0500622_0034813 | 3300053156 | Bacteria | 2637 |
| 700 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 701 | Ga0500637_0000022 | 3300053178 | Bacteria | 61494 |
| 702 | Ga0501084_0000171 | 3300054114 | Bacteria | 50689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0086492 | Ga0466967_0086492_36_830 | 260 |
| 2 | 3300005577 | Ga0068857_100135940 | Ga0068857_1001359402 | 267 |
| 3 | 3300025944 | Ga0207661_10047494 | Ga0207661_100474941 | 275 |
| 4 | 3300009093 | Ga0105240_10015147 | Ga0105240_100151476 | 276 |
| 5 | 3300010375 | Ga0105239_10732565 | Ga0105239_107325651 | 276 |
| 6 | 3300013100 | Ga0157373_10031653 | Ga0157373_100316533 | 276 |
| 7 | 3300013307 | Ga0157372_10012201 | Ga0157372_100122017 | 276 |
| 8 | 3300005339 | Ga0070660_100003291 | Ga0070660_1000032917 | 286 |
| 9 | 3300005366 | Ga0070659_100003697 | Ga0070659_1000036979 | 286 |
| 10 | 3300025913 | Ga0207695_10024131 | Ga0207695_100241316 | 286 |
| 11 | 3300025919 | Ga0207657_10003486 | Ga0207657_100034869 | 286 |
| 12 | 3300025920 | Ga0207649_10008370 | Ga0207649_100083705 | 286 |
| 13 | 3300025924 | Ga0207694_10001010 | Ga0207694_1000101021 | 286 |
| 14 | 3300025932 | Ga0207690_10004900 | Ga0207690_100049004 | 286 |
| 15 | 3300026041 | Ga0207639_10000181 | Ga0207639_1000018111 | 286 |
| 16 | 3300026116 | Ga0207674_10016271 | Ga0207674_100162715 | 286 |
| 17 | 3300005327 | Ga0070658_10038050 | Ga0070658_100380505 | 287 |
| 18 | 3300025949 | Ga0207667_10007513 | Ga0207667_1000751312 | 287 |
| 19 | 3300038443 | Ga0395901_0752757 | Ga0395901_0752757_86_949 | 287 |
| 20 | 3300049571 | Ga0501034_0482573 | Ga0501034_0482573_15_893 | 292 |
| 21 | 3300025909 | Ga0207705_10044634 | Ga0207705_100446344 | 293 |
| 22 | 3300031247 | Ga0265340_10003297 | Ga0265340_100032975 | 297 |
| 23 | 3300031344 | Ga0265316_10006090 | Ga0265316_1000609010 | 297 |
| 24 | 3300035410 | Ga0373924_0129707 | Ga0373924_0129707_125_1084 | 299 |
| 25 | 3300005536 | Ga0070697_100000139 | Ga0070697_10000013952 | 301 |
| 26 | 3300005536 | Ga0070697_100018866 | Ga0070697_1000188663 | 301 |
| 27 | 3300050514 | nmdc:mga08x19_143565_c1 | nmdc:mga08x19_143565_c1_133_1044 | 301 |
| 28 | 3300013104 | Ga0157370_10069403 | Ga0157370_100694033 | 302 |
| 29 | 3300013105 | Ga0157369_10102744 | Ga0157369_101027443 | 303 |
| 30 | 3300037418 | Ga0395900_0218670 | Ga0395900_0218670_80_1027 | 303 |
| 31 | 3300038443 | Ga0395901_0624640 | Ga0395901_0624640_81_1028 | 303 |
| 32 | 3300046473 | Ga0495582_0063922 | Ga0495582_0063922_13_993 | 303 |
| 33 | 3300013104 | Ga0157370_10204812 | Ga0157370_102048123 | 304 |
| 34 | 3300013104 | Ga0157370_10349859 | Ga0157370_103498591 | 305 |
| 35 | 3300025909 | Ga0207705_10016400 | Ga0207705_100164004 | 306 |
| 36 | 3300025919 | Ga0207657_10065052 | Ga0207657_100650523 | 306 |
| 37 | 3300025921 | Ga0207652_10052952 | Ga0207652_100529523 | 306 |
| 38 | 3300037418 | Ga0395900_0005458 | Ga0395900_0005458_1638_2558 | 306 |
| 39 | 3300037418 | Ga0395900_0102369 | Ga0395900_0102369_994_1971 | 306 |
| 40 | 3300037466 | Ga0395898_0127894 | Ga0395898_0127894_1095_2015 | 306 |
| 41 | 3300037471 | Ga0395905_0016712 | Ga0395905_0016712_1721_2698 | 306 |
| 42 | 3300038443 | Ga0395901_0086429 | Ga0395901_0086429_449_1426 | 306 |
| 43 | 3300038443 | Ga0395901_0234317 | Ga0395901_0234317_66_986 | 306 |
| 44 | 3300041486 | Ga0451807_0903417 | Ga0451807_0903417_257_1186 | 306 |
| 45 | 3300044901 | Ga0466960_0036053 | Ga0466960_0036053_1150_2073 | 306 |
| 46 | 3300048904 | Ga0496101_0073859 | Ga0496101_0073859_1340_2260 | 306 |
| 47 | 3300049823 | Ga0501044_0078876 | Ga0501044_0078876_2358_3311 | 306 |
| 48 | 3300026078 | Ga0207702_10025964 | Ga0207702_100259644 | 312 |
| 49 | 3300046522 | Ga0495643_0000007 | Ga0495643_0000007_27574_28554 | 312 |
| 50 | 3300048913 | Ga0496110_0076090 | Ga0496110_0076090_345_1283 | 312 |
| 51 | 3300048915 | Ga0496112_0182833 | Ga0496112_0182833_135_1073 | 312 |
| 52 | 3300005434 | Ga0070709_10202436 | Ga0070709_102024361 | 313 |
| 53 | 3300005471 | Ga0070698_100063579 | Ga0070698_1000635792 | 313 |
| 54 | 3300025906 | Ga0207699_10175992 | Ga0207699_101759921 | 313 |
| 55 | 3300025922 | Ga0207646_10162553 | Ga0207646_101625532 | 313 |
| 56 | 3300036401 | Ga0373937_0060514 | Ga0373937_0060514_1654_2682 | 313 |
| 57 | 3300037466 | Ga0395898_0022892 | Ga0395898_0022892_3988_4965 | 313 |
| 58 | 3300037471 | Ga0395905_0028215 | Ga0395905_0028215_3978_4955 | 313 |
| 59 | 3300046454 | Ga0495592_0055356 | Ga0495592_0055356_1658_2686 | 313 |
| 60 | 3300046462 | Ga0495651_0046190 | Ga0495651_0046190_1652_2680 | 313 |
| 61 | 3300046463 | Ga0495653_0041584 | Ga0495653_0041584_884_1912 | 313 |
| 62 | 3300046477 | Ga0495664_0039770 | Ga0495664_0039770_1102_2130 | 313 |
| 63 | 3300046511 | Ga0495608_0089155 | Ga0495608_0089155_67_1095 | 313 |
| 64 | 3300046514 | Ga0495618_0023989 | Ga0495618_0023989_1101_2129 | 313 |
| 65 | 3300046516 | Ga0495628_0096379 | Ga0495628_0096379_67_1095 | 313 |
| 66 | 3300046529 | Ga0495652_0049977 | Ga0495652_0049977_1648_2676 | 313 |
| 67 | 3300046533 | Ga0495640_0051265 | Ga0495640_0051265_1103_2131 | 313 |
| 68 | 3300046559 | Ga0495667_0038098 | Ga0495667_0038098_892_1920 | 313 |
| 69 | 3300046663 | Ga0495635_0036810 | Ga0495635_0036810_1659_2687 | 313 |
| 70 | 3300046675 | Ga0495657_0037685 | Ga0495657_0037685_654_1682 | 313 |
| 71 | 3300046678 | Ga0495599_0000776 | Ga0495599_0000776_1423_2451 | 313 |
| 72 | 3300046680 | Ga0495646_0035166 | Ga0495646_0035166_1675_2703 | 313 |
| 73 | 3300047319 | Ga0495674_0056993 | Ga0495674_0056993_735_1763 | 313 |
| 74 | 3300047322 | Ga0495680_0032197 | Ga0495680_0032197_2561_3589 | 313 |
| 75 | 3300048911 | Ga0496108_0316070 | Ga0496108_0316070_250_1278 | 313 |
| 76 | 3300048912 | Ga0496109_0180520 | Ga0496109_0180520_219_1247 | 313 |
| 77 | 3300048915 | Ga0496112_0042055 | Ga0496112_0042055_378_1406 | 313 |
| 78 | 3300053077 | Ga0495601_0009915 | Ga0495601_0009915_3056_4084 | 313 |
| 79 | 3300037418 | Ga0395900_0039225 | Ga0395900_0039225_1396_2340 | 314 |
| 80 | 3300037471 | Ga0395905_0001923 | Ga0395905_0001923_16202_17146 | 314 |
| 81 | 3300038443 | Ga0395901_0008002 | Ga0395901_0008002_6974_7918 | 314 |
| 82 | 3300038443 | Ga0395901_0240762 | Ga0395901_0240762_86_1030 | 314 |
| 83 | 3300042184 | Ga0450908_025005 | Ga0450908_025005_19_966 | 314 |
| 84 | 3300046616 | Ga0495668_0118643 | Ga0495668_0118643_11_961 | 314 |
| 85 | 3300053085 | Ga0495619_0164263 | Ga0495619_0164263_30_1034 | 314 |
| 86 | 3300005458 | Ga0070681_10093219 | Ga0070681_100932194 | 315 |
| 87 | 3300005530 | Ga0070679_100075528 | Ga0070679_1000755283 | 315 |
| 88 | 3300009551 | Ga0105238_10014401 | Ga0105238_100144016 | 315 |
| 89 | 3300013105 | Ga0157369_10002441 | Ga0157369_1000244120 | 315 |
| 90 | 3300035691 | Ga0373931_0177169 | Ga0373931_0177169_285_1235 | 315 |
| 91 | 3300037312 | Ga0395899_0000154 | Ga0395899_0000154_77181_78128 | 315 |
| 92 | 3300037312 | Ga0395899_0000154 | Ga0395899_0000154_96981_97928 | 315 |
| 93 | 3300037312 | Ga0395899_0105544 | Ga0395899_0105544_68_1015 | 315 |
| 94 | 3300037312 | Ga0395899_0275004 | Ga0395899_0275004_120_1067 | 315 |
| 95 | 3300037418 | Ga0395900_0000293 | Ga0395900_0000293_66974_67921 | 315 |
| 96 | 3300037418 | Ga0395900_0000837 | Ga0395900_0000837_31506_32453 | 315 |
| 97 | 3300037418 | Ga0395900_0014026 | Ga0395900_0014026_5472_6419 | 315 |
| 98 | 3300037418 | Ga0395900_0194366 | Ga0395900_0194366_299_1246 | 315 |
| 99 | 3300037418 | Ga0395900_0509950 | Ga0395900_0509950_178_1125 | 315 |
| 100 | 3300037466 | Ga0395898_0000219 | Ga0395898_0000219_31506_32453 | 315 |
| 101 | 3300037466 | Ga0395898_0000219 | Ga0395898_0000219_51306_52253 | 315 |
| 102 | 3300037466 | Ga0395898_0033483 | Ga0395898_0033483_3915_4862 | 315 |
| 103 | 3300037466 | Ga0395898_0166718 | Ga0395898_0166718_248_1195 | 315 |
| 104 | 3300037471 | Ga0395905_0000094 | Ga0395905_0000094_32444_33391 | 315 |
| 105 | 3300037471 | Ga0395905_0000094 | Ga0395905_0000094_52244_53191 | 315 |
| 106 | 3300037471 | Ga0395905_0021348 | Ga0395905_0021348_2737_3684 | 315 |
| 107 | 3300037471 | Ga0395905_0120879 | Ga0395905_0120879_477_1424 | 315 |
| 108 | 3300037471 | Ga0395905_0160391 | Ga0395905_0160391_386_1333 | 315 |
| 109 | 3300037471 | Ga0395905_0439035 | Ga0395905_0439035_136_1083 | 315 |
| 110 | 3300037471 | Ga0395905_0466562 | Ga0395905_0466562_34_981 | 315 |
| 111 | 3300038443 | Ga0395901_0000228 | Ga0395901_0000228_66974_67921 | 315 |
| 112 | 3300038443 | Ga0395901_0003671 | Ga0395901_0003671_7590_8537 | 315 |
| 113 | 3300038443 | Ga0395901_0044513 | Ga0395901_0044513_1171_2118 | 315 |
| 114 | 3300038443 | Ga0395901_0075485 | Ga0395901_0075485_1946_2893 | 315 |
| 115 | 3300038443 | Ga0395901_0076069 | Ga0395901_0076069_60_1007 | 315 |
| 116 | 3300038443 | Ga0395901_0197458 | Ga0395901_0197458_911_1858 | 315 |
| 117 | 3300038443 | Ga0395901_0529857 | Ga0395901_0529857_131_1108 | 315 |
| 118 | 3300044694 | Ga0466963_0083554 | Ga0466963_0083554_22_969 | 315 |
| 119 | 3300045049 | Ga0466959_0027362 | Ga0466959_0027362_382_1329 | 315 |
| 120 | 3300045836 | Ga0466958_0145877 | Ga0466958_0145877_310_1257 | 315 |
| 121 | 3300045976 | Ga0466967_0061960 | Ga0466967_0061960_943_1890 | 315 |
| 122 | 3300046684 | Ga0495669_0037764 | Ga0495669_0037764_50_997 | 315 |
| 123 | 3300048920 | Ga0496117_0021492 | Ga0496117_0021492_4251_5207 | 315 |
| 124 | 3300026121 | Ga0207683_10115678 | Ga0207683_101156782 | 316 |
| 125 | 3300049571 | Ga0501034_0005027 | Ga0501034_0005027_6342_7322 | 318 |
| 126 | 3300053108 | Ga0500562_002575 | Ga0500562_002575_2654_3631 | 319 |
| 127 | 3300013104 | Ga0157370_10025395 | Ga0157370_100253956 | 320 |
| 128 | 3300049823 | Ga0501044_0211422 | Ga0501044_0211422_837_1832 | 320 |
| 129 | iso_pu_bacteria | 2510917021 | 2511130088 | 320 |
| 130 | iso_pu_bacteria | 2738541281 | 2738745027 | 320 |
| 131 | iso_pu_bacteria | 2738543032 | 2739354257 | 320 |
| 132 | 3300005344 | Ga0070661_100061923 | Ga0070661_1000619233 | 321 |
| 133 | 3300005459 | Ga0068867_100016740 | Ga0068867_1000167403 | 321 |
| 134 | 3300005616 | Ga0068852_100102314 | Ga0068852_1001023142 | 321 |
| 135 | 3300005842 | Ga0068858_100235315 | Ga0068858_1002353152 | 321 |
| 136 | 3300006042 | Ga0075368_10087558 | Ga0075368_100875582 | 321 |
| 137 | 3300009098 | Ga0105245_10000198 | Ga0105245_1000019864 | 321 |
| 138 | 3300009098 | Ga0105245_10063705 | Ga0105245_100637055 | 321 |
| 139 | 3300009148 | Ga0105243_10010602 | Ga0105243_100106025 | 321 |
| 140 | 3300009148 | Ga0105243_10298211 | Ga0105243_102982111 | 321 |
| 141 | 3300009177 | Ga0105248_10000391 | Ga0105248_100003916 | 321 |
| 142 | 3300009545 | Ga0105237_10243467 | Ga0105237_102434672 | 321 |
| 143 | 3300010375 | Ga0105239_10477424 | Ga0105239_104774242 | 321 |
| 144 | 3300011119 | Ga0105246_10073297 | Ga0105246_100732973 | 321 |
| 145 | 3300011119 | Ga0105246_10368332 | Ga0105246_103683321 | 321 |
| 146 | 3300013100 | Ga0157373_10010344 | Ga0157373_100103445 | 321 |
| 147 | 3300013102 | Ga0157371_10002789 | Ga0157371_100027897 | 321 |
| 148 | 3300013102 | Ga0157371_10293365 | Ga0157371_102933651 | 321 |
| 149 | 3300013297 | Ga0157378_10001311 | Ga0157378_100013118 | 321 |
| 150 | 3300013306 | Ga0163162_10072048 | Ga0163162_100720482 | 321 |
| 151 | 3300014745 | Ga0157377_10022379 | Ga0157377_100223791 | 321 |
| 152 | 3300037471 | Ga0395905_0203178 | Ga0395905_0203178_48_1013 | 321 |
| 153 | 3300046453 | Ga0495627_000224 | Ga0495627_000224_31948_32928 | 321 |
| 154 | 3300046471 | Ga0495650_0001756 | Ga0495650_0001756_15834_16814 | 321 |
| 155 | 3300047470 | Ga0495681_0000011 | Ga0495681_0000011_37027_38007 | 321 |
| 156 | 3300050493 | nmdc:mga0k408_34852_c2 | nmdc:mga0k408_34852_c2_589_1563 | 321 |
| 157 | 3300050495 | nmdc:mga04h51_59395_c1 | nmdc:mga04h51_59395_c1_320_1285 | 321 |
| 158 | 3300050515 | nmdc:mga0a205_5975_c1 | nmdc:mga0a205_5975_c1_1563_2528 | 321 |
| 159 | 3300053136 | Ga0500559_0022361 | Ga0500559_0022361_1245_2210 | 321 |
| 160 | iso_pu_bacteria | 2510917020 | 2511120387 | 321 |
| 161 | iso_pu_bacteria | 2643221583 | 2643924796 | 321 |
| 162 | iso_pu_bacteria | 2830075706 | 2830076896 | 321 |
| 163 | iso_pu_bacteria | 2885429604 | 2885430718 | 321 |
| 164 | iso_pu_bacteria | 2919513703 | 2919514470 | 321 |
| 165 | iso_pu_bacteria | 2946787523 | 2946789656 | 321 |
| 166 | 3300005355 | Ga0070671_100021780 | Ga0070671_1000217806 | 322 |
| 167 | 3300049583 | Ga0501067_0109079 | Ga0501067_0109079_510_1487 | 322 |
| 168 | 3300054114 | Ga0501084_0000171 | Ga0501084_0000171_40166_41143 | 322 |
| 169 | 3300005981 | Ga0081538_10018384 | Ga0081538_100183845 | 323 |
| 170 | 3300009093 | Ga0105240_10085276 | Ga0105240_100852762 | 323 |
| 171 | 3300025261 | Ga0209233_1013690 | Ga0209233_10136902 | 323 |
| 172 | 3300025913 | Ga0207695_10458431 | Ga0207695_104584311 | 323 |
| 173 | 3300025915 | Ga0207693_10067961 | Ga0207693_100679611 | 323 |
| 174 | 3300031247 | Ga0265340_10001665 | Ga0265340_100016652 | 323 |
| 175 | 3300031249 | Ga0265339_10084722 | Ga0265339_100847222 | 323 |
| 176 | 3300031344 | Ga0265316_10018815 | Ga0265316_100188154 | 323 |
| 177 | 3300031665 | Ga0316575_10008358 | Ga0316575_100083582 | 323 |
| 178 | 3300031665 | Ga0316575_10032612 | Ga0316575_100326122 | 323 |
| 179 | 3300031712 | Ga0265342_10009933 | Ga0265342_100099332 | 323 |
| 180 | 3300031727 | Ga0316576_10228756 | Ga0316576_102287561 | 323 |
| 181 | 3300031733 | Ga0316577_10094086 | Ga0316577_100940862 | 323 |
| 182 | 3300037466 | Ga0395898_0243070 | Ga0395898_0243070_232_1242 | 323 |
| 183 | 3300046524 | Ga0495648_0007929 | Ga0495648_0007929_1736_2713 | 323 |
| 184 | 3300046558 | Ga0495633_0041501 | Ga0495633_0041501_1192_2169 | 323 |
| 185 | 3300048915 | Ga0496112_0027433 | Ga0496112_0027433_1727_2743 | 323 |
| 186 | 3300049744 | Ga0501083_0006223 | Ga0501083_0006223_4568_5569 | 323 |
| 187 | 3300053117 | Ga0500593_074444 | Ga0500593_074444_161_1162 | 323 |
| 188 | iso_pu_bacteria | 2791355406 | 2793978932 | 323 |
| 189 | iso_pu_bacteria | 8048127548 | 8048137243 | 323 |
| 190 | 3300003320 | rootH2_10075661 | rootH2_100756612 | 324 |
| 191 | 3300005327 | Ga0070658_10246114 | Ga0070658_102461142 | 324 |
| 192 | 3300005327 | Ga0070658_10318277 | Ga0070658_103182772 | 324 |
| 193 | 3300005336 | Ga0070680_100008701 | Ga0070680_1000087012 | 324 |
| 194 | 3300005336 | Ga0070680_100255725 | Ga0070680_1002557252 | 324 |
| 195 | 3300005339 | Ga0070660_100266557 | Ga0070660_1002665571 | 324 |
| 196 | 3300005341 | Ga0070691_10123756 | Ga0070691_101237562 | 324 |
| 197 | 3300005458 | Ga0070681_10113562 | Ga0070681_101135623 | 324 |
| 198 | 3300005458 | Ga0070681_10315254 | Ga0070681_103152542 | 324 |
| 199 | 3300005458 | Ga0070681_10332708 | Ga0070681_103327082 | 324 |
| 200 | 3300005530 | Ga0070679_100320061 | Ga0070679_1003200612 | 324 |
| 201 | 3300005530 | Ga0070679_100479188 | Ga0070679_1004791882 | 324 |
| 202 | 3300005563 | Ga0068855_100394571 | Ga0068855_1003945712 | 324 |
| 203 | 3300005563 | Ga0068855_100395925 | Ga0068855_1003959252 | 324 |
| 204 | 3300005614 | Ga0068856_100057631 | Ga0068856_1000576313 | 324 |
| 205 | 3300005616 | Ga0068852_100005893 | Ga0068852_1000058937 | 324 |
| 206 | 3300006844 | Ga0075428_100131976 | Ga0075428_1001319762 | 324 |
| 207 | 3300006847 | Ga0075431_100288808 | Ga0075431_1002888082 | 324 |
| 208 | 3300009093 | Ga0105240_10018070 | Ga0105240_100180707 | 324 |
| 209 | 3300009551 | Ga0105238_10007731 | Ga0105238_100077314 | 324 |
| 210 | 3300013104 | Ga0157370_10032238 | Ga0157370_100322382 | 324 |
| 211 | 3300013104 | Ga0157370_10284948 | Ga0157370_102849482 | 324 |
| 212 | 3300013104 | Ga0157370_10295723 | Ga0157370_102957232 | 324 |
| 213 | 3300013105 | Ga0157369_10098789 | Ga0157369_100987892 | 324 |
| 214 | 3300020082 | Ga0206353_10434619 | Ga0206353_104346193 | 324 |
| 215 | 3300025909 | Ga0207705_10000647 | Ga0207705_1000064720 | 324 |
| 216 | 3300025912 | Ga0207707_10004869 | Ga0207707_100048692 | 324 |
| 217 | 3300025912 | Ga0207707_10012471 | Ga0207707_100124712 | 324 |
| 218 | 3300025912 | Ga0207707_10271783 | Ga0207707_102717832 | 324 |
| 219 | 3300025913 | Ga0207695_10292239 | Ga0207695_102922392 | 324 |
| 220 | 3300025917 | Ga0207660_10000720 | Ga0207660_1000072012 | 324 |
| 221 | 3300025917 | Ga0207660_10002930 | Ga0207660_100029302 | 324 |
| 222 | 3300025917 | Ga0207660_10004462 | Ga0207660_100044622 | 324 |
| 223 | 3300025919 | Ga0207657_10002443 | Ga0207657_1000244318 | 324 |
| 224 | 3300025921 | Ga0207652_10001317 | Ga0207652_1000131712 | 324 |
| 225 | 3300025921 | Ga0207652_10002779 | Ga0207652_1000277910 | 324 |
| 226 | 3300025949 | Ga0207667_10029561 | Ga0207667_100295614 | 324 |
| 227 | 3300025949 | Ga0207667_10061822 | Ga0207667_100618224 | 324 |
| 228 | 3300026142 | Ga0207698_10050609 | Ga0207698_100506092 | 324 |
| 229 | 3300028794 | Ga0307515_10030060 | Ga0307515_100300602 | 324 |
| 230 | 3300031711 | Ga0265314_10008687 | Ga0265314_100086876 | 324 |
| 231 | 3300035171 | Ga0373946_0001529 | Ga0373946_0001529_5493_6473 | 324 |
| 232 | 3300035692 | Ga0373935_0016342 | Ga0373935_0016342_1993_2973 | 324 |
| 233 | 3300035695 | Ga0373927_0006248 | Ga0373927_0006248_1240_2220 | 324 |
| 234 | 3300038443 | Ga0395901_0455821 | Ga0395901_0455821_64_1098 | 324 |
| 235 | 3300045976 | Ga0466967_0082937 | Ga0466967_0082937_387_1361 | 324 |
| 236 | 3300046475 | Ga0495639_0048020 | Ga0495639_0048020_826_1806 | 324 |
| 237 | 3300046499 | Ga0495594_0075152 | Ga0495594_0075152_885_1865 | 324 |
| 238 | 3300046500 | Ga0495596_0006414 | Ga0495596_0006414_149_1129 | 324 |
| 239 | 3300046512 | Ga0495610_0001358 | Ga0495610_0001358_15808_16788 | 324 |
| 240 | 3300046514 | Ga0495618_0105126 | Ga0495618_0105126_114_1148 | 324 |
| 241 | 3300046522 | Ga0495643_0062327 | Ga0495643_0062327_43_1023 | 324 |
| 242 | 3300046526 | Ga0495666_0007474 | Ga0495666_0007474_3251_4282 | 324 |
| 243 | 3300046660 | Ga0495625_0000025 | Ga0495625_0000025_216815_217789 | 324 |
| 244 | 3300046660 | Ga0495625_0000665 | Ga0495625_0000665_20279_21268 | 324 |
| 245 | 3300046660 | Ga0495625_0001685 | Ga0495625_0001685_15275_16255 | 324 |
| 246 | 3300047471 | Ga0495684_0099297 | Ga0495684_0099297_900_1934 | 324 |
| 247 | 3300048911 | Ga0496108_0033094 | Ga0496108_0033094_3023_3997 | 324 |
| 248 | 3300049568 | Ga0501031_0059130 | Ga0501031_0059130_983_1990 | 324 |
| 249 | 3300049569 | Ga0501032_0053364 | Ga0501032_0053364_1030_2046 | 324 |
| 250 | 3300049570 | Ga0501033_0054652 | Ga0501033_0054652_561_1568 | 324 |
| 251 | 3300049570 | Ga0501033_0151270 | Ga0501033_0151270_429_1436 | 324 |
| 252 | 3300049574 | Ga0501038_0015781 | Ga0501038_0015781_1102_2109 | 324 |
| 253 | 3300049579 | Ga0501043_0047606 | Ga0501043_0047606_537_1553 | 324 |
| 254 | 3300049581 | Ga0501047_0040926 | Ga0501047_0040926_770_1786 | 324 |
| 255 | 3300049586 | Ga0501070_0000020 | Ga0501070_0000020_59707_60714 | 324 |
| 256 | 3300049586 | Ga0501070_0061488 | Ga0501070_0061488_816_1832 | 324 |
| 257 | 3300049742 | Ga0501080_0011676 | Ga0501080_0011676_4159_5175 | 324 |
| 258 | 3300049742 | Ga0501080_0075002 | Ga0501080_0075002_292_1299 | 324 |
| 259 | 3300049822 | Ga0501035_0006911 | Ga0501035_0006911_8481_9488 | 324 |
| 260 | 3300049822 | Ga0501035_0088838 | Ga0501035_0088838_1005_2021 | 324 |
| 261 | 3300049823 | Ga0501044_0020893 | Ga0501044_0020893_2495_3511 | 324 |
| 262 | 3300049823 | Ga0501044_0097527 | Ga0501044_0097527_1649_2656 | 324 |
| 263 | 3300049823 | Ga0501044_0202547 | Ga0501044_0202547_369_1376 | 324 |
| 264 | 3300050510 | nmdc:mga06r32_145461_c1 | nmdc:mga06r32_145461_c1_976_1965 | 324 |
| 265 | 3300053077 | Ga0495601_0011636 | Ga0495601_0011636_1131_2165 | 324 |
| 266 | 3300053084 | Ga0495595_0028222 | Ga0495595_0028222_692_1726 | 324 |
| 267 | 3300053136 | Ga0500559_0004706 | Ga0500559_0004706_3278_4252 | 324 |
| 268 | 3300001979 | JGI24740J21852_10005372 | JGI24740J21852_100053724 | 325 |
| 269 | 3300001989 | JGI24739J22299_10004790 | JGI24739J22299_100047905 | 325 |
| 270 | 3300001989 | JGI24739J22299_10009552 | JGI24739J22299_100095522 | 325 |
| 271 | 3300001989 | JGI24739J22299_10049772 | JGI24739J22299_100497722 | 325 |
| 272 | 3300001990 | JGI24737J22298_10000687 | JGI24737J22298_100006878 | 325 |
| 273 | 3300002067 | JGI24735J21928_10027297 | JGI24735J21928_100272972 | 325 |
| 274 | 3300002075 | JGI24738J21930_10002091 | JGI24738J21930_100020914 | 325 |
| 275 | 3300002075 | JGI24738J21930_10007677 | JGI24738J21930_100076774 | 325 |
| 276 | 3300002774 | JGI25150J39212_1000020 | JGI25150J39212_100002075 | 325 |
| 277 | 3300003187 | JGI25151J46595_10055943 | JGI25151J46595_100559431 | 325 |
| 278 | 3300003215 | JGI25153J46596_10000017 | JGI25153J46596_10000017141 | 325 |
| 279 | 3300003781 | Ga0055536_1011158 | Ga0055536_10111584 | 325 |
| 280 | 3300003791 | Ga0055530_10016424 | Ga0055530_100164242 | 325 |
| 281 | 3300003792 | Ga0055540_1005503 | Ga0055540_10055033 | 325 |
| 282 | 3300005262 | Ga0065165_1000625 | Ga0065165_10006252 | 325 |
| 283 | 3300005288 | Ga0065714_10109070 | Ga0065714_101090701 | 325 |
| 284 | 3300005327 | Ga0070658_10008641 | Ga0070658_100086418 | 325 |
| 285 | 3300005327 | Ga0070658_10040306 | Ga0070658_100403063 | 325 |
| 286 | 3300005327 | Ga0070658_10222296 | Ga0070658_102222962 | 325 |
| 287 | 3300005328 | Ga0070676_10004172 | Ga0070676_100041725 | 325 |
| 288 | 3300005329 | Ga0070683_100025567 | Ga0070683_1000255676 | 325 |
| 289 | 3300005329 | Ga0070683_100218535 | Ga0070683_1002185352 | 325 |
| 290 | 3300005330 | Ga0070690_100091417 | Ga0070690_1000914172 | 325 |
| 291 | 3300005331 | Ga0070670_100016900 | Ga0070670_1000169003 | 325 |
| 292 | 3300005331 | Ga0070670_100025510 | Ga0070670_1000255104 | 325 |
| 293 | 3300005334 | Ga0068869_100003116 | Ga0068869_1000031167 | 325 |
| 294 | 3300005335 | Ga0070666_10062831 | Ga0070666_100628311 | 325 |
| 295 | 3300005336 | Ga0070680_100000777 | Ga0070680_10000077713 | 325 |
| 296 | 3300005336 | Ga0070680_100001609 | Ga0070680_1000016094 | 325 |
| 297 | 3300005336 | Ga0070680_100310653 | Ga0070680_1003106531 | 325 |
| 298 | 3300005337 | Ga0070682_100035315 | Ga0070682_1000353154 | 325 |
| 299 | 3300005338 | Ga0068868_100011184 | Ga0068868_1000111842 | 325 |
| 300 | 3300005339 | Ga0070660_100004065 | Ga0070660_1000040656 | 325 |
| 301 | 3300005339 | Ga0070660_100017639 | Ga0070660_1000176397 | 325 |
| 302 | 3300005339 | Ga0070660_100029155 | Ga0070660_1000291552 | 325 |
| 303 | 3300005339 | Ga0070660_100047766 | Ga0070660_1000477662 | 325 |
| 304 | 3300005339 | Ga0070660_100160963 | Ga0070660_1001609632 | 325 |
| 305 | 3300005339 | Ga0070660_100186491 | Ga0070660_1001864911 | 325 |
| 306 | 3300005339 | Ga0070660_100310240 | Ga0070660_1003102402 | 325 |
| 307 | 3300005339 | Ga0070660_100362680 | Ga0070660_1003626802 | 325 |
| 308 | 3300005341 | Ga0070691_10008548 | Ga0070691_100085484 | 325 |
| 309 | 3300005344 | Ga0070661_100001494 | Ga0070661_10000149412 | 325 |
| 310 | 3300005344 | Ga0070661_100040130 | Ga0070661_1000401303 | 325 |
| 311 | 3300005344 | Ga0070661_100108664 | Ga0070661_1001086643 | 325 |
| 312 | 3300005344 | Ga0070661_100169133 | Ga0070661_1001691333 | 325 |
| 313 | 3300005344 | Ga0070661_100182187 | Ga0070661_1001821871 | 325 |
| 314 | 3300005345 | Ga0070692_10041405 | Ga0070692_100414051 | 325 |
| 315 | 3300005347 | Ga0070668_100043360 | Ga0070668_1000433603 | 325 |
| 316 | 3300005353 | Ga0070669_100000138 | Ga0070669_10000013872 | 325 |
| 317 | 3300005353 | Ga0070669_100041151 | Ga0070669_1000411514 | 325 |
| 318 | 3300005354 | Ga0070675_100021410 | Ga0070675_1000214104 | 325 |
| 319 | 3300005355 | Ga0070671_100027056 | Ga0070671_1000270562 | 325 |
| 320 | 3300005355 | Ga0070671_100104838 | Ga0070671_1001048382 | 325 |
| 321 | 3300005355 | Ga0070671_100232034 | Ga0070671_1002320342 | 325 |
| 322 | 3300005356 | Ga0070674_100033254 | Ga0070674_1000332543 | 325 |
| 323 | 3300005364 | Ga0070673_100002586 | Ga0070673_1000025864 | 325 |
| 324 | 3300005364 | Ga0070673_100004948 | Ga0070673_1000049486 | 325 |
| 325 | 3300005366 | Ga0070659_100001040 | Ga0070659_10000104010 | 325 |
| 326 | 3300005366 | Ga0070659_100007325 | Ga0070659_1000073253 | 325 |
| 327 | 3300005366 | Ga0070659_100015988 | Ga0070659_1000159884 | 325 |
| 328 | 3300005366 | Ga0070659_100027275 | Ga0070659_1000272753 | 325 |
| 329 | 3300005366 | Ga0070659_100065256 | Ga0070659_1000652564 | 325 |
| 330 | 3300005366 | Ga0070659_100075317 | Ga0070659_1000753173 | 325 |
| 331 | 3300005366 | Ga0070659_100112163 | Ga0070659_1001121632 | 325 |
| 332 | 3300005367 | Ga0070667_100047812 | Ga0070667_1000478123 | 325 |
| 333 | 3300005367 | Ga0070667_100227132 | Ga0070667_1002271322 | 325 |
| 334 | 3300005444 | Ga0070694_100020574 | Ga0070694_1000205745 | 325 |
| 335 | 3300005455 | Ga0070663_100048900 | Ga0070663_1000489003 | 325 |
| 336 | 3300005455 | Ga0070663_100109285 | Ga0070663_1001092852 | 325 |
| 337 | 3300005455 | Ga0070663_100276188 | Ga0070663_1002761882 | 325 |
| 338 | 3300005455 | Ga0070663_100398467 | Ga0070663_1003984671 | 325 |
| 339 | 3300005457 | Ga0070662_100001837 | Ga0070662_1000018372 | 325 |
| 340 | 3300005457 | Ga0070662_100001928 | Ga0070662_1000019287 | 325 |
| 341 | 3300005457 | Ga0070662_100080350 | Ga0070662_1000803503 | 325 |
| 342 | 3300005458 | Ga0070681_10006985 | Ga0070681_100069854 | 325 |
| 343 | 3300005459 | Ga0068867_100010664 | Ga0068867_1000106644 | 325 |
| 344 | 3300005530 | Ga0070679_100004635 | Ga0070679_1000046352 | 325 |
| 345 | 3300005530 | Ga0070679_100077512 | Ga0070679_1000775123 | 325 |
| 346 | 3300005530 | Ga0070679_100330242 | Ga0070679_1003302422 | 325 |
| 347 | 3300005530 | Ga0070679_100419467 | Ga0070679_1004194672 | 325 |
| 348 | 3300005535 | Ga0070684_100027737 | Ga0070684_1000277373 | 325 |
| 349 | 3300005535 | Ga0070684_100124210 | Ga0070684_1001242102 | 325 |
| 350 | 3300005535 | Ga0070684_100345018 | Ga0070684_1003450182 | 325 |
| 351 | 3300005539 | Ga0068853_100004994 | Ga0068853_1000049942 | 325 |
| 352 | 3300005539 | Ga0068853_100027359 | Ga0068853_1000273594 | 325 |
| 353 | 3300005539 | Ga0068853_100027704 | Ga0068853_1000277042 | 325 |
| 354 | 3300005539 | Ga0068853_100033891 | Ga0068853_1000338912 | 325 |
| 355 | 3300005539 | Ga0068853_100113339 | Ga0068853_1001133392 | 325 |
| 356 | 3300005539 | Ga0068853_100116126 | Ga0068853_1001161262 | 325 |
| 357 | 3300005539 | Ga0068853_100134100 | Ga0068853_1001341004 | 325 |
| 358 | 3300005543 | Ga0070672_100000868 | Ga0070672_1000008689 | 325 |
| 359 | 3300005547 | Ga0070693_100284404 | Ga0070693_1002844041 | 325 |
| 360 | 3300005548 | Ga0070665_100000380 | Ga0070665_1000003807 | 325 |
| 361 | 3300005548 | Ga0070665_100138367 | Ga0070665_1001383672 | 325 |
| 362 | 3300005563 | Ga0068855_100001148 | Ga0068855_10000114819 | 325 |
| 363 | 3300005563 | Ga0068855_100008821 | Ga0068855_1000088218 | 325 |
| 364 | 3300005563 | Ga0068855_100010741 | Ga0068855_1000107415 | 325 |
| 365 | 3300005563 | Ga0068855_100709803 | Ga0068855_1007098031 | 325 |
| 366 | 3300005564 | Ga0070664_100002792 | Ga0070664_1000027924 | 325 |
| 367 | 3300005564 | Ga0070664_100004946 | Ga0070664_1000049462 | 325 |
| 368 | 3300005564 | Ga0070664_100006300 | Ga0070664_1000063002 | 325 |
| 369 | 3300005564 | Ga0070664_100043512 | Ga0070664_1000435123 | 325 |
| 370 | 3300005564 | Ga0070664_100057463 | Ga0070664_1000574634 | 325 |
| 371 | 3300005577 | Ga0068857_100007132 | Ga0068857_1000071327 | 325 |
| 372 | 3300005577 | Ga0068857_100021844 | Ga0068857_1000218443 | 325 |
| 373 | 3300005577 | Ga0068857_100041994 | Ga0068857_1000419947 | 325 |
| 374 | 3300005577 | Ga0068857_100107278 | Ga0068857_1001072782 | 325 |
| 375 | 3300005577 | Ga0068857_100189409 | Ga0068857_1001894092 | 325 |
| 376 | 3300005577 | Ga0068857_100313261 | Ga0068857_1003132612 | 325 |
| 377 | 3300005578 | Ga0068854_100005266 | Ga0068854_1000052663 | 325 |
| 378 | 3300005578 | Ga0068854_100014636 | Ga0068854_1000146364 | 325 |
| 379 | 3300005578 | Ga0068854_100072173 | Ga0068854_1000721731 | 325 |
| 380 | 3300005578 | Ga0068854_100072875 | Ga0068854_1000728753 | 325 |
| 381 | 3300005578 | Ga0068854_100240021 | Ga0068854_1002400212 | 325 |
| 382 | 3300005614 | Ga0068856_100009932 | Ga0068856_1000099322 | 325 |
| 383 | 3300005614 | Ga0068856_100047053 | Ga0068856_1000470532 | 325 |
| 384 | 3300005614 | Ga0068856_100347459 | Ga0068856_1003474592 | 325 |
| 385 | 3300005614 | Ga0068856_100618558 | Ga0068856_1006185581 | 325 |
| 386 | 3300005616 | Ga0068852_100000946 | Ga0068852_10000094615 | 325 |
| 387 | 3300005616 | Ga0068852_100018079 | Ga0068852_1000180795 | 325 |
| 388 | 3300005616 | Ga0068852_100112815 | Ga0068852_1001128152 | 325 |
| 389 | 3300005616 | Ga0068852_100125607 | Ga0068852_1001256071 | 325 |
| 390 | 3300005616 | Ga0068852_100225606 | Ga0068852_1002256062 | 325 |
| 391 | 3300005616 | Ga0068852_100505068 | Ga0068852_1005050682 | 325 |
| 392 | 3300005617 | Ga0068859_100000550 | Ga0068859_10000055041 | 325 |
| 393 | 3300005617 | Ga0068859_100006426 | Ga0068859_1000064263 | 325 |
| 394 | 3300005617 | Ga0068859_100073328 | Ga0068859_1000733283 | 325 |
| 395 | 3300005617 | Ga0068859_100155178 | Ga0068859_1001551784 | 325 |
| 396 | 3300005618 | Ga0068864_100003528 | Ga0068864_1000035286 | 325 |
| 397 | 3300005618 | Ga0068864_100005190 | Ga0068864_1000051903 | 325 |
| 398 | 3300005834 | Ga0068851_10012796 | Ga0068851_100127962 | 325 |
| 399 | 3300005834 | Ga0068851_10014173 | Ga0068851_100141732 | 325 |
| 400 | 3300005841 | Ga0068863_100004087 | Ga0068863_1000040876 | 325 |
| 401 | 3300005841 | Ga0068863_100009309 | Ga0068863_1000093099 | 325 |
| 402 | 3300005841 | Ga0068863_100048341 | Ga0068863_1000483411 | 325 |
| 403 | 3300005841 | Ga0068863_100226573 | Ga0068863_1002265732 | 325 |
| 404 | 3300005842 | Ga0068858_100002589 | Ga0068858_1000025894 | 325 |
| 405 | 3300005842 | Ga0068858_100004956 | Ga0068858_1000049565 | 325 |
| 406 | 3300005842 | Ga0068858_100023934 | Ga0068858_1000239348 | 325 |
| 407 | 3300005842 | Ga0068858_100025161 | Ga0068858_1000251614 | 325 |
| 408 | 3300005843 | Ga0068860_100004406 | Ga0068860_1000044068 | 325 |
| 409 | 3300005843 | Ga0068860_100006884 | Ga0068860_1000068843 | 325 |
| 410 | 3300005843 | Ga0068860_100284558 | Ga0068860_1002845582 | 325 |
| 411 | 3300005844 | Ga0068862_100006635 | Ga0068862_1000066356 | 325 |
| 412 | 3300005844 | Ga0068862_100021749 | Ga0068862_1000217496 | 325 |
| 413 | 3300006175 | Ga0070712_100185284 | Ga0070712_1001852842 | 325 |
| 414 | 3300006195 | Ga0075366_10026901 | Ga0075366_100269013 | 325 |
| 415 | 3300006195 | Ga0075366_10067766 | Ga0075366_100677661 | 325 |
| 416 | 3300006195 | Ga0075366_10180035 | Ga0075366_101800352 | 325 |
| 417 | 3300006353 | Ga0075370_10000001 | Ga0075370_10000001140 | 325 |
| 418 | 3300006358 | Ga0068871_100405905 | Ga0068871_1004059051 | 325 |
| 419 | 3300006852 | Ga0075433_10010202 | Ga0075433_100102029 | 325 |
| 420 | 3300006881 | Ga0068865_100005976 | Ga0068865_1000059764 | 325 |
| 421 | 3300006931 | Ga0097620_100000550 | Ga0097620_10000055041 | 325 |
| 422 | 3300006931 | Ga0097620_100006426 | Ga0097620_1000064263 | 325 |
| 423 | 3300006931 | Ga0097620_100073329 | Ga0097620_1000733293 | 325 |
| 424 | 3300006931 | Ga0097620_100155181 | Ga0097620_1001551814 | 325 |
| 425 | 3300009093 | Ga0105240_10010679 | Ga0105240_100106792 | 325 |
| 426 | 3300009093 | Ga0105240_10065883 | Ga0105240_100658833 | 325 |
| 427 | 3300009093 | Ga0105240_10150136 | Ga0105240_101501362 | 325 |
| 428 | 3300009101 | Ga0105247_10018070 | Ga0105247_100180703 | 325 |
| 429 | 3300009174 | Ga0105241_10027469 | Ga0105241_100274693 | 325 |
| 430 | 3300009174 | Ga0105241_10284753 | Ga0105241_102847532 | 325 |
| 431 | 3300009177 | Ga0105248_10031695 | Ga0105248_100316952 | 325 |
| 432 | 3300009551 | Ga0105238_10052170 | Ga0105238_100521703 | 325 |
| 433 | 3300010375 | Ga0105239_10053714 | Ga0105239_100537144 | 325 |
| 434 | 3300013100 | Ga0157373_10076574 | Ga0157373_100765742 | 325 |
| 435 | 3300013100 | Ga0157373_10081004 | Ga0157373_100810042 | 325 |
| 436 | 3300013100 | Ga0157373_10142136 | Ga0157373_101421362 | 325 |
| 437 | 3300013102 | Ga0157371_10002797 | Ga0157371_100027974 | 325 |
| 438 | 3300013104 | Ga0157370_10006108 | Ga0157370_100061086 | 325 |
| 439 | 3300013104 | Ga0157370_10097207 | Ga0157370_100972073 | 325 |
| 440 | 3300013104 | Ga0157370_10130551 | Ga0157370_101305513 | 325 |
| 441 | 3300013105 | Ga0157369_10007310 | Ga0157369_100073106 | 325 |
| 442 | 3300013105 | Ga0157369_10085210 | Ga0157369_100852103 | 325 |
| 443 | 3300013105 | Ga0157369_10290820 | Ga0157369_102908202 | 325 |
| 444 | 3300013105 | Ga0157369_10504471 | Ga0157369_105044711 | 325 |
| 445 | 3300013296 | Ga0157374_10086272 | Ga0157374_100862723 | 325 |
| 446 | 3300013297 | Ga0157378_10437162 | Ga0157378_104371621 | 325 |
| 447 | 3300013306 | Ga0163162_10064438 | Ga0163162_100644383 | 325 |
| 448 | 3300013306 | Ga0163162_10122274 | Ga0163162_101222741 | 325 |
| 449 | 3300013306 | Ga0163162_10511373 | Ga0163162_105113732 | 325 |
| 450 | 3300013307 | Ga0157372_10003571 | Ga0157372_100035716 | 325 |
| 451 | 3300013307 | Ga0157372_10244011 | Ga0157372_102440113 | 325 |
| 452 | 3300013308 | Ga0157375_10026969 | Ga0157375_100269693 | 325 |
| 453 | 3300013308 | Ga0157375_10100575 | Ga0157375_101005752 | 325 |
| 454 | 3300014325 | Ga0163163_10003435 | Ga0163163_1000343513 | 325 |
| 455 | 3300014968 | Ga0157379_10006683 | Ga0157379_100066833 | 325 |
| 456 | 3300025245 | Ga0207425_1000022 | Ga0207425_1000022189 | 325 |
| 457 | 3300025258 | Ga0209129_1000286 | Ga0209129_100028614 | 325 |
| 458 | 3300025292 | Ga0209676_1009141 | Ga0209676_10091412 | 325 |
| 459 | 3300025294 | Ga0209025_1001464 | Ga0209025_10014646 | 325 |
| 460 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004816 | 325 |
| 461 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012820 | 325 |
| 462 | 3300025303 | Ga0209051_1000246 | Ga0209051_100024620 | 325 |
| 463 | 3300025304 | Ga0209257_1011642 | Ga0209257_10116423 | 325 |
| 464 | 3300025315 | Ga0207697_10000297 | Ga0207697_100002978 | 325 |
| 465 | 3300025321 | Ga0207656_10008833 | Ga0207656_100088332 | 325 |
| 466 | 3300025321 | Ga0207656_10013262 | Ga0207656_100132623 | 325 |
| 467 | 3300025321 | Ga0207656_10026133 | Ga0207656_100261333 | 325 |
| 468 | 3300025901 | Ga0207688_10000214 | Ga0207688_1000021425 | 325 |
| 469 | 3300025904 | Ga0207647_10000450 | Ga0207647_1000045014 | 325 |
| 470 | 3300025904 | Ga0207647_10000550 | Ga0207647_100005508 | 325 |
| 471 | 3300025904 | Ga0207647_10001333 | Ga0207647_100013336 | 325 |
| 472 | 3300025904 | Ga0207647_10051388 | Ga0207647_100513884 | 325 |
| 473 | 3300025907 | Ga0207645_10047073 | Ga0207645_100470732 | 325 |
| 474 | 3300025909 | Ga0207705_10000733 | Ga0207705_1000073315 | 325 |
| 475 | 3300025909 | Ga0207705_10012679 | Ga0207705_100126795 | 325 |
| 476 | 3300025909 | Ga0207705_10021334 | Ga0207705_100213346 | 325 |
| 477 | 3300025909 | Ga0207705_10036186 | Ga0207705_100361864 | 325 |
| 478 | 3300025909 | Ga0207705_10038781 | Ga0207705_100387813 | 325 |
| 479 | 3300025909 | Ga0207705_10043296 | Ga0207705_100432962 | 325 |
| 480 | 3300025911 | Ga0207654_10129313 | Ga0207654_101293132 | 325 |
| 481 | 3300025912 | Ga0207707_10031408 | Ga0207707_100314082 | 325 |
| 482 | 3300025913 | Ga0207695_10048907 | Ga0207695_100489073 | 325 |
| 483 | 3300025913 | Ga0207695_10105071 | Ga0207695_101050712 | 325 |
| 484 | 3300025917 | Ga0207660_10000753 | Ga0207660_100007533 | 325 |
| 485 | 3300025917 | Ga0207660_10002951 | Ga0207660_100029514 | 325 |
| 486 | 3300025917 | Ga0207660_10026504 | Ga0207660_100265042 | 325 |
| 487 | 3300025917 | Ga0207660_10400218 | Ga0207660_104002181 | 325 |
| 488 | 3300025919 | Ga0207657_10002019 | Ga0207657_100020194 | 325 |
| 489 | 3300025919 | Ga0207657_10003530 | Ga0207657_100035306 | 325 |
| 490 | 3300025919 | Ga0207657_10009031 | Ga0207657_100090319 | 325 |
| 491 | 3300025919 | Ga0207657_10010446 | Ga0207657_1001044610 | 325 |
| 492 | 3300025919 | Ga0207657_10011217 | Ga0207657_100112173 | 325 |
| 493 | 3300025919 | Ga0207657_10016702 | Ga0207657_100167022 | 325 |
| 494 | 3300025919 | Ga0207657_10028287 | Ga0207657_100282872 | 325 |
| 495 | 3300025919 | Ga0207657_10296054 | Ga0207657_102960542 | 325 |
| 496 | 3300025919 | Ga0207657_10317974 | Ga0207657_103179742 | 325 |
| 497 | 3300025920 | Ga0207649_10010422 | Ga0207649_100104221 | 325 |
| 498 | 3300025920 | Ga0207649_10021475 | Ga0207649_100214753 | 325 |
| 499 | 3300025920 | Ga0207649_10028353 | Ga0207649_100283533 | 325 |
| 500 | 3300025920 | Ga0207649_10056575 | Ga0207649_100565752 | 325 |
| 501 | 3300025921 | Ga0207652_10115640 | Ga0207652_101156402 | 325 |
| 502 | 3300025921 | Ga0207652_10287960 | Ga0207652_102879602 | 325 |
| 503 | 3300025923 | Ga0207681_10002797 | Ga0207681_100027978 | 325 |
| 504 | 3300025923 | Ga0207681_10045621 | Ga0207681_100456212 | 325 |
| 505 | 3300025924 | Ga0207694_10009321 | Ga0207694_100093213 | 325 |
| 506 | 3300025924 | Ga0207694_10102113 | Ga0207694_101021132 | 325 |
| 507 | 3300025926 | Ga0207659_10011048 | Ga0207659_100110482 | 325 |
| 508 | 3300025926 | Ga0207659_10277564 | Ga0207659_102775641 | 325 |
| 509 | 3300025927 | Ga0207687_10004719 | Ga0207687_100047193 | 325 |
| 510 | 3300025931 | Ga0207644_10021354 | Ga0207644_100213542 | 325 |
| 511 | 3300025931 | Ga0207644_10021704 | Ga0207644_100217043 | 325 |
| 512 | 3300025931 | Ga0207644_10028811 | Ga0207644_100288112 | 325 |
| 513 | 3300025931 | Ga0207644_10067500 | Ga0207644_100675002 | 325 |
| 514 | 3300025931 | Ga0207644_10178978 | Ga0207644_101789782 | 325 |
| 515 | 3300025932 | Ga0207690_10004314 | Ga0207690_100043145 | 325 |
| 516 | 3300025932 | Ga0207690_10031546 | Ga0207690_100315462 | 325 |
| 517 | 3300025932 | Ga0207690_10061653 | Ga0207690_100616531 | 325 |
| 518 | 3300025932 | Ga0207690_10069839 | Ga0207690_100698392 | 325 |
| 519 | 3300025932 | Ga0207690_10174621 | Ga0207690_101746212 | 325 |
| 520 | 3300025932 | Ga0207690_10247107 | Ga0207690_102471072 | 325 |
| 521 | 3300025933 | Ga0207706_10001953 | Ga0207706_1000195310 | 325 |
| 522 | 3300025933 | Ga0207706_10002890 | Ga0207706_100028908 | 325 |
| 523 | 3300025933 | Ga0207706_10019463 | Ga0207706_100194637 | 325 |
| 524 | 3300025933 | Ga0207706_10109711 | Ga0207706_101097113 | 325 |
| 525 | 3300025935 | Ga0207709_10069381 | Ga0207709_100693813 | 325 |
| 526 | 3300025935 | Ga0207709_10101297 | Ga0207709_101012971 | 325 |
| 527 | 3300025937 | Ga0207669_10052976 | Ga0207669_100529761 | 325 |
| 528 | 3300025938 | Ga0207704_10043071 | Ga0207704_100430712 | 325 |
| 529 | 3300025940 | Ga0207691_10000047 | Ga0207691_100000478 | 325 |
| 530 | 3300025940 | Ga0207691_10073755 | Ga0207691_100737553 | 325 |
| 531 | 3300025940 | Ga0207691_10228695 | Ga0207691_102286952 | 325 |
| 532 | 3300025941 | Ga0207711_10001028 | Ga0207711_100010282 | 325 |
| 533 | 3300025941 | Ga0207711_10003195 | Ga0207711_100031956 | 325 |
| 534 | 3300025941 | Ga0207711_10003281 | Ga0207711_1000328114 | 325 |
| 535 | 3300025942 | Ga0207689_10000002 | Ga0207689_100000028 | 325 |
| 536 | 3300025942 | Ga0207689_10014038 | Ga0207689_100140387 | 325 |
| 537 | 3300025944 | Ga0207661_10322527 | Ga0207661_103225272 | 325 |
| 538 | 3300025945 | Ga0207679_10034440 | Ga0207679_100344403 | 325 |
| 539 | 3300025945 | Ga0207679_10058928 | Ga0207679_100589282 | 325 |
| 540 | 3300025949 | Ga0207667_10004932 | Ga0207667_100049323 | 325 |
| 541 | 3300025949 | Ga0207667_10015484 | Ga0207667_100154842 | 325 |
| 542 | 3300025949 | Ga0207667_10017570 | Ga0207667_100175704 | 325 |
| 543 | 3300025949 | Ga0207667_10051008 | Ga0207667_100510082 | 325 |
| 544 | 3300025960 | Ga0207651_10010367 | Ga0207651_100103674 | 325 |
| 545 | 3300025960 | Ga0207651_10027820 | Ga0207651_100278202 | 325 |
| 546 | 3300025960 | Ga0207651_10254231 | Ga0207651_102542311 | 325 |
| 547 | 3300025961 | Ga0207712_10000969 | Ga0207712_100009695 | 325 |
| 548 | 3300025961 | Ga0207712_10095457 | Ga0207712_100954572 | 325 |
| 549 | 3300025972 | Ga0207668_10113779 | Ga0207668_101137792 | 325 |
| 550 | 3300025981 | Ga0207640_10010650 | Ga0207640_100106504 | 325 |
| 551 | 3300025981 | Ga0207640_10024071 | Ga0207640_100240713 | 325 |
| 552 | 3300025981 | Ga0207640_10283999 | Ga0207640_102839991 | 325 |
| 553 | 3300025986 | Ga0207658_10003561 | Ga0207658_100035619 | 325 |
| 554 | 3300025986 | Ga0207658_10023648 | Ga0207658_100236482 | 325 |
| 555 | 3300025986 | Ga0207658_10230416 | Ga0207658_102304162 | 325 |
| 556 | 3300026023 | Ga0207677_10361972 | Ga0207677_103619722 | 325 |
| 557 | 3300026035 | Ga0207703_10002189 | Ga0207703_100021896 | 325 |
| 558 | 3300026035 | Ga0207703_10030569 | Ga0207703_100305693 | 325 |
| 559 | 3300026035 | Ga0207703_10065739 | Ga0207703_100657392 | 325 |
| 560 | 3300026035 | Ga0207703_10204788 | Ga0207703_102047882 | 325 |
| 561 | 3300026041 | Ga0207639_10002813 | Ga0207639_100028134 | 325 |
| 562 | 3300026041 | Ga0207639_10013429 | Ga0207639_100134292 | 325 |
| 563 | 3300026041 | Ga0207639_10014834 | Ga0207639_100148343 | 325 |
| 564 | 3300026041 | Ga0207639_10028477 | Ga0207639_100284772 | 325 |
| 565 | 3300026041 | Ga0207639_10030303 | Ga0207639_100303032 | 325 |
| 566 | 3300026041 | Ga0207639_10088370 | Ga0207639_100883703 | 325 |
| 567 | 3300026041 | Ga0207639_10111414 | Ga0207639_101114142 | 325 |
| 568 | 3300026067 | Ga0207678_10001895 | Ga0207678_1000189521 | 325 |
| 569 | 3300026067 | Ga0207678_10003129 | Ga0207678_1000312912 | 325 |
| 570 | 3300026067 | Ga0207678_10047684 | Ga0207678_100476842 | 325 |
| 571 | 3300026067 | Ga0207678_10061702 | Ga0207678_100617022 | 325 |
| 572 | 3300026067 | Ga0207678_10062991 | Ga0207678_100629912 | 325 |
| 573 | 3300026067 | Ga0207678_10172896 | Ga0207678_101728961 | 325 |
| 574 | 3300026078 | Ga0207702_10031490 | Ga0207702_100314902 | 325 |
| 575 | 3300026078 | Ga0207702_10045727 | Ga0207702_100457272 | 325 |
| 576 | 3300026078 | Ga0207702_10196823 | Ga0207702_101968232 | 325 |
| 577 | 3300026078 | Ga0207702_10314046 | Ga0207702_103140462 | 325 |
| 578 | 3300026088 | Ga0207641_10000761 | Ga0207641_1000076136 | 325 |
| 579 | 3300026088 | Ga0207641_10002113 | Ga0207641_100021138 | 325 |
| 580 | 3300026089 | Ga0207648_10001403 | Ga0207648_1000140320 | 325 |
| 581 | 3300026089 | Ga0207648_10017420 | Ga0207648_100174202 | 325 |
| 582 | 3300026089 | Ga0207648_10048809 | Ga0207648_100488092 | 325 |
| 583 | 3300026095 | Ga0207676_10000731 | Ga0207676_1000073114 | 325 |
| 584 | 3300026095 | Ga0207676_10012400 | Ga0207676_100124005 | 325 |
| 585 | 3300026095 | Ga0207676_10565241 | Ga0207676_105652411 | 325 |
| 586 | 3300026116 | Ga0207674_10000850 | Ga0207674_100008508 | 325 |
| 587 | 3300026116 | Ga0207674_10011911 | Ga0207674_100119115 | 325 |
| 588 | 3300026116 | Ga0207674_10012448 | Ga0207674_100124487 | 325 |
| 589 | 3300026116 | Ga0207674_10035053 | Ga0207674_100350532 | 325 |
| 590 | 3300026116 | Ga0207674_10036991 | Ga0207674_100369914 | 325 |
| 591 | 3300026116 | Ga0207674_10054898 | Ga0207674_100548983 | 325 |
| 592 | 3300026116 | Ga0207674_10422338 | Ga0207674_104223382 | 325 |
| 593 | 3300026142 | Ga0207698_10006372 | Ga0207698_100063724 | 325 |
| 594 | 3300026142 | Ga0207698_10009246 | Ga0207698_100092463 | 325 |
| 595 | 3300026142 | Ga0207698_10046586 | Ga0207698_100465865 | 325 |
| 596 | 3300026142 | Ga0207698_10069575 | Ga0207698_100695752 | 325 |
| 597 | 3300026142 | Ga0207698_10093468 | Ga0207698_100934682 | 325 |
| 598 | 3300026142 | Ga0207698_10147759 | Ga0207698_101477592 | 325 |
| 599 | 3300026142 | Ga0207698_10319786 | Ga0207698_103197862 | 325 |
| 600 | 3300027866 | Ga0209813_10005352 | Ga0209813_100053524 | 325 |
| 601 | 3300028379 | Ga0268266_10000256 | Ga0268266_1000025695 | 325 |
| 602 | 3300028379 | Ga0268266_10102025 | Ga0268266_101020252 | 325 |
| 603 | 3300028380 | Ga0268265_10007223 | Ga0268265_100072235 | 325 |
| 604 | 3300028380 | Ga0268265_10047457 | Ga0268265_100474574 | 325 |
| 605 | 3300028380 | Ga0268265_10232819 | Ga0268265_102328192 | 325 |
| 606 | 3300028380 | Ga0268265_10245348 | Ga0268265_102453482 | 325 |
| 607 | 3300028381 | Ga0268264_10000755 | Ga0268264_1000075522 | 325 |
| 608 | 3300028381 | Ga0268264_10032295 | Ga0268264_100322953 | 325 |
| 609 | 3300028577 | Ga0265318_10069592 | Ga0265318_100695922 | 325 |
| 610 | 3300028794 | Ga0307515_10000186 | Ga0307515_1000018674 | 325 |
| 611 | 3300028800 | Ga0265338_10006667 | Ga0265338_1000666715 | 325 |
| 612 | 3300031238 | Ga0265332_10042963 | Ga0265332_100429631 | 325 |
| 613 | 3300031240 | Ga0265320_10000088 | Ga0265320_1000008853 | 325 |
| 614 | 3300031241 | Ga0265325_10019084 | Ga0265325_100190842 | 325 |
| 615 | 3300031344 | Ga0265316_10085401 | Ga0265316_100854012 | 325 |
| 616 | 3300031595 | Ga0265313_10034458 | Ga0265313_100344582 | 325 |
| 617 | 3300031711 | Ga0265314_10011566 | Ga0265314_100115662 | 325 |
| 618 | 3300031712 | Ga0265342_10013637 | Ga0265342_100136372 | 325 |
| 619 | 3300031824 | Ga0307413_10033399 | Ga0307413_100333994 | 325 |
| 620 | 3300031852 | Ga0307410_10103090 | Ga0307410_101030903 | 325 |
| 621 | 3300031852 | Ga0307410_10440576 | Ga0307410_104405761 | 325 |
| 622 | 3300031903 | Ga0307407_10088573 | Ga0307407_100885732 | 325 |
| 623 | 3300031911 | Ga0307412_10019158 | Ga0307412_100191582 | 325 |
| 624 | 3300031995 | Ga0307409_100018531 | Ga0307409_1000185315 | 325 |
| 625 | 3300031995 | Ga0307409_100074682 | Ga0307409_1000746822 | 325 |
| 626 | 3300032004 | Ga0307414_10009782 | Ga0307414_100097823 | 325 |
| 627 | 3300032004 | Ga0307414_10010095 | Ga0307414_100100954 | 325 |
| 628 | 3300032004 | Ga0307414_10044469 | Ga0307414_100444693 | 325 |
| 629 | 3300032004 | Ga0307414_10154988 | Ga0307414_101549882 | 325 |
| 630 | 3300032004 | Ga0307414_10465226 | Ga0307414_104652261 | 325 |
| 631 | 3300032005 | Ga0307411_10000948 | Ga0307411_100009484 | 325 |
| 632 | 3300032005 | Ga0307411_10020582 | Ga0307411_100205822 | 325 |
| 633 | 3300032005 | Ga0307411_10025486 | Ga0307411_100254863 | 325 |
| 634 | 3300032005 | Ga0307411_10027338 | Ga0307411_100273386 | 325 |
| 635 | 3300032126 | Ga0307415_100001833 | Ga0307415_1000018335 | 325 |
| 636 | 3300032126 | Ga0307415_100033428 | Ga0307415_1000334287 | 325 |
| 637 | 3300037418 | Ga0395900_0001617 | Ga0395900_0001617_6500_7486 | 325 |
| 638 | 3300037418 | Ga0395900_0023841 | Ga0395900_0023841_3061_4038 | 325 |
| 639 | 3300037418 | Ga0395900_0070364 | Ga0395900_0070364_2347_3324 | 325 |
| 640 | 3300037418 | Ga0395900_0073310 | Ga0395900_0073310_1988_2965 | 325 |
| 641 | 3300037418 | Ga0395900_0297051 | Ga0395900_0297051_573_1565 | 325 |
| 642 | 3300037466 | Ga0395898_0001594 | Ga0395898_0001594_24350_25327 | 325 |
| 643 | 3300037466 | Ga0395898_0038614 | Ga0395898_0038614_2032_3009 | 325 |
| 644 | 3300037466 | Ga0395898_0121876 | Ga0395898_0121876_15_1007 | 325 |
| 645 | 3300037471 | Ga0395905_0004005 | Ga0395905_0004005_7825_8811 | 325 |
| 646 | 3300037471 | Ga0395905_0014247 | Ga0395905_0014247_5394_6371 | 325 |
| 647 | 3300037471 | Ga0395905_0016641 | Ga0395905_0016641_175_1152 | 325 |
| 648 | 3300037471 | Ga0395905_0024162 | Ga0395905_0024162_2167_3147 | 325 |
| 649 | 3300037471 | Ga0395905_0066005 | Ga0395905_0066005_178_1155 | 325 |
| 650 | 3300037471 | Ga0395905_0213911 | Ga0395905_0213911_573_1565 | 325 |
| 651 | 3300037471 | Ga0395905_0380168 | Ga0395905_0380168_213_1190 | 325 |
| 652 | 3300037471 | Ga0395905_0397782 | Ga0395905_0397782_197_1174 | 325 |
| 653 | 3300038443 | Ga0395901_0002443 | Ga0395901_0002443_9424_10410 | 325 |
| 654 | 3300038443 | Ga0395901_0012539 | Ga0395901_0012539_3867_4844 | 325 |
| 655 | 3300038443 | Ga0395901_0041312 | Ga0395901_0041312_2664_3641 | 325 |
| 656 | 3300038443 | Ga0395901_0061864 | Ga0395901_0061864_1785_2762 | 325 |
| 657 | 3300038443 | Ga0395901_0139342 | Ga0395901_0139342_1369_2361 | 325 |
| 658 | 3300038443 | Ga0395901_0287881 | Ga0395901_0287881_239_1216 | 325 |
| 659 | 3300039438 | Ga0436360_0764336 | Ga0436360_0764336_60_1058 | 325 |
| 660 | 3300039450 | Ga0436363_1352830 | Ga0436363_1352830_39_1025 | 325 |
| 661 | 3300042005 | Ga0439448_0002573 | Ga0439448_0002573_3592_4569 | 325 |
| 662 | 3300042007 | Ga0439449_0000498 | Ga0439449_0000498_3912_4892 | 325 |
| 663 | 3300042010 | Ga0439452_011492 | Ga0439452_011492_365_1345 | 325 |
| 664 | 3300042012 | Ga0439455_0000252 | Ga0439455_0000252_5463_6440 | 325 |
| 665 | 3300042157 | Ga0439458_0000255 | Ga0439458_0000255_3316_4293 | 325 |
| 666 | 3300042157 | Ga0439458_0006263 | Ga0439458_0006263_1074_2051 | 325 |
| 667 | 3300042439 | Ga0439464_0000114 | Ga0439464_0000114_4413_5390 | 325 |
| 668 | 3300042461 | Ga0439460_0046173 | Ga0439460_0046173_240_1217 | 325 |
| 669 | 3300044694 | Ga0466963_0035095 | Ga0466963_0035095_1216_2205 | 325 |
| 670 | 3300044842 | Ga0466957_0312078 | Ga0466957_0312078_61_1038 | 325 |
| 671 | 3300045976 | Ga0466967_0072406 | Ga0466967_0072406_1421_2398 | 325 |
| 672 | 3300046453 | Ga0495627_000650 | Ga0495627_000650_12453_13430 | 325 |
| 673 | 3300046460 | Ga0495638_0004955 | Ga0495638_0004955_7707_8684 | 325 |
| 674 | 3300046512 | Ga0495610_0006803 | Ga0495610_0006803_231_1208 | 325 |
| 675 | 3300046520 | Ga0495637_0026938 | Ga0495637_0026938_760_1737 | 325 |
| 676 | 3300046674 | Ga0495588_0035246 | Ga0495588_0035246_41_1024 | 325 |
| 677 | 3300046684 | Ga0495669_0000556 | Ga0495669_0000556_5997_6980 | 325 |
| 678 | 3300046691 | Ga0495670_0000014 | Ga0495670_0000014_115226_116203 | 325 |
| 679 | 3300046694 | Ga0495649_0012204 | Ga0495649_0012204_2536_3513 | 325 |
| 680 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_58760_59737 | 325 |
| 681 | 3300047472 | Ga0495686_0000147 | Ga0495686_0000147_67246_68223 | 325 |
| 682 | 3300047472 | Ga0495686_0000661 | Ga0495686_0000661_537_1514 | 325 |
| 683 | 3300047472 | Ga0495686_0121210 | Ga0495686_0121210_413_1390 | 325 |
| 684 | 3300047472 | Ga0495686_0185313 | Ga0495686_0185313_132_1109 | 325 |
| 685 | 3300048905 | Ga0496102_0265920 | Ga0496102_0265920_485_1555 | 325 |
| 686 | 3300048905 | Ga0496102_0275836 | Ga0496102_0275836_288_1265 | 325 |
| 687 | 3300048910 | Ga0496107_0032008 | Ga0496107_0032008_1939_2919 | 325 |
| 688 | 3300048910 | Ga0496107_0136217 | Ga0496107_0136217_297_1310 | 325 |
| 689 | 3300048913 | Ga0496110_0130977 | Ga0496110_0130977_966_1979 | 325 |
| 690 | 3300048914 | Ga0496111_0146163 | Ga0496111_0146163_508_1521 | 325 |
| 691 | 3300048915 | Ga0496112_0210036 | Ga0496112_0210036_718_1698 | 325 |
| 692 | 3300048917 | Ga0496114_0090799 | Ga0496114_0090799_184_1197 | 325 |
| 693 | 3300048921 | Ga0496118_0001617 | Ga0496118_0001617_122_1108 | 325 |
| 694 | 3300048923 | Ga0496120_0161911 | Ga0496120_0161911_49_1026 | 325 |
| 695 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_121655_122635 | 325 |
| 696 | 3300048924 | Ga0496121_0003131 | Ga0496121_0003131_12413_13399 | 325 |
| 697 | 3300048926 | Ga0496123_0002459 | Ga0496123_0002459_4835_5812 | 325 |
| 698 | 3300048927 | Ga0496124_0015727 | Ga0496124_0015727_2156_3133 | 325 |
| 699 | 3300048927 | Ga0496124_0142495 | Ga0496124_0142495_653_1639 | 325 |
| 700 | 3300049570 | Ga0501033_0014079 | Ga0501033_0014079_169_1146 | 325 |
| 701 | 3300049572 | Ga0501036_0282734 | Ga0501036_0282734_251_1228 | 325 |
| 702 | 3300049579 | Ga0501043_0020865 | Ga0501043_0020865_3006_3992 | 325 |
| 703 | 3300049581 | Ga0501047_0001117 | Ga0501047_0001117_12781_13767 | 325 |
| 704 | 3300049581 | Ga0501047_0013021 | Ga0501047_0013021_5348_6325 | 325 |
| 705 | 3300049585 | Ga0501069_0036991 | Ga0501069_0036991_150_1127 | 325 |
| 706 | 3300049823 | Ga0501044_0014571 | Ga0501044_0014571_1362_2339 | 325 |
| 707 | 3300050493 | nmdc:mga0k408_161782_c1 | nmdc:mga0k408_161782_c1_157_1134 | 325 |
| 708 | 3300050493 | nmdc:mga0k408_25112_c1 | nmdc:mga0k408_25112_c1_1736_2722 | 325 |
| 709 | 3300050496 | nmdc:mga07m45_2_c1 | nmdc:mga07m45_2_c1_118438_119424 | 325 |
| 710 | 3300053096 | Ga0500641_0021781 | Ga0500641_0021781_729_1715 | 325 |
| 711 | 3300053120 | Ga0500597_024094 | Ga0500597_024094_1280_2272 | 325 |
| 712 | 3300053125 | Ga0500618_000514 | Ga0500618_000514_8309_9289 | 325 |
| 713 | 3300053153 | Ga0500616_0008861 | Ga0500616_0008861_4175_5161 | 325 |
| 714 | 3300053156 | Ga0500622_0034813 | Ga0500622_0034813_1628_2611 | 325 |
| 715 | 3300053157 | Ga0500624_000020 | Ga0500624_000020_38489_39481 | 325 |
| 716 | 3300053178 | Ga0500637_0000022 | Ga0500637_0000022_38464_39456 | 325 |
| 717 | iso_pu_bacteria | 2919675420 | 2919678829 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pvi-assembly1.cif.gz_A | crystal structure of phqk in complex with paraherquamide l | 0.9498 | 1 | 32 |
| 5y7a-assembly1.cif.gz_A | crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn | 0.9496 | 2 | 31 |
| 6foy-assembly2.cif.gz_B | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 9 | 0.9484 | 1 | 31 |
| 6foz-assembly1.cif.gz_A | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 | 0.9482 | 2 | 31 |
| 6ici-assembly1.cif.gz_A | crystal structure of human mical3 | 0.9391 | 2 | 31 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 1 | 178 | 3.40.50.720 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9411 | 1 | 137 | 3.40.50.720 |
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9384 | 1 | 178 | 3.40.50.720 |
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9371 | 2 | 31 | 3.50.50.60 |
| 3rp8A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9309 | 2 | 30 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2WQY9-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9956 | 1 | 115 |
GO:0004616
GO:0050661 |
| AF-A0A0L0LZ89-F1-model_v4 | deleted | 0.9934 | 1 | 115 |
|
| AF-A0A6I5CPF4-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9917 | 47 | 154 |
GO:0004616
GO:0050661 |
| AF-A0A7W0X915-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.991 | 1 | 134 |
GO:0004616
GO:0050661 |
| AF-A0A525I822-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9903 | 1 | 88 |
GO:0004616
GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar