F477121

General Info

Members Datasets Scaffolds Average Seq Length
717 310 702 324

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0265920|Ga0496102_0265920_485_1555
Length 356
Sequence MSATSRGSFCDSRNDLTETQASPEKYSKGNYMRLAMIGLGRMGGNIARRLMLGNHEIVAFDRDDGAVAELISEGATGADTLEDVVAKLNTPRIFWVMLPAGGPTQETVDRLIELAAPGDIIIDGGNSFYKDDITRAAAAREKQIHYVDVGTSGGVWGLDRGYCMMIGGDKETVDLLDPIFDTLAPGYGTIPRTPGRGTTDDRAERGYIHAGPNGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKASEKLPAEERYDINLPDVAEVWRRGSVISSWLLDLCAIGLARDSMLEQFTGRVADSGEGRWTIDAAMEEAVPAHVLTAALFARYRSRVDTTFGDKLLSAMRFGFGGHVEMPQ

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221583 Caulobacter sp. Root655 Isolate Unclassified
4 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
5 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
6 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
7 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2919513703 Luteimonas sp. 3794 Isolate Unclassified
10 2919675420 Luteimonas terrae 4099 Isolate Unclassified
11 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
211 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
212 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.14
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 2.37
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005372 3300001979 Bacteria 5427
2 JGI24739J22299_10004790 3300001989 Bacteria 5167
3 JGI24739J22299_10009552 3300001989 Bacteria 3611
4 JGI24739J22299_10049772 3300001989 Bacteria 1357
5 JGI24737J22298_10000687 3300001990 Bacteria 11875
6 JGI24735J21928_10027297 3300002067 Bacteria 1711
7 JGI24738J21930_10002091 3300002075 Bacteria 5342
8 JGI24738J21930_10007677 3300002075 Bacteria 2478
9 JGI25150J39212_1000020 3300002774 Bacteria 134928
10 JGI25151J46595_10055943 3300003187 Bacteria 1297
11 JGI25153J46596_10000017 3300003215 Bacteria 274325
12 rootH2_10075661 3300003320 Bacteria 6877
13 Ga0055536_1011158 3300003781 Bacteria 3484
14 Ga0055530_10016424 3300003791 Bacteria 2365
15 Ga0055540_1005503 3300003792 Bacteria 5300
16 Ga0065165_1000625 3300005262 Bacteria 51321
17 Ga0065714_10109070 3300005288 Bacteria 1505
18 Ga0070658_10008641 3300005327 Bacteria 8186
19 Ga0070658_10038050 3300005327 Bacteria 3880
20 Ga0070658_10040306 3300005327 Bacteria 3767
21 Ga0070658_10222296 3300005327 Bacteria 1597
22 Ga0070658_10246114 3300005327 Bacteria 1516
23 Ga0070658_10318277 3300005327 Bacteria 1328
24 Ga0070676_10004172 3300005328 Bacteria 7587
25 Ga0070683_100025567 3300005329 Bacteria 5304
26 Ga0070683_100218535 3300005329 Bacteria 1811
27 Ga0070690_100091417 3300005330 Bacteria 2005
28 Ga0070670_100016900 3300005331 Bacteria 6263
29 Ga0070670_100025510 3300005331 Bacteria 5085
30 Ga0068869_100003116 3300005334 Bacteria 10111
31 Ga0070666_10062831 3300005335 Bacteria 2517
32 Ga0070680_100000777 3300005336 Bacteria 22371
33 Ga0070680_100001609 3300005336 Bacteria 16497
34 Ga0070680_100008701 3300005336 Bacteria 7780
35 Ga0070680_100255725 3300005336 Bacteria 1481
36 Ga0070680_100310653 3300005336 Bacteria 1337
37 Ga0070682_100035315 3300005337 Bacteria 3051
38 Ga0068868_100011184 3300005338 Bacteria 6534
39 Ga0070660_100003291 3300005339 Bacteria 11105
40 Ga0070660_100004065 3300005339 Bacteria 10092
41 Ga0070660_100017639 3300005339 Bacteria 5205
42 Ga0070660_100029155 3300005339 Bacteria 4133
43 Ga0070660_100047766 3300005339 Bacteria 3285
44 Ga0070660_100160963 3300005339 Bacteria 1809
45 Ga0070660_100186491 3300005339 Bacteria 1679
46 Ga0070660_100266557 3300005339 Bacteria 1399
47 Ga0070660_100310240 3300005339 Bacteria 1294
48 Ga0070660_100362680 3300005339 Bacteria 1194
49 Ga0070691_10008548 3300005341 Bacteria 4688
50 Ga0070691_10123756 3300005341 Bacteria 1304
51 Ga0070661_100001494 3300005344 Bacteria 16268
52 Ga0070661_100040130 3300005344 Bacteria 3413
53 Ga0070661_100061923 3300005344 Bacteria 2747
54 Ga0070661_100108664 3300005344 Bacteria 2070
55 Ga0070661_100169133 3300005344 Bacteria 1659
56 Ga0070661_100182187 3300005344 Bacteria 1598
57 Ga0070692_10041405 3300005345 Bacteria 2360
58 Ga0070668_100043360 3300005347 Bacteria 3450
59 Ga0070669_100000138 3300005353 Bacteria 65433
60 Ga0070669_100041151 3300005353 Bacteria 3360
61 Ga0070675_100021410 3300005354 Bacteria 5167
62 Ga0070671_100021780 3300005355 Bacteria 5235
63 Ga0070671_100027056 3300005355 Bacteria 4718
64 Ga0070671_100104838 3300005355 Bacteria 2373
65 Ga0070671_100232034 3300005355 Bacteria 1566
66 Ga0070674_100033254 3300005356 Bacteria 3431
67 Ga0070673_100002586 3300005364 Bacteria 11053
68 Ga0070673_100004948 3300005364 Bacteria 8490
69 Ga0070659_100001040 3300005366 Bacteria 20295
70 Ga0070659_100003697 3300005366 Bacteria 10913
71 Ga0070659_100007325 3300005366 Bacteria 8015
72 Ga0070659_100015988 3300005366 Bacteria 5628
73 Ga0070659_100027275 3300005366 Bacteria 4400
74 Ga0070659_100065256 3300005366 Bacteria 2883
75 Ga0070659_100075317 3300005366 Bacteria 2690
76 Ga0070659_100112163 3300005366 Bacteria 2202
77 Ga0070667_100047812 3300005367 Bacteria 3600
78 Ga0070667_100227132 3300005367 Bacteria 1663
79 Ga0070709_10202436 3300005434 Bacteria 1407
80 Ga0070694_100020574 3300005444 Bacteria 4209
81 Ga0070663_100048900 3300005455 Bacteria 3001
82 Ga0070663_100109285 3300005455 Bacteria 2076
83 Ga0070663_100276188 3300005455 Bacteria 1337
84 Ga0070663_100398467 3300005455 Bacteria 1124
85 Ga0070662_100001837 3300005457 Bacteria 13006
86 Ga0070662_100001928 3300005457 Bacteria 12750
87 Ga0070662_100080350 3300005457 Bacteria 2427
88 Ga0070681_10006985 3300005458 Bacteria 10988
89 Ga0070681_10093219 3300005458 Bacteria 2960
90 Ga0070681_10113562 3300005458 Bacteria 2648
91 Ga0070681_10315254 3300005458 Bacteria 1473
92 Ga0070681_10332708 3300005458 Bacteria 1428
93 Ga0068867_100010664 3300005459 Bacteria 6482
94 Ga0068867_100016740 3300005459 Bacteria 5209
95 Ga0070698_100063579 3300005471 Bacteria 3721
96 Ga0070679_100004635 3300005530 Bacteria 12688
97 Ga0070679_100075528 3300005530 Bacteria 3359
98 Ga0070679_100077512 3300005530 Bacteria 3313
99 Ga0070679_100320061 3300005530 Bacteria 1500
100 Ga0070679_100330242 3300005530 Bacteria 1473
101 Ga0070679_100419467 3300005530 Bacteria 1284
102 Ga0070679_100479188 3300005530 Bacteria 1188
103 Ga0070684_100027737 3300005535 Bacteria 4783
104 Ga0070684_100124210 3300005535 Bacteria 2324
105 Ga0070684_100345018 3300005535 Bacteria 1369
106 Ga0070697_100000139 3300005536 Bacteria 58838
107 Ga0070697_100018866 3300005536 Bacteria 5443
108 Ga0068853_100004994 3300005539 Bacteria 10339
109 Ga0068853_100027359 3300005539 Bacteria 4791
110 Ga0068853_100027704 3300005539 Bacteria 4762
111 Ga0068853_100033891 3300005539 Bacteria 4333
112 Ga0068853_100113339 3300005539 Bacteria 2411
113 Ga0068853_100116126 3300005539 Bacteria 2383
114 Ga0068853_100134100 3300005539 Bacteria 2219
115 Ga0070672_100000868 3300005543 Bacteria 18094
116 Ga0070693_100284404 3300005547 Bacteria 1109
117 Ga0070665_100000380 3300005548 Bacteria 65676
118 Ga0070665_100138367 3300005548 Bacteria 2438
119 Ga0068855_100001148 3300005563 Bacteria 32786
120 Ga0068855_100008821 3300005563 Bacteria 12188
121 Ga0068855_100010741 3300005563 Bacteria 11051
122 Ga0068855_100394571 3300005563 Bacteria 1517
123 Ga0068855_100395925 3300005563 Bacteria 1514
124 Ga0068855_100709803 3300005563 Bacteria 1075
125 Ga0070664_100002792 3300005564 Bacteria 14105
126 Ga0070664_100004946 3300005564 Bacteria 10677
127 Ga0070664_100006300 3300005564 Bacteria 9572
128 Ga0070664_100043512 3300005564 Bacteria 3789
129 Ga0070664_100057463 3300005564 Bacteria 3307
130 Ga0068857_100007132 3300005577 Bacteria 9625
131 Ga0068857_100021844 3300005577 Bacteria 5631
132 Ga0068857_100041994 3300005577 Bacteria 4055
133 Ga0068857_100107278 3300005577 Bacteria 2508
134 Ga0068857_100135940 3300005577 Bacteria 2219
135 Ga0068857_100189409 3300005577 Bacteria 1873
136 Ga0068857_100313261 3300005577 Bacteria 1448
137 Ga0068854_100005266 3300005578 Bacteria 8161
138 Ga0068854_100014636 3300005578 Bacteria 5176
139 Ga0068854_100072173 3300005578 Bacteria 2527
140 Ga0068854_100072875 3300005578 Bacteria 2516
141 Ga0068854_100240021 3300005578 Bacteria 1443
142 Ga0068856_100009932 3300005614 Bacteria 9245
143 Ga0068856_100047053 3300005614 Bacteria 4249
144 Ga0068856_100057631 3300005614 Bacteria 3835
145 Ga0068856_100347459 3300005614 Bacteria 1502
146 Ga0068856_100618558 3300005614 Bacteria 1104
147 Ga0068852_100000946 3300005616 Bacteria 19100
148 Ga0068852_100005893 3300005616 Bacteria 8811
149 Ga0068852_100018079 3300005616 Bacteria 5546
150 Ga0068852_100102314 3300005616 Bacteria 2588
151 Ga0068852_100112815 3300005616 Bacteria 2474
152 Ga0068852_100125607 3300005616 Bacteria 2355
153 Ga0068852_100225606 3300005616 Bacteria 1784
154 Ga0068852_100505068 3300005616 Bacteria 1204
155 Ga0068859_100000550 3300005617 Bacteria 37222
156 Ga0068859_100006426 3300005617 Bacteria 11926
157 Ga0068859_100073328 3300005617 Bacteria 3461
158 Ga0068859_100155178 3300005617 Bacteria 2366
159 Ga0068864_100003528 3300005618 Bacteria 12934
160 Ga0068864_100005190 3300005618 Bacteria 10669
161 Ga0068851_10012796 3300005834 Bacteria 3963
162 Ga0068851_10014173 3300005834 Bacteria 3782
163 Ga0068863_100004087 3300005841 Bacteria 14417
164 Ga0068863_100009309 3300005841 Bacteria 9584
165 Ga0068863_100048341 3300005841 Bacteria 4034
166 Ga0068863_100226573 3300005841 Bacteria 1802
167 Ga0068858_100002589 3300005842 Bacteria 18214
168 Ga0068858_100004956 3300005842 Bacteria 13043
169 Ga0068858_100023934 3300005842 Bacteria 5690
170 Ga0068858_100025161 3300005842 Bacteria 5539
171 Ga0068858_100235315 3300005842 Bacteria 1737
172 Ga0068860_100004406 3300005843 Bacteria 14383
173 Ga0068860_100006884 3300005843 Bacteria 11399
174 Ga0068860_100284558 3300005843 Bacteria 1616
175 Ga0068862_100006635 3300005844 Bacteria 9599
176 Ga0068862_100021749 3300005844 Bacteria 5364
177 Ga0081538_10018384 3300005981 Bacteria 5251
178 Ga0075368_10087558 3300006042 Bacteria 1272
179 Ga0070712_100185284 3300006175 Bacteria 1625
180 Ga0075366_10026901 3300006195 Bacteria 3372
181 Ga0075366_10067766 3300006195 Bacteria 2124
182 Ga0075366_10180035 3300006195 Bacteria 1284
183 Ga0075370_10000001 3300006353 Bacteria 239876
184 Ga0068871_100405905 3300006358 Bacteria 1214
185 Ga0075428_100131976 3300006844 Bacteria 2716
186 Ga0075431_100288808 3300006847 Bacteria 1660
187 Ga0075433_10010202 3300006852 Bacteria 7533
188 Ga0068865_100005976 3300006881 Bacteria 7418
189 Ga0097620_100000550 3300006931 Bacteria 37222
190 Ga0097620_100006426 3300006931 Bacteria 11926
191 Ga0097620_100073329 3300006931 Bacteria 3461
192 Ga0097620_100155181 3300006931 Bacteria 2366
193 Ga0105240_10010679 3300009093 Bacteria 12886
194 Ga0105240_10015147 3300009093 Bacteria 10494
195 Ga0105240_10018070 3300009093 Bacteria 9481
196 Ga0105240_10065883 3300009093 Bacteria 4495
197 Ga0105240_10085276 3300009093 Bacteria 3870
198 Ga0105240_10150136 3300009093 Bacteria 2776
199 Ga0105245_10000198 3300009098 Bacteria 57372
200 Ga0105245_10063705 3300009098 Bacteria 3330
201 Ga0105247_10018070 3300009101 Bacteria 4229
202 Ga0105243_10010602 3300009148 Bacteria 6996
203 Ga0105243_10298211 3300009148 Bacteria 1460
204 Ga0105241_10027469 3300009174 Bacteria 4239
205 Ga0105241_10284753 3300009174 Bacteria 1413
206 Ga0105248_10000391 3300009177 Bacteria 50565
207 Ga0105248_10031695 3300009177 Bacteria 5906
208 Ga0105237_10243467 3300009545 Bacteria 1800
209 Ga0105238_10007731 3300009551 Bacteria 10750
210 Ga0105238_10014401 3300009551 Bacteria 7994
211 Ga0105238_10052170 3300009551 Bacteria 4112
212 Ga0105239_10053714 3300010375 Bacteria 4419
213 Ga0105239_10477424 3300010375 Bacteria 1416
214 Ga0105239_10732565 3300010375 Bacteria 1131
215 Ga0105246_10073297 3300011119 Bacteria 2417
216 Ga0105246_10368332 3300011119 Bacteria 1183
217 Ga0157373_10010344 3300013100 Bacteria 6869
218 Ga0157373_10031653 3300013100 Bacteria 3807
219 Ga0157373_10076574 3300013100 Bacteria 2360
220 Ga0157373_10081004 3300013100 Bacteria 2289
221 Ga0157373_10142136 3300013100 Bacteria 1688
222 Ga0157371_10002789 3300013102 Bacteria 16391
223 Ga0157371_10002797 3300013102 Bacteria 16362
224 Ga0157371_10293365 3300013102 Bacteria 1176
225 Ga0157370_10006108 3300013104 Bacteria 13365
226 Ga0157370_10025395 3300013104 Bacteria 5864
227 Ga0157370_10032238 3300013104 Bacteria 5118
228 Ga0157370_10069403 3300013104 Bacteria 3329
229 Ga0157370_10097207 3300013104 Bacteria 2762
230 Ga0157370_10130551 3300013104 Bacteria 2343
231 Ga0157370_10204812 3300013104 Bacteria 1830
232 Ga0157370_10284948 3300013104 Bacteria 1526
233 Ga0157370_10295723 3300013104 Bacteria 1495
234 Ga0157370_10349859 3300013104 Bacteria 1362
235 Ga0157369_10002441 3300013105 Bacteria 22331
236 Ga0157369_10007310 3300013105 Bacteria 12712
237 Ga0157369_10085210 3300013105 Bacteria 3377
238 Ga0157369_10098789 3300013105 Bacteria 3112
239 Ga0157369_10102744 3300013105 Bacteria 3045
240 Ga0157369_10290820 3300013105 Bacteria 1701
241 Ga0157369_10504471 3300013105 Bacteria 1252
242 Ga0157374_10086272 3300013296 Bacteria 2986
243 Ga0157378_10001311 3300013297 Bacteria 22380
244 Ga0157378_10437162 3300013297 Bacteria 1296
245 Ga0163162_10064438 3300013306 Bacteria 3710
246 Ga0163162_10072048 3300013306 Bacteria 3509
247 Ga0163162_10122274 3300013306 Bacteria 2708
248 Ga0163162_10511373 3300013306 Bacteria 1331
249 Ga0157372_10003571 3300013307 Bacteria 16739
250 Ga0157372_10012201 3300013307 Bacteria 9153
251 Ga0157372_10244011 3300013307 Bacteria 2084
252 Ga0157375_10026969 3300013308 Bacteria 5363
253 Ga0157375_10100575 3300013308 Bacteria 2972
254 Ga0163163_10003435 3300014325 Bacteria 13462
255 Ga0157377_10022379 3300014745 Bacteria 3336
256 Ga0157379_10006683 3300014968 Bacteria 9959
257 Ga0206353_10434619 3300020082 Bacteria 3038
258 Ga0207425_1000022 3300025245 Bacteria 355305
259 Ga0209129_1000286 3300025258 Bacteria 48191
260 Ga0209233_1013690 3300025261 Bacteria 2311
261 Ga0209676_1009141 3300025292 Bacteria 4313
262 Ga0209025_1001464 3300025294 Bacteria 30863
263 Ga0209758_1000004 3300025297 Bacteria 1375322
264 Ga0209050_1000001 3300025298 Bacteria 3563507
265 Ga0209051_1000246 3300025303 Bacteria 91170
266 Ga0209257_1011642 3300025304 Bacteria 4200
267 Ga0207697_10000297 3300025315 Bacteria 27757
268 Ga0207656_10008833 3300025321 Bacteria 3728
269 Ga0207656_10013262 3300025321 Bacteria 3145
270 Ga0207656_10026133 3300025321 Bacteria 2377
271 Ga0207688_10000214 3300025901 Bacteria 25912
272 Ga0207647_10000450 3300025904 Bacteria 33415
273 Ga0207647_10000550 3300025904 Bacteria 29810
274 Ga0207647_10001333 3300025904 Bacteria 18966
275 Ga0207647_10051388 3300025904 Bacteria 2548
276 Ga0207699_10175992 3300025906 Bacteria 1435
277 Ga0207645_10047073 3300025907 Bacteria 2754
278 Ga0207705_10000647 3300025909 Bacteria 28998
279 Ga0207705_10000733 3300025909 Bacteria 27069
280 Ga0207705_10012679 3300025909 Bacteria 6083
281 Ga0207705_10016400 3300025909 Bacteria 5311
282 Ga0207705_10021334 3300025909 Bacteria 4621
283 Ga0207705_10036186 3300025909 Bacteria 3533
284 Ga0207705_10038781 3300025909 Bacteria 3413
285 Ga0207705_10043296 3300025909 Bacteria 3234
286 Ga0207705_10044634 3300025909 Bacteria 3185
287 Ga0207654_10129313 3300025911 Bacteria 1596
288 Ga0207707_10004869 3300025912 Bacteria 11785
289 Ga0207707_10012471 3300025912 Bacteria 7389
290 Ga0207707_10031408 3300025912 Bacteria 4648
291 Ga0207707_10271783 3300025912 Bacteria 1469
292 Ga0207695_10024131 3300025913 Bacteria 6851
293 Ga0207695_10048907 3300025913 Bacteria 4461
294 Ga0207695_10105071 3300025913 Bacteria 2812
295 Ga0207695_10292239 3300025913 Bacteria 1522
296 Ga0207695_10458431 3300025913 Bacteria 1158
297 Ga0207693_10067961 3300025915 Bacteria 2790
298 Ga0207660_10000720 3300025917 Bacteria 22059
299 Ga0207660_10000753 3300025917 Bacteria 21519
300 Ga0207660_10002930 3300025917 Bacteria 11151
301 Ga0207660_10002951 3300025917 Bacteria 11121
302 Ga0207660_10004462 3300025917 Bacteria 9124
303 Ga0207660_10026504 3300025917 Bacteria 3948
304 Ga0207660_10400218 3300025917 Bacteria 1106
305 Ga0207657_10002019 3300025919 Bacteria 21940
306 Ga0207657_10002443 3300025919 Bacteria 20074
307 Ga0207657_10003486 3300025919 Bacteria 16785
308 Ga0207657_10003530 3300025919 Bacteria 16704
309 Ga0207657_10009031 3300025919 Bacteria 10066
310 Ga0207657_10010446 3300025919 Bacteria 9265
311 Ga0207657_10011217 3300025919 Bacteria 8909
312 Ga0207657_10016702 3300025919 Bacteria 7071
313 Ga0207657_10028287 3300025919 Bacteria 5116
314 Ga0207657_10065052 3300025919 Bacteria 3110
315 Ga0207657_10296054 3300025919 Bacteria 1282
316 Ga0207657_10317974 3300025919 Bacteria 1231
317 Ga0207649_10008370 3300025920 Bacteria 5637
318 Ga0207649_10010422 3300025920 Bacteria 5107
319 Ga0207649_10021475 3300025920 Bacteria 3717
320 Ga0207649_10028353 3300025920 Bacteria 3296
321 Ga0207649_10056575 3300025920 Bacteria 2450
322 Ga0207652_10001317 3300025921 Bacteria 22056
323 Ga0207652_10002779 3300025921 Bacteria 14710
324 Ga0207652_10052952 3300025921 Bacteria 3486
325 Ga0207652_10115640 3300025921 Bacteria 2383
326 Ga0207652_10287960 3300025921 Bacteria 1482
327 Ga0207646_10162553 3300025922 Bacteria 2015
328 Ga0207681_10002797 3300025923 Bacteria 11046
329 Ga0207681_10045621 3300025923 Bacteria 2944
330 Ga0207694_10001010 3300025924 Bacteria 24549
331 Ga0207694_10009321 3300025924 Bacteria 7406
332 Ga0207694_10102113 3300025924 Bacteria 2273
333 Ga0207659_10011048 3300025926 Bacteria 5691
334 Ga0207659_10277564 3300025926 Bacteria 1369
335 Ga0207687_10004719 3300025927 Bacteria 9067
336 Ga0207644_10021354 3300025931 Bacteria 4409
337 Ga0207644_10021704 3300025931 Bacteria 4378
338 Ga0207644_10028811 3300025931 Bacteria 3848
339 Ga0207644_10067500 3300025931 Bacteria 2607
340 Ga0207644_10178978 3300025931 Bacteria 1661
341 Ga0207690_10004314 3300025932 Bacteria 8395
342 Ga0207690_10004900 3300025932 Bacteria 7896
343 Ga0207690_10031546 3300025932 Bacteria 3392
344 Ga0207690_10061653 3300025932 Bacteria 2550
345 Ga0207690_10069839 3300025932 Bacteria 2418
346 Ga0207690_10174621 3300025932 Bacteria 1612
347 Ga0207690_10247107 3300025932 Bacteria 1376
348 Ga0207706_10001953 3300025933 Bacteria 20227
349 Ga0207706_10002890 3300025933 Bacteria 16629
350 Ga0207706_10019463 3300025933 Bacteria 6107
351 Ga0207706_10109711 3300025933 Bacteria 2428
352 Ga0207709_10069381 3300025935 Bacteria 2231
353 Ga0207709_10101297 3300025935 Bacteria 1905
354 Ga0207669_10052976 3300025937 Bacteria 2441
355 Ga0207704_10043071 3300025938 Bacteria 2662
356 Ga0207691_10000047 3300025940 Bacteria 99519
357 Ga0207691_10073755 3300025940 Bacteria 3078
358 Ga0207691_10228695 3300025940 Bacteria 1611
359 Ga0207711_10001028 3300025941 Bacteria 26716
360 Ga0207711_10003195 3300025941 Bacteria 14296
361 Ga0207711_10003281 3300025941 Bacteria 14062
362 Ga0207689_10000002 3300025942 Bacteria 198437
363 Ga0207689_10014038 3300025942 Bacteria 6819
364 Ga0207661_10047494 3300025944 Bacteria 3409
365 Ga0207661_10322527 3300025944 Bacteria 1389
366 Ga0207679_10034440 3300025945 Bacteria 3573
367 Ga0207679_10058928 3300025945 Bacteria 2848
368 Ga0207667_10004932 3300025949 Bacteria 16295
369 Ga0207667_10007513 3300025949 Bacteria 13084
370 Ga0207667_10015484 3300025949 Bacteria 8660
371 Ga0207667_10017570 3300025949 Bacteria 8045
372 Ga0207667_10029561 3300025949 Bacteria 5941
373 Ga0207667_10051008 3300025949 Bacteria 4363
374 Ga0207667_10061822 3300025949 Bacteria 3917
375 Ga0207651_10010367 3300025960 Bacteria 5162
376 Ga0207651_10027820 3300025960 Bacteria 3557
377 Ga0207651_10254231 3300025960 Bacteria 1439
378 Ga0207712_10000969 3300025961 Bacteria 20659
379 Ga0207712_10095457 3300025961 Bacteria 2199
380 Ga0207668_10113779 3300025972 Bacteria 2035
381 Ga0207640_10010650 3300025981 Bacteria 5186
382 Ga0207640_10024071 3300025981 Bacteria 3668
383 Ga0207640_10283999 3300025981 Bacteria 1301
384 Ga0207658_10003561 3300025986 Bacteria 10994
385 Ga0207658_10023648 3300025986 Bacteria 4291
386 Ga0207658_10230416 3300025986 Bacteria 1563
387 Ga0207677_10361972 3300026023 Bacteria 1219
388 Ga0207703_10002189 3300026035 Bacteria 17150
389 Ga0207703_10030569 3300026035 Bacteria 4258
390 Ga0207703_10065739 3300026035 Bacteria 2981
391 Ga0207703_10204788 3300026035 Bacteria 1755
392 Ga0207639_10000181 3300026041 Bacteria 49444
393 Ga0207639_10002813 3300026041 Bacteria 11673
394 Ga0207639_10013429 3300026041 Bacteria 5733
395 Ga0207639_10014834 3300026041 Bacteria 5488
396 Ga0207639_10028477 3300026041 Bacteria 4079
397 Ga0207639_10030303 3300026041 Bacteria 3967
398 Ga0207639_10088370 3300026041 Bacteria 2473
399 Ga0207639_10111414 3300026041 Bacteria 2231
400 Ga0207678_10001895 3300026067 Bacteria 19090
401 Ga0207678_10003129 3300026067 Bacteria 14975
402 Ga0207678_10047684 3300026067 Bacteria 3704
403 Ga0207678_10061702 3300026067 Bacteria 3224
404 Ga0207678_10062991 3300026067 Bacteria 3187
405 Ga0207678_10172896 3300026067 Bacteria 1844
406 Ga0207702_10025964 3300026078 Bacteria 4863
407 Ga0207702_10031490 3300026078 Bacteria 4420
408 Ga0207702_10045727 3300026078 Bacteria 3683
409 Ga0207702_10196823 3300026078 Bacteria 1866
410 Ga0207702_10314046 3300026078 Bacteria 1491
411 Ga0207641_10000761 3300026088 Bacteria 34699
412 Ga0207641_10002113 3300026088 Bacteria 18795
413 Ga0207648_10001403 3300026089 Bacteria 26509
414 Ga0207648_10017420 3300026089 Bacteria 6538
415 Ga0207648_10048809 3300026089 Bacteria 3706
416 Ga0207676_10000731 3300026095 Bacteria 25737
417 Ga0207676_10012400 3300026095 Bacteria 6106
418 Ga0207676_10565241 3300026095 Bacteria 1088
419 Ga0207674_10000850 3300026116 Bacteria 39849
420 Ga0207674_10011911 3300026116 Bacteria 9750
421 Ga0207674_10012448 3300026116 Bacteria 9507
422 Ga0207674_10016271 3300026116 Bacteria 8146
423 Ga0207674_10035053 3300026116 Bacteria 5238
424 Ga0207674_10036991 3300026116 Bacteria 5080
425 Ga0207674_10054898 3300026116 Bacteria 4053
426 Ga0207674_10422338 3300026116 Bacteria 1288
427 Ga0207683_10115678 3300026121 Bacteria 2404
428 Ga0207698_10006372 3300026142 Bacteria 7355
429 Ga0207698_10009246 3300026142 Bacteria 6272
430 Ga0207698_10046586 3300026142 Bacteria 3276
431 Ga0207698_10050609 3300026142 Bacteria 3170
432 Ga0207698_10069575 3300026142 Bacteria 2784
433 Ga0207698_10093468 3300026142 Bacteria 2469
434 Ga0207698_10147759 3300026142 Bacteria 2035
435 Ga0207698_10319786 3300026142 Bacteria 1453
436 Ga0209813_10005352 3300027866 Bacteria 3109
437 Ga0268266_10000256 3300028379 Bacteria 89436
438 Ga0268266_10102025 3300028379 Bacteria 2530
439 Ga0268265_10007223 3300028380 Bacteria 7505
440 Ga0268265_10047457 3300028380 Bacteria 3218
441 Ga0268265_10232819 3300028380 Bacteria 1620
442 Ga0268265_10245348 3300028380 Bacteria 1583
443 Ga0268264_10000755 3300028381 Bacteria 36243
444 Ga0268264_10032295 3300028381 Bacteria 4295
445 Ga0265318_10069592 3300028577 Bacteria 1305
446 Ga0307515_10000186 3300028794 Bacteria 153531
447 Ga0307515_10030060 3300028794 Bacteria 9147
448 Ga0265338_10006667 3300028800 Bacteria 14602
449 Ga0265332_10042963 3300031238 Bacteria 1953
450 Ga0265320_10000088 3300031240 Bacteria 77379
451 Ga0265325_10019084 3300031241 Bacteria 3795
452 Ga0265340_10001665 3300031247 Bacteria 12773
453 Ga0265340_10003297 3300031247 Bacteria 9149
454 Ga0265339_10084722 3300031249 Bacteria 1670
455 Ga0265316_10006090 3300031344 Bacteria 11574
456 Ga0265316_10018815 3300031344 Bacteria 5929
457 Ga0265316_10085401 3300031344 Bacteria 2415
458 Ga0265313_10034458 3300031595 Bacteria 2560
459 Ga0316575_10008358 3300031665 Bacteria 3768
460 Ga0316575_10032612 3300031665 Bacteria 2041
461 Ga0265314_10008687 3300031711 Bacteria 8689
462 Ga0265314_10011566 3300031711 Bacteria 7272
463 Ga0265342_10009933 3300031712 Bacteria 6653
464 Ga0265342_10013637 3300031712 Bacteria 5439
465 Ga0316576_10228756 3300031727 Bacteria 1398
466 Ga0316577_10094086 3300031733 Bacteria 1678
467 Ga0307413_10033399 3300031824 Bacteria 2929
468 Ga0307410_10103090 3300031852 Bacteria 2048
469 Ga0307410_10440576 3300031852 Bacteria 1061
470 Ga0307407_10088573 3300031903 Bacteria 1891
471 Ga0307412_10019158 3300031911 Bacteria 4136
472 Ga0307409_100018531 3300031995 Bacteria 4684
473 Ga0307409_100074682 3300031995 Bacteria 2710
474 Ga0307414_10009782 3300032004 Bacteria 5526
475 Ga0307414_10010095 3300032004 Bacteria 5459
476 Ga0307414_10044469 3300032004 Bacteria 3033
477 Ga0307414_10154988 3300032004 Bacteria 1812
478 Ga0307414_10465226 3300032004 Bacteria 1112
479 Ga0307411_10000948 3300032005 Bacteria 11083
480 Ga0307411_10020582 3300032005 Bacteria 3841
481 Ga0307411_10025486 3300032005 Bacteria 3544
482 Ga0307411_10027338 3300032005 Bacteria 3450
483 Ga0307415_100001833 3300032126 Bacteria 10420
484 Ga0307415_100033428 3300032126 Bacteria 3338
485 Ga0373946_0001529 3300035171 Bacteria 8044
486 Ga0373924_0129707 3300035410 Bacteria 1097
487 Ga0373931_0177169 3300035691 Bacteria 1260
488 Ga0373935_0016342 3300035692 Bacteria 4490
489 Ga0373927_0006248 3300035695 Bacteria 8131
490 Ga0373937_0060514 3300036401 Bacteria 3480
491 Ga0395899_0000154 3300037312 Bacteria 104239
492 Ga0395899_0105544 3300037312 Bacteria 2029
493 Ga0395899_0275004 3300037312 Bacteria 1147
494 Ga0395900_0000293 3300037418 Bacteria 75318
495 Ga0395900_0000837 3300037418 Bacteria 40521
496 Ga0395900_0001617 3300037418 Bacteria 26505
497 Ga0395900_0005458 3300037418 Bacteria 13315
498 Ga0395900_0014026 3300037418 Bacteria 8183
499 Ga0395900_0023841 3300037418 Bacteria 6261
500 Ga0395900_0039225 3300037418 Bacteria 4880
501 Ga0395900_0070364 3300037418 Bacteria 3597
502 Ga0395900_0073310 3300037418 Bacteria 3520
503 Ga0395900_0102369 3300037418 Bacteria 2942
504 Ga0395900_0194366 3300037418 Bacteria 2056
505 Ga0395900_0218670 3300037418 Bacteria 1921
506 Ga0395900_0297051 3300037418 Bacteria 1602
507 Ga0395900_0509950 3300037418 Bacteria 1152
508 Ga0395898_0000219 3300037466 Bacteria 146838
509 Ga0395898_0001594 3300037466 Bacteria 30951
510 Ga0395898_0022892 3300037466 Bacteria 6318
511 Ga0395898_0033483 3300037466 Bacteria 5127
512 Ga0395898_0038614 3300037466 Bacteria 4730
513 Ga0395898_0121876 3300037466 Bacteria 2498
514 Ga0395898_0127894 3300037466 Bacteria 2434
515 Ga0395898_0166718 3300037466 Bacteria 2106
516 Ga0395898_0243070 3300037466 Bacteria 1717
517 Ga0395905_0000094 3300037471 Bacteria 147776
518 Ga0395905_0001923 3300037471 Bacteria 23843
519 Ga0395905_0004005 3300037471 Bacteria 15480
520 Ga0395905_0014247 3300037471 Bacteria 7596
521 Ga0395905_0016641 3300037471 Bacteria 6990
522 Ga0395905_0016712 3300037471 Bacteria 6973
523 Ga0395905_0021348 3300037471 Bacteria 6124
524 Ga0395905_0024162 3300037471 Bacteria 5736
525 Ga0395905_0028215 3300037471 Bacteria 5291
526 Ga0395905_0066005 3300037471 Bacteria 3388
527 Ga0395905_0120879 3300037471 Bacteria 2462
528 Ga0395905_0160391 3300037471 Bacteria 2114
529 Ga0395905_0203178 3300037471 Bacteria 1857
530 Ga0395905_0213911 3300037471 Bacteria 1805
531 Ga0395905_0380168 3300037471 Bacteria 1306
532 Ga0395905_0397782 3300037471 Bacteria 1272
533 Ga0395905_0439035 3300037471 Bacteria 1202
534 Ga0395905_0466562 3300037471 Bacteria 1161
535 Ga0395901_0000228 3300038443 Bacteria 70677
536 Ga0395901_0002443 3300038443 Bacteria 18837
537 Ga0395901_0003671 3300038443 Bacteria 15477
538 Ga0395901_0008002 3300038443 Bacteria 10671
539 Ga0395901_0012539 3300038443 Bacteria 8601
540 Ga0395901_0041312 3300038443 Bacteria 4779
541 Ga0395901_0044513 3300038443 Bacteria 4603
542 Ga0395901_0061864 3300038443 Bacteria 3895
543 Ga0395901_0075485 3300038443 Bacteria 3516
544 Ga0395901_0076069 3300038443 Bacteria 3502
545 Ga0395901_0086429 3300038443 Bacteria 3279
546 Ga0395901_0139342 3300038443 Bacteria 2549
547 Ga0395901_0197458 3300038443 Bacteria 2109
548 Ga0395901_0234317 3300038443 Bacteria 1916
549 Ga0395901_0240762 3300038443 Bacteria 1887
550 Ga0395901_0287881 3300038443 Bacteria 1706
551 Ga0395901_0455821 3300038443 Bacteria 1307
552 Ga0395901_0529857 3300038443 Bacteria 1196
553 Ga0395901_0624640 3300038443 Bacteria 1084
554 Ga0395901_0752757 3300038443 Bacteria 967
555 Ga0436360_0764336 3300039438 Bacteria 1608
556 Ga0436363_1352830 3300039450 Bacteria 1624
557 Ga0451807_0903417 3300041486 Bacteria 1196
558 Ga0439448_0002573 3300042005 Bacteria 4944
559 Ga0439449_0000498 3300042007 Bacteria 14738
560 Ga0439452_011492 3300042010 Bacteria 2541
561 Ga0439455_0000252 3300042012 Bacteria 6482
562 Ga0439458_0000255 3300042157 Bacteria 12956
563 Ga0439458_0006263 3300042157 Bacteria 2653
564 Ga0450908_025005 3300042184 Bacteria 1043
565 Ga0439464_0000114 3300042439 Bacteria 12425
566 Ga0439460_0046173 3300042461 Bacteria 1294
567 Ga0466963_0035095 3300044694 Bacteria 3266
568 Ga0466963_0083554 3300044694 Bacteria 2165
569 Ga0466957_0312078 3300044842 Bacteria 1059
570 Ga0466960_0036053 3300044901 Bacteria 2315
571 Ga0466959_0027362 3300045049 Bacteria 4230
572 Ga0466958_0145877 3300045836 Bacteria 1491
573 Ga0466967_0061960 3300045976 Bacteria 3319
574 Ga0466967_0072406 3300045976 Bacteria 3089
575 Ga0466967_0082937 3300045976 Bacteria 2898
576 Ga0466967_0086492 3300045976 Bacteria 2840
577 Ga0495627_000224 3300046453 Bacteria 60727
578 Ga0495627_000650 3300046453 Bacteria 26905
579 Ga0495592_0055356 3300046454 Bacteria 2935
580 Ga0495638_0004955 3300046460 Bacteria 9998
581 Ga0495651_0046190 3300046462 Bacteria 3371
582 Ga0495653_0041584 3300046463 Bacteria 3587
583 Ga0495650_0001756 3300046471 Bacteria 19720
584 Ga0495582_0063922 3300046473 Bacteria 2032
585 Ga0495639_0048020 3300046475 Bacteria 1935
586 Ga0495664_0039770 3300046477 Bacteria 2779
587 Ga0495594_0075152 3300046499 Bacteria 1883
588 Ga0495596_0006414 3300046500 Bacteria 5412
589 Ga0495608_0089155 3300046511 Bacteria 1996
590 Ga0495610_0001358 3300046512 Bacteria 21731
591 Ga0495610_0006803 3300046512 Bacteria 7759
592 Ga0495618_0023989 3300046514 Bacteria 3776
593 Ga0495618_0105126 3300046514 Bacteria 1808
594 Ga0495628_0096379 3300046516 Bacteria 2285
595 Ga0495637_0026938 3300046520 Bacteria 2575
596 Ga0495643_0000007 3300046522 Bacteria 383435
597 Ga0495643_0062327 3300046522 Bacteria 1974
598 Ga0495648_0007929 3300046524 Bacteria 8425
599 Ga0495666_0007474 3300046526 Bacteria 5471
600 Ga0495652_0049977 3300046529 Bacteria 3577
601 Ga0495640_0051265 3300046533 Bacteria 2837
602 Ga0495633_0041501 3300046558 Bacteria 2188
603 Ga0495667_0038098 3300046559 Bacteria 3202
604 Ga0495668_0118643 3300046616 Bacteria 1447
605 Ga0495625_0000025 3300046660 Bacteria 267383
606 Ga0495625_0000665 3300046660 Bacteria 48983
607 Ga0495625_0001685 3300046660 Bacteria 25771
608 Ga0495635_0036810 3300046663 Bacteria 3389
609 Ga0495588_0035246 3300046674 Bacteria 2535
610 Ga0495657_0037685 3300046675 Bacteria 3330
611 Ga0495599_0000776 3300046678 Bacteria 17964
612 Ga0495646_0035166 3300046680 Bacteria 3108
613 Ga0495669_0000556 3300046684 Bacteria 16545
614 Ga0495669_0037764 3300046684 Bacteria 2138
615 Ga0495670_0000014 3300046691 Bacteria 138993
616 Ga0495649_0012204 3300046694 Bacteria 5009
617 Ga0495674_0056993 3300047319 Bacteria 3420
618 Ga0495680_0032197 3300047322 Bacteria 4260
619 Ga0495673_0000078 3300047469 Bacteria 203066
620 Ga0495681_0000011 3300047470 Bacteria 201843
621 Ga0495684_0099297 3300047471 Bacteria 2201
622 Ga0495686_0000147 3300047472 Bacteria 139008
623 Ga0495686_0000661 3300047472 Bacteria 46810
624 Ga0495686_0121210 3300047472 Bacteria 1558
625 Ga0495686_0185313 3300047472 Bacteria 1203
626 Ga0496101_0073859 3300048904 Bacteria 2506
627 Ga0496102_0265920 3300048905 Bacteria 1617
628 Ga0496102_0275836 3300048905 Bacteria 1585
629 Ga0496107_0032008 3300048910 Bacteria 3757
630 Ga0496107_0136217 3300048910 Bacteria 1814
631 Ga0496108_0033094 3300048911 Bacteria 4294
632 Ga0496108_0316070 3300048911 Bacteria 1361
633 Ga0496109_0180520 3300048912 Bacteria 1982
634 Ga0496110_0076090 3300048913 Bacteria 2984
635 Ga0496110_0130977 3300048913 Bacteria 2265
636 Ga0496111_0146163 3300048914 Bacteria 1753
637 Ga0496112_0027433 3300048915 Bacteria 5490
638 Ga0496112_0042055 3300048915 Bacteria 4472
639 Ga0496112_0182833 3300048915 Bacteria 2060
640 Ga0496112_0210036 3300048915 Bacteria 1904
641 Ga0496114_0090799 3300048917 Bacteria 2593
642 Ga0496117_0021492 3300048920 Bacteria 5217
643 Ga0496118_0001617 3300048921 Bacteria 33315
644 Ga0496120_0161911 3300048923 Bacteria 1115
645 Ga0496121_0000031 3300048924 Bacteria 384119
646 Ga0496121_0003131 3300048924 Bacteria 23873
647 Ga0496123_0002459 3300048926 Bacteria 22941
648 Ga0496124_0015727 3300048927 Bacteria 7234
649 Ga0496124_0142495 3300048927 Bacteria 1890
650 Ga0501031_0059130 3300049568 Bacteria 2498
651 Ga0501032_0053364 3300049569 Bacteria 2723
652 Ga0501033_0014079 3300049570 Bacteria 6082
653 Ga0501033_0054652 3300049570 Bacteria 2953
654 Ga0501033_0151270 3300049570 Bacteria 1674
655 Ga0501034_0005027 3300049571 Bacteria 14533
656 Ga0501034_0482573 3300049571 Bacteria 1155
657 Ga0501036_0282734 3300049572 Bacteria 1388
658 Ga0501038_0015781 3300049574 Bacteria 6864
659 Ga0501043_0020865 3300049579 Bacteria 5139
660 Ga0501043_0047606 3300049579 Bacteria 3371
661 Ga0501047_0001117 3300049581 Bacteria 26643
662 Ga0501047_0013021 3300049581 Bacteria 7877
663 Ga0501047_0040926 3300049581 Bacteria 4480
664 Ga0501067_0109079 3300049583 Bacteria 1539
665 Ga0501069_0036991 3300049585 Bacteria 2693
666 Ga0501070_0000020 3300049586 Bacteria 169025
667 Ga0501070_0061488 3300049586 Bacteria 3111
668 Ga0501080_0011676 3300049742 Bacteria 8046
669 Ga0501080_0075002 3300049742 Bacteria 3147
670 Ga0501083_0006223 3300049744 Bacteria 8467
671 Ga0501035_0006911 3300049822 Bacteria 10599
672 Ga0501035_0088838 3300049822 Bacteria 2722
673 Ga0501044_0014571 3300049823 Bacteria 8481
674 Ga0501044_0020893 3300049823 Bacteria 6989
675 Ga0501044_0078876 3300049823 Bacteria 3337
676 Ga0501044_0097527 3300049823 Bacteria 2960
677 Ga0501044_0202547 3300049823 Bacteria 1942
678 Ga0501044_0211422 3300049823 Bacteria 1894
679 nmdc:mga0k408_161782_c1 3300050493 Bacteria 1334
680 nmdc:mga0k408_25112_c1 3300050493 Bacteria 3372
681 nmdc:mga0k408_34852_c2 3300050493 Bacteria 2192
682 nmdc:mga04h51_59395_c1 3300050495 Bacteria 1307
683 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
684 nmdc:mga06r32_145461_c1 3300050510 Bacteria 2348
685 nmdc:mga08x19_143565_c1 3300050514 Bacteria 1613
686 nmdc:mga0a205_5975_c1 3300050515 Bacteria 10970
687 Ga0495601_0009915 3300053077 Bacteria 5644
688 Ga0495601_0011636 3300053077 Bacteria 5272
689 Ga0495595_0028222 3300053084 Bacteria 2506
690 Ga0495619_0164263 3300053085 Bacteria 1534
691 Ga0500641_0021781 3300053096 Bacteria 2448
692 Ga0500562_002575 3300053108 Bacteria 4520
693 Ga0500593_074444 3300053117 Bacteria 1468
694 Ga0500597_024094 3300053120 Bacteria 2439
695 Ga0500618_000514 3300053125 Bacteria 24477
696 Ga0500559_0004706 3300053136 Bacteria 6423
697 Ga0500559_0022361 3300053136 Bacteria 2681
698 Ga0500616_0008861 3300053153 Bacteria 6182
699 Ga0500622_0034813 3300053156 Bacteria 2637
700 Ga0500624_000020 3300053157 Bacteria 118392
701 Ga0500637_0000022 3300053178 Bacteria 61494
702 Ga0501084_0000171 3300054114 Bacteria 50689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0086492 Ga0466967_0086492_36_830 260
2 3300005577 Ga0068857_100135940 Ga0068857_1001359402 267
3 3300025944 Ga0207661_10047494 Ga0207661_100474941 275
4 3300009093 Ga0105240_10015147 Ga0105240_100151476 276
5 3300010375 Ga0105239_10732565 Ga0105239_107325651 276
6 3300013100 Ga0157373_10031653 Ga0157373_100316533 276
7 3300013307 Ga0157372_10012201 Ga0157372_100122017 276
8 3300005339 Ga0070660_100003291 Ga0070660_1000032917 286
9 3300005366 Ga0070659_100003697 Ga0070659_1000036979 286
10 3300025913 Ga0207695_10024131 Ga0207695_100241316 286
11 3300025919 Ga0207657_10003486 Ga0207657_100034869 286
12 3300025920 Ga0207649_10008370 Ga0207649_100083705 286
13 3300025924 Ga0207694_10001010 Ga0207694_1000101021 286
14 3300025932 Ga0207690_10004900 Ga0207690_100049004 286
15 3300026041 Ga0207639_10000181 Ga0207639_1000018111 286
16 3300026116 Ga0207674_10016271 Ga0207674_100162715 286
17 3300005327 Ga0070658_10038050 Ga0070658_100380505 287
18 3300025949 Ga0207667_10007513 Ga0207667_1000751312 287
19 3300038443 Ga0395901_0752757 Ga0395901_0752757_86_949 287
20 3300049571 Ga0501034_0482573 Ga0501034_0482573_15_893 292
21 3300025909 Ga0207705_10044634 Ga0207705_100446344 293
22 3300031247 Ga0265340_10003297 Ga0265340_100032975 297
23 3300031344 Ga0265316_10006090 Ga0265316_1000609010 297
24 3300035410 Ga0373924_0129707 Ga0373924_0129707_125_1084 299
25 3300005536 Ga0070697_100000139 Ga0070697_10000013952 301
26 3300005536 Ga0070697_100018866 Ga0070697_1000188663 301
27 3300050514 nmdc:mga08x19_143565_c1 nmdc:mga08x19_143565_c1_133_1044 301
28 3300013104 Ga0157370_10069403 Ga0157370_100694033 302
29 3300013105 Ga0157369_10102744 Ga0157369_101027443 303
30 3300037418 Ga0395900_0218670 Ga0395900_0218670_80_1027 303
31 3300038443 Ga0395901_0624640 Ga0395901_0624640_81_1028 303
32 3300046473 Ga0495582_0063922 Ga0495582_0063922_13_993 303
33 3300013104 Ga0157370_10204812 Ga0157370_102048123 304
34 3300013104 Ga0157370_10349859 Ga0157370_103498591 305
35 3300025909 Ga0207705_10016400 Ga0207705_100164004 306
36 3300025919 Ga0207657_10065052 Ga0207657_100650523 306
37 3300025921 Ga0207652_10052952 Ga0207652_100529523 306
38 3300037418 Ga0395900_0005458 Ga0395900_0005458_1638_2558 306
39 3300037418 Ga0395900_0102369 Ga0395900_0102369_994_1971 306
40 3300037466 Ga0395898_0127894 Ga0395898_0127894_1095_2015 306
41 3300037471 Ga0395905_0016712 Ga0395905_0016712_1721_2698 306
42 3300038443 Ga0395901_0086429 Ga0395901_0086429_449_1426 306
43 3300038443 Ga0395901_0234317 Ga0395901_0234317_66_986 306
44 3300041486 Ga0451807_0903417 Ga0451807_0903417_257_1186 306
45 3300044901 Ga0466960_0036053 Ga0466960_0036053_1150_2073 306
46 3300048904 Ga0496101_0073859 Ga0496101_0073859_1340_2260 306
47 3300049823 Ga0501044_0078876 Ga0501044_0078876_2358_3311 306
48 3300026078 Ga0207702_10025964 Ga0207702_100259644 312
49 3300046522 Ga0495643_0000007 Ga0495643_0000007_27574_28554 312
50 3300048913 Ga0496110_0076090 Ga0496110_0076090_345_1283 312
51 3300048915 Ga0496112_0182833 Ga0496112_0182833_135_1073 312
52 3300005434 Ga0070709_10202436 Ga0070709_102024361 313
53 3300005471 Ga0070698_100063579 Ga0070698_1000635792 313
54 3300025906 Ga0207699_10175992 Ga0207699_101759921 313
55 3300025922 Ga0207646_10162553 Ga0207646_101625532 313
56 3300036401 Ga0373937_0060514 Ga0373937_0060514_1654_2682 313
57 3300037466 Ga0395898_0022892 Ga0395898_0022892_3988_4965 313
58 3300037471 Ga0395905_0028215 Ga0395905_0028215_3978_4955 313
59 3300046454 Ga0495592_0055356 Ga0495592_0055356_1658_2686 313
60 3300046462 Ga0495651_0046190 Ga0495651_0046190_1652_2680 313
61 3300046463 Ga0495653_0041584 Ga0495653_0041584_884_1912 313
62 3300046477 Ga0495664_0039770 Ga0495664_0039770_1102_2130 313
63 3300046511 Ga0495608_0089155 Ga0495608_0089155_67_1095 313
64 3300046514 Ga0495618_0023989 Ga0495618_0023989_1101_2129 313
65 3300046516 Ga0495628_0096379 Ga0495628_0096379_67_1095 313
66 3300046529 Ga0495652_0049977 Ga0495652_0049977_1648_2676 313
67 3300046533 Ga0495640_0051265 Ga0495640_0051265_1103_2131 313
68 3300046559 Ga0495667_0038098 Ga0495667_0038098_892_1920 313
69 3300046663 Ga0495635_0036810 Ga0495635_0036810_1659_2687 313
70 3300046675 Ga0495657_0037685 Ga0495657_0037685_654_1682 313
71 3300046678 Ga0495599_0000776 Ga0495599_0000776_1423_2451 313
72 3300046680 Ga0495646_0035166 Ga0495646_0035166_1675_2703 313
73 3300047319 Ga0495674_0056993 Ga0495674_0056993_735_1763 313
74 3300047322 Ga0495680_0032197 Ga0495680_0032197_2561_3589 313
75 3300048911 Ga0496108_0316070 Ga0496108_0316070_250_1278 313
76 3300048912 Ga0496109_0180520 Ga0496109_0180520_219_1247 313
77 3300048915 Ga0496112_0042055 Ga0496112_0042055_378_1406 313
78 3300053077 Ga0495601_0009915 Ga0495601_0009915_3056_4084 313
79 3300037418 Ga0395900_0039225 Ga0395900_0039225_1396_2340 314
80 3300037471 Ga0395905_0001923 Ga0395905_0001923_16202_17146 314
81 3300038443 Ga0395901_0008002 Ga0395901_0008002_6974_7918 314
82 3300038443 Ga0395901_0240762 Ga0395901_0240762_86_1030 314
83 3300042184 Ga0450908_025005 Ga0450908_025005_19_966 314
84 3300046616 Ga0495668_0118643 Ga0495668_0118643_11_961 314
85 3300053085 Ga0495619_0164263 Ga0495619_0164263_30_1034 314
86 3300005458 Ga0070681_10093219 Ga0070681_100932194 315
87 3300005530 Ga0070679_100075528 Ga0070679_1000755283 315
88 3300009551 Ga0105238_10014401 Ga0105238_100144016 315
89 3300013105 Ga0157369_10002441 Ga0157369_1000244120 315
90 3300035691 Ga0373931_0177169 Ga0373931_0177169_285_1235 315
91 3300037312 Ga0395899_0000154 Ga0395899_0000154_77181_78128 315
92 3300037312 Ga0395899_0000154 Ga0395899_0000154_96981_97928 315
93 3300037312 Ga0395899_0105544 Ga0395899_0105544_68_1015 315
94 3300037312 Ga0395899_0275004 Ga0395899_0275004_120_1067 315
95 3300037418 Ga0395900_0000293 Ga0395900_0000293_66974_67921 315
96 3300037418 Ga0395900_0000837 Ga0395900_0000837_31506_32453 315
97 3300037418 Ga0395900_0014026 Ga0395900_0014026_5472_6419 315
98 3300037418 Ga0395900_0194366 Ga0395900_0194366_299_1246 315
99 3300037418 Ga0395900_0509950 Ga0395900_0509950_178_1125 315
100 3300037466 Ga0395898_0000219 Ga0395898_0000219_31506_32453 315
101 3300037466 Ga0395898_0000219 Ga0395898_0000219_51306_52253 315
102 3300037466 Ga0395898_0033483 Ga0395898_0033483_3915_4862 315
103 3300037466 Ga0395898_0166718 Ga0395898_0166718_248_1195 315
104 3300037471 Ga0395905_0000094 Ga0395905_0000094_32444_33391 315
105 3300037471 Ga0395905_0000094 Ga0395905_0000094_52244_53191 315
106 3300037471 Ga0395905_0021348 Ga0395905_0021348_2737_3684 315
107 3300037471 Ga0395905_0120879 Ga0395905_0120879_477_1424 315
108 3300037471 Ga0395905_0160391 Ga0395905_0160391_386_1333 315
109 3300037471 Ga0395905_0439035 Ga0395905_0439035_136_1083 315
110 3300037471 Ga0395905_0466562 Ga0395905_0466562_34_981 315
111 3300038443 Ga0395901_0000228 Ga0395901_0000228_66974_67921 315
112 3300038443 Ga0395901_0003671 Ga0395901_0003671_7590_8537 315
113 3300038443 Ga0395901_0044513 Ga0395901_0044513_1171_2118 315
114 3300038443 Ga0395901_0075485 Ga0395901_0075485_1946_2893 315
115 3300038443 Ga0395901_0076069 Ga0395901_0076069_60_1007 315
116 3300038443 Ga0395901_0197458 Ga0395901_0197458_911_1858 315
117 3300038443 Ga0395901_0529857 Ga0395901_0529857_131_1108 315
118 3300044694 Ga0466963_0083554 Ga0466963_0083554_22_969 315
119 3300045049 Ga0466959_0027362 Ga0466959_0027362_382_1329 315
120 3300045836 Ga0466958_0145877 Ga0466958_0145877_310_1257 315
121 3300045976 Ga0466967_0061960 Ga0466967_0061960_943_1890 315
122 3300046684 Ga0495669_0037764 Ga0495669_0037764_50_997 315
123 3300048920 Ga0496117_0021492 Ga0496117_0021492_4251_5207 315
124 3300026121 Ga0207683_10115678 Ga0207683_101156782 316
125 3300049571 Ga0501034_0005027 Ga0501034_0005027_6342_7322 318
126 3300053108 Ga0500562_002575 Ga0500562_002575_2654_3631 319
127 3300013104 Ga0157370_10025395 Ga0157370_100253956 320
128 3300049823 Ga0501044_0211422 Ga0501044_0211422_837_1832 320
129 iso_pu_bacteria 2510917021 2511130088 320
130 iso_pu_bacteria 2738541281 2738745027 320
131 iso_pu_bacteria 2738543032 2739354257 320
132 3300005344 Ga0070661_100061923 Ga0070661_1000619233 321
133 3300005459 Ga0068867_100016740 Ga0068867_1000167403 321
134 3300005616 Ga0068852_100102314 Ga0068852_1001023142 321
135 3300005842 Ga0068858_100235315 Ga0068858_1002353152 321
136 3300006042 Ga0075368_10087558 Ga0075368_100875582 321
137 3300009098 Ga0105245_10000198 Ga0105245_1000019864 321
138 3300009098 Ga0105245_10063705 Ga0105245_100637055 321
139 3300009148 Ga0105243_10010602 Ga0105243_100106025 321
140 3300009148 Ga0105243_10298211 Ga0105243_102982111 321
141 3300009177 Ga0105248_10000391 Ga0105248_100003916 321
142 3300009545 Ga0105237_10243467 Ga0105237_102434672 321
143 3300010375 Ga0105239_10477424 Ga0105239_104774242 321
144 3300011119 Ga0105246_10073297 Ga0105246_100732973 321
145 3300011119 Ga0105246_10368332 Ga0105246_103683321 321
146 3300013100 Ga0157373_10010344 Ga0157373_100103445 321
147 3300013102 Ga0157371_10002789 Ga0157371_100027897 321
148 3300013102 Ga0157371_10293365 Ga0157371_102933651 321
149 3300013297 Ga0157378_10001311 Ga0157378_100013118 321
150 3300013306 Ga0163162_10072048 Ga0163162_100720482 321
151 3300014745 Ga0157377_10022379 Ga0157377_100223791 321
152 3300037471 Ga0395905_0203178 Ga0395905_0203178_48_1013 321
153 3300046453 Ga0495627_000224 Ga0495627_000224_31948_32928 321
154 3300046471 Ga0495650_0001756 Ga0495650_0001756_15834_16814 321
155 3300047470 Ga0495681_0000011 Ga0495681_0000011_37027_38007 321
156 3300050493 nmdc:mga0k408_34852_c2 nmdc:mga0k408_34852_c2_589_1563 321
157 3300050495 nmdc:mga04h51_59395_c1 nmdc:mga04h51_59395_c1_320_1285 321
158 3300050515 nmdc:mga0a205_5975_c1 nmdc:mga0a205_5975_c1_1563_2528 321
159 3300053136 Ga0500559_0022361 Ga0500559_0022361_1245_2210 321
160 iso_pu_bacteria 2510917020 2511120387 321
161 iso_pu_bacteria 2643221583 2643924796 321
162 iso_pu_bacteria 2830075706 2830076896 321
163 iso_pu_bacteria 2885429604 2885430718 321
164 iso_pu_bacteria 2919513703 2919514470 321
165 iso_pu_bacteria 2946787523 2946789656 321
166 3300005355 Ga0070671_100021780 Ga0070671_1000217806 322
167 3300049583 Ga0501067_0109079 Ga0501067_0109079_510_1487 322
168 3300054114 Ga0501084_0000171 Ga0501084_0000171_40166_41143 322
169 3300005981 Ga0081538_10018384 Ga0081538_100183845 323
170 3300009093 Ga0105240_10085276 Ga0105240_100852762 323
171 3300025261 Ga0209233_1013690 Ga0209233_10136902 323
172 3300025913 Ga0207695_10458431 Ga0207695_104584311 323
173 3300025915 Ga0207693_10067961 Ga0207693_100679611 323
174 3300031247 Ga0265340_10001665 Ga0265340_100016652 323
175 3300031249 Ga0265339_10084722 Ga0265339_100847222 323
176 3300031344 Ga0265316_10018815 Ga0265316_100188154 323
177 3300031665 Ga0316575_10008358 Ga0316575_100083582 323
178 3300031665 Ga0316575_10032612 Ga0316575_100326122 323
179 3300031712 Ga0265342_10009933 Ga0265342_100099332 323
180 3300031727 Ga0316576_10228756 Ga0316576_102287561 323
181 3300031733 Ga0316577_10094086 Ga0316577_100940862 323
182 3300037466 Ga0395898_0243070 Ga0395898_0243070_232_1242 323
183 3300046524 Ga0495648_0007929 Ga0495648_0007929_1736_2713 323
184 3300046558 Ga0495633_0041501 Ga0495633_0041501_1192_2169 323
185 3300048915 Ga0496112_0027433 Ga0496112_0027433_1727_2743 323
186 3300049744 Ga0501083_0006223 Ga0501083_0006223_4568_5569 323
187 3300053117 Ga0500593_074444 Ga0500593_074444_161_1162 323
188 iso_pu_bacteria 2791355406 2793978932 323
189 iso_pu_bacteria 8048127548 8048137243 323
190 3300003320 rootH2_10075661 rootH2_100756612 324
191 3300005327 Ga0070658_10246114 Ga0070658_102461142 324
192 3300005327 Ga0070658_10318277 Ga0070658_103182772 324
193 3300005336 Ga0070680_100008701 Ga0070680_1000087012 324
194 3300005336 Ga0070680_100255725 Ga0070680_1002557252 324
195 3300005339 Ga0070660_100266557 Ga0070660_1002665571 324
196 3300005341 Ga0070691_10123756 Ga0070691_101237562 324
197 3300005458 Ga0070681_10113562 Ga0070681_101135623 324
198 3300005458 Ga0070681_10315254 Ga0070681_103152542 324
199 3300005458 Ga0070681_10332708 Ga0070681_103327082 324
200 3300005530 Ga0070679_100320061 Ga0070679_1003200612 324
201 3300005530 Ga0070679_100479188 Ga0070679_1004791882 324
202 3300005563 Ga0068855_100394571 Ga0068855_1003945712 324
203 3300005563 Ga0068855_100395925 Ga0068855_1003959252 324
204 3300005614 Ga0068856_100057631 Ga0068856_1000576313 324
205 3300005616 Ga0068852_100005893 Ga0068852_1000058937 324
206 3300006844 Ga0075428_100131976 Ga0075428_1001319762 324
207 3300006847 Ga0075431_100288808 Ga0075431_1002888082 324
208 3300009093 Ga0105240_10018070 Ga0105240_100180707 324
209 3300009551 Ga0105238_10007731 Ga0105238_100077314 324
210 3300013104 Ga0157370_10032238 Ga0157370_100322382 324
211 3300013104 Ga0157370_10284948 Ga0157370_102849482 324
212 3300013104 Ga0157370_10295723 Ga0157370_102957232 324
213 3300013105 Ga0157369_10098789 Ga0157369_100987892 324
214 3300020082 Ga0206353_10434619 Ga0206353_104346193 324
215 3300025909 Ga0207705_10000647 Ga0207705_1000064720 324
216 3300025912 Ga0207707_10004869 Ga0207707_100048692 324
217 3300025912 Ga0207707_10012471 Ga0207707_100124712 324
218 3300025912 Ga0207707_10271783 Ga0207707_102717832 324
219 3300025913 Ga0207695_10292239 Ga0207695_102922392 324
220 3300025917 Ga0207660_10000720 Ga0207660_1000072012 324
221 3300025917 Ga0207660_10002930 Ga0207660_100029302 324
222 3300025917 Ga0207660_10004462 Ga0207660_100044622 324
223 3300025919 Ga0207657_10002443 Ga0207657_1000244318 324
224 3300025921 Ga0207652_10001317 Ga0207652_1000131712 324
225 3300025921 Ga0207652_10002779 Ga0207652_1000277910 324
226 3300025949 Ga0207667_10029561 Ga0207667_100295614 324
227 3300025949 Ga0207667_10061822 Ga0207667_100618224 324
228 3300026142 Ga0207698_10050609 Ga0207698_100506092 324
229 3300028794 Ga0307515_10030060 Ga0307515_100300602 324
230 3300031711 Ga0265314_10008687 Ga0265314_100086876 324
231 3300035171 Ga0373946_0001529 Ga0373946_0001529_5493_6473 324
232 3300035692 Ga0373935_0016342 Ga0373935_0016342_1993_2973 324
233 3300035695 Ga0373927_0006248 Ga0373927_0006248_1240_2220 324
234 3300038443 Ga0395901_0455821 Ga0395901_0455821_64_1098 324
235 3300045976 Ga0466967_0082937 Ga0466967_0082937_387_1361 324
236 3300046475 Ga0495639_0048020 Ga0495639_0048020_826_1806 324
237 3300046499 Ga0495594_0075152 Ga0495594_0075152_885_1865 324
238 3300046500 Ga0495596_0006414 Ga0495596_0006414_149_1129 324
239 3300046512 Ga0495610_0001358 Ga0495610_0001358_15808_16788 324
240 3300046514 Ga0495618_0105126 Ga0495618_0105126_114_1148 324
241 3300046522 Ga0495643_0062327 Ga0495643_0062327_43_1023 324
242 3300046526 Ga0495666_0007474 Ga0495666_0007474_3251_4282 324
243 3300046660 Ga0495625_0000025 Ga0495625_0000025_216815_217789 324
244 3300046660 Ga0495625_0000665 Ga0495625_0000665_20279_21268 324
245 3300046660 Ga0495625_0001685 Ga0495625_0001685_15275_16255 324
246 3300047471 Ga0495684_0099297 Ga0495684_0099297_900_1934 324
247 3300048911 Ga0496108_0033094 Ga0496108_0033094_3023_3997 324
248 3300049568 Ga0501031_0059130 Ga0501031_0059130_983_1990 324
249 3300049569 Ga0501032_0053364 Ga0501032_0053364_1030_2046 324
250 3300049570 Ga0501033_0054652 Ga0501033_0054652_561_1568 324
251 3300049570 Ga0501033_0151270 Ga0501033_0151270_429_1436 324
252 3300049574 Ga0501038_0015781 Ga0501038_0015781_1102_2109 324
253 3300049579 Ga0501043_0047606 Ga0501043_0047606_537_1553 324
254 3300049581 Ga0501047_0040926 Ga0501047_0040926_770_1786 324
255 3300049586 Ga0501070_0000020 Ga0501070_0000020_59707_60714 324
256 3300049586 Ga0501070_0061488 Ga0501070_0061488_816_1832 324
257 3300049742 Ga0501080_0011676 Ga0501080_0011676_4159_5175 324
258 3300049742 Ga0501080_0075002 Ga0501080_0075002_292_1299 324
259 3300049822 Ga0501035_0006911 Ga0501035_0006911_8481_9488 324
260 3300049822 Ga0501035_0088838 Ga0501035_0088838_1005_2021 324
261 3300049823 Ga0501044_0020893 Ga0501044_0020893_2495_3511 324
262 3300049823 Ga0501044_0097527 Ga0501044_0097527_1649_2656 324
263 3300049823 Ga0501044_0202547 Ga0501044_0202547_369_1376 324
264 3300050510 nmdc:mga06r32_145461_c1 nmdc:mga06r32_145461_c1_976_1965 324
265 3300053077 Ga0495601_0011636 Ga0495601_0011636_1131_2165 324
266 3300053084 Ga0495595_0028222 Ga0495595_0028222_692_1726 324
267 3300053136 Ga0500559_0004706 Ga0500559_0004706_3278_4252 324
268 3300001979 JGI24740J21852_10005372 JGI24740J21852_100053724 325
269 3300001989 JGI24739J22299_10004790 JGI24739J22299_100047905 325
270 3300001989 JGI24739J22299_10009552 JGI24739J22299_100095522 325
271 3300001989 JGI24739J22299_10049772 JGI24739J22299_100497722 325
272 3300001990 JGI24737J22298_10000687 JGI24737J22298_100006878 325
273 3300002067 JGI24735J21928_10027297 JGI24735J21928_100272972 325
274 3300002075 JGI24738J21930_10002091 JGI24738J21930_100020914 325
275 3300002075 JGI24738J21930_10007677 JGI24738J21930_100076774 325
276 3300002774 JGI25150J39212_1000020 JGI25150J39212_100002075 325
277 3300003187 JGI25151J46595_10055943 JGI25151J46595_100559431 325
278 3300003215 JGI25153J46596_10000017 JGI25153J46596_10000017141 325
279 3300003781 Ga0055536_1011158 Ga0055536_10111584 325
280 3300003791 Ga0055530_10016424 Ga0055530_100164242 325
281 3300003792 Ga0055540_1005503 Ga0055540_10055033 325
282 3300005262 Ga0065165_1000625 Ga0065165_10006252 325
283 3300005288 Ga0065714_10109070 Ga0065714_101090701 325
284 3300005327 Ga0070658_10008641 Ga0070658_100086418 325
285 3300005327 Ga0070658_10040306 Ga0070658_100403063 325
286 3300005327 Ga0070658_10222296 Ga0070658_102222962 325
287 3300005328 Ga0070676_10004172 Ga0070676_100041725 325
288 3300005329 Ga0070683_100025567 Ga0070683_1000255676 325
289 3300005329 Ga0070683_100218535 Ga0070683_1002185352 325
290 3300005330 Ga0070690_100091417 Ga0070690_1000914172 325
291 3300005331 Ga0070670_100016900 Ga0070670_1000169003 325
292 3300005331 Ga0070670_100025510 Ga0070670_1000255104 325
293 3300005334 Ga0068869_100003116 Ga0068869_1000031167 325
294 3300005335 Ga0070666_10062831 Ga0070666_100628311 325
295 3300005336 Ga0070680_100000777 Ga0070680_10000077713 325
296 3300005336 Ga0070680_100001609 Ga0070680_1000016094 325
297 3300005336 Ga0070680_100310653 Ga0070680_1003106531 325
298 3300005337 Ga0070682_100035315 Ga0070682_1000353154 325
299 3300005338 Ga0068868_100011184 Ga0068868_1000111842 325
300 3300005339 Ga0070660_100004065 Ga0070660_1000040656 325
301 3300005339 Ga0070660_100017639 Ga0070660_1000176397 325
302 3300005339 Ga0070660_100029155 Ga0070660_1000291552 325
303 3300005339 Ga0070660_100047766 Ga0070660_1000477662 325
304 3300005339 Ga0070660_100160963 Ga0070660_1001609632 325
305 3300005339 Ga0070660_100186491 Ga0070660_1001864911 325
306 3300005339 Ga0070660_100310240 Ga0070660_1003102402 325
307 3300005339 Ga0070660_100362680 Ga0070660_1003626802 325
308 3300005341 Ga0070691_10008548 Ga0070691_100085484 325
309 3300005344 Ga0070661_100001494 Ga0070661_10000149412 325
310 3300005344 Ga0070661_100040130 Ga0070661_1000401303 325
311 3300005344 Ga0070661_100108664 Ga0070661_1001086643 325
312 3300005344 Ga0070661_100169133 Ga0070661_1001691333 325
313 3300005344 Ga0070661_100182187 Ga0070661_1001821871 325
314 3300005345 Ga0070692_10041405 Ga0070692_100414051 325
315 3300005347 Ga0070668_100043360 Ga0070668_1000433603 325
316 3300005353 Ga0070669_100000138 Ga0070669_10000013872 325
317 3300005353 Ga0070669_100041151 Ga0070669_1000411514 325
318 3300005354 Ga0070675_100021410 Ga0070675_1000214104 325
319 3300005355 Ga0070671_100027056 Ga0070671_1000270562 325
320 3300005355 Ga0070671_100104838 Ga0070671_1001048382 325
321 3300005355 Ga0070671_100232034 Ga0070671_1002320342 325
322 3300005356 Ga0070674_100033254 Ga0070674_1000332543 325
323 3300005364 Ga0070673_100002586 Ga0070673_1000025864 325
324 3300005364 Ga0070673_100004948 Ga0070673_1000049486 325
325 3300005366 Ga0070659_100001040 Ga0070659_10000104010 325
326 3300005366 Ga0070659_100007325 Ga0070659_1000073253 325
327 3300005366 Ga0070659_100015988 Ga0070659_1000159884 325
328 3300005366 Ga0070659_100027275 Ga0070659_1000272753 325
329 3300005366 Ga0070659_100065256 Ga0070659_1000652564 325
330 3300005366 Ga0070659_100075317 Ga0070659_1000753173 325
331 3300005366 Ga0070659_100112163 Ga0070659_1001121632 325
332 3300005367 Ga0070667_100047812 Ga0070667_1000478123 325
333 3300005367 Ga0070667_100227132 Ga0070667_1002271322 325
334 3300005444 Ga0070694_100020574 Ga0070694_1000205745 325
335 3300005455 Ga0070663_100048900 Ga0070663_1000489003 325
336 3300005455 Ga0070663_100109285 Ga0070663_1001092852 325
337 3300005455 Ga0070663_100276188 Ga0070663_1002761882 325
338 3300005455 Ga0070663_100398467 Ga0070663_1003984671 325
339 3300005457 Ga0070662_100001837 Ga0070662_1000018372 325
340 3300005457 Ga0070662_100001928 Ga0070662_1000019287 325
341 3300005457 Ga0070662_100080350 Ga0070662_1000803503 325
342 3300005458 Ga0070681_10006985 Ga0070681_100069854 325
343 3300005459 Ga0068867_100010664 Ga0068867_1000106644 325
344 3300005530 Ga0070679_100004635 Ga0070679_1000046352 325
345 3300005530 Ga0070679_100077512 Ga0070679_1000775123 325
346 3300005530 Ga0070679_100330242 Ga0070679_1003302422 325
347 3300005530 Ga0070679_100419467 Ga0070679_1004194672 325
348 3300005535 Ga0070684_100027737 Ga0070684_1000277373 325
349 3300005535 Ga0070684_100124210 Ga0070684_1001242102 325
350 3300005535 Ga0070684_100345018 Ga0070684_1003450182 325
351 3300005539 Ga0068853_100004994 Ga0068853_1000049942 325
352 3300005539 Ga0068853_100027359 Ga0068853_1000273594 325
353 3300005539 Ga0068853_100027704 Ga0068853_1000277042 325
354 3300005539 Ga0068853_100033891 Ga0068853_1000338912 325
355 3300005539 Ga0068853_100113339 Ga0068853_1001133392 325
356 3300005539 Ga0068853_100116126 Ga0068853_1001161262 325
357 3300005539 Ga0068853_100134100 Ga0068853_1001341004 325
358 3300005543 Ga0070672_100000868 Ga0070672_1000008689 325
359 3300005547 Ga0070693_100284404 Ga0070693_1002844041 325
360 3300005548 Ga0070665_100000380 Ga0070665_1000003807 325
361 3300005548 Ga0070665_100138367 Ga0070665_1001383672 325
362 3300005563 Ga0068855_100001148 Ga0068855_10000114819 325
363 3300005563 Ga0068855_100008821 Ga0068855_1000088218 325
364 3300005563 Ga0068855_100010741 Ga0068855_1000107415 325
365 3300005563 Ga0068855_100709803 Ga0068855_1007098031 325
366 3300005564 Ga0070664_100002792 Ga0070664_1000027924 325
367 3300005564 Ga0070664_100004946 Ga0070664_1000049462 325
368 3300005564 Ga0070664_100006300 Ga0070664_1000063002 325
369 3300005564 Ga0070664_100043512 Ga0070664_1000435123 325
370 3300005564 Ga0070664_100057463 Ga0070664_1000574634 325
371 3300005577 Ga0068857_100007132 Ga0068857_1000071327 325
372 3300005577 Ga0068857_100021844 Ga0068857_1000218443 325
373 3300005577 Ga0068857_100041994 Ga0068857_1000419947 325
374 3300005577 Ga0068857_100107278 Ga0068857_1001072782 325
375 3300005577 Ga0068857_100189409 Ga0068857_1001894092 325
376 3300005577 Ga0068857_100313261 Ga0068857_1003132612 325
377 3300005578 Ga0068854_100005266 Ga0068854_1000052663 325
378 3300005578 Ga0068854_100014636 Ga0068854_1000146364 325
379 3300005578 Ga0068854_100072173 Ga0068854_1000721731 325
380 3300005578 Ga0068854_100072875 Ga0068854_1000728753 325
381 3300005578 Ga0068854_100240021 Ga0068854_1002400212 325
382 3300005614 Ga0068856_100009932 Ga0068856_1000099322 325
383 3300005614 Ga0068856_100047053 Ga0068856_1000470532 325
384 3300005614 Ga0068856_100347459 Ga0068856_1003474592 325
385 3300005614 Ga0068856_100618558 Ga0068856_1006185581 325
386 3300005616 Ga0068852_100000946 Ga0068852_10000094615 325
387 3300005616 Ga0068852_100018079 Ga0068852_1000180795 325
388 3300005616 Ga0068852_100112815 Ga0068852_1001128152 325
389 3300005616 Ga0068852_100125607 Ga0068852_1001256071 325
390 3300005616 Ga0068852_100225606 Ga0068852_1002256062 325
391 3300005616 Ga0068852_100505068 Ga0068852_1005050682 325
392 3300005617 Ga0068859_100000550 Ga0068859_10000055041 325
393 3300005617 Ga0068859_100006426 Ga0068859_1000064263 325
394 3300005617 Ga0068859_100073328 Ga0068859_1000733283 325
395 3300005617 Ga0068859_100155178 Ga0068859_1001551784 325
396 3300005618 Ga0068864_100003528 Ga0068864_1000035286 325
397 3300005618 Ga0068864_100005190 Ga0068864_1000051903 325
398 3300005834 Ga0068851_10012796 Ga0068851_100127962 325
399 3300005834 Ga0068851_10014173 Ga0068851_100141732 325
400 3300005841 Ga0068863_100004087 Ga0068863_1000040876 325
401 3300005841 Ga0068863_100009309 Ga0068863_1000093099 325
402 3300005841 Ga0068863_100048341 Ga0068863_1000483411 325
403 3300005841 Ga0068863_100226573 Ga0068863_1002265732 325
404 3300005842 Ga0068858_100002589 Ga0068858_1000025894 325
405 3300005842 Ga0068858_100004956 Ga0068858_1000049565 325
406 3300005842 Ga0068858_100023934 Ga0068858_1000239348 325
407 3300005842 Ga0068858_100025161 Ga0068858_1000251614 325
408 3300005843 Ga0068860_100004406 Ga0068860_1000044068 325
409 3300005843 Ga0068860_100006884 Ga0068860_1000068843 325
410 3300005843 Ga0068860_100284558 Ga0068860_1002845582 325
411 3300005844 Ga0068862_100006635 Ga0068862_1000066356 325
412 3300005844 Ga0068862_100021749 Ga0068862_1000217496 325
413 3300006175 Ga0070712_100185284 Ga0070712_1001852842 325
414 3300006195 Ga0075366_10026901 Ga0075366_100269013 325
415 3300006195 Ga0075366_10067766 Ga0075366_100677661 325
416 3300006195 Ga0075366_10180035 Ga0075366_101800352 325
417 3300006353 Ga0075370_10000001 Ga0075370_10000001140 325
418 3300006358 Ga0068871_100405905 Ga0068871_1004059051 325
419 3300006852 Ga0075433_10010202 Ga0075433_100102029 325
420 3300006881 Ga0068865_100005976 Ga0068865_1000059764 325
421 3300006931 Ga0097620_100000550 Ga0097620_10000055041 325
422 3300006931 Ga0097620_100006426 Ga0097620_1000064263 325
423 3300006931 Ga0097620_100073329 Ga0097620_1000733293 325
424 3300006931 Ga0097620_100155181 Ga0097620_1001551814 325
425 3300009093 Ga0105240_10010679 Ga0105240_100106792 325
426 3300009093 Ga0105240_10065883 Ga0105240_100658833 325
427 3300009093 Ga0105240_10150136 Ga0105240_101501362 325
428 3300009101 Ga0105247_10018070 Ga0105247_100180703 325
429 3300009174 Ga0105241_10027469 Ga0105241_100274693 325
430 3300009174 Ga0105241_10284753 Ga0105241_102847532 325
431 3300009177 Ga0105248_10031695 Ga0105248_100316952 325
432 3300009551 Ga0105238_10052170 Ga0105238_100521703 325
433 3300010375 Ga0105239_10053714 Ga0105239_100537144 325
434 3300013100 Ga0157373_10076574 Ga0157373_100765742 325
435 3300013100 Ga0157373_10081004 Ga0157373_100810042 325
436 3300013100 Ga0157373_10142136 Ga0157373_101421362 325
437 3300013102 Ga0157371_10002797 Ga0157371_100027974 325
438 3300013104 Ga0157370_10006108 Ga0157370_100061086 325
439 3300013104 Ga0157370_10097207 Ga0157370_100972073 325
440 3300013104 Ga0157370_10130551 Ga0157370_101305513 325
441 3300013105 Ga0157369_10007310 Ga0157369_100073106 325
442 3300013105 Ga0157369_10085210 Ga0157369_100852103 325
443 3300013105 Ga0157369_10290820 Ga0157369_102908202 325
444 3300013105 Ga0157369_10504471 Ga0157369_105044711 325
445 3300013296 Ga0157374_10086272 Ga0157374_100862723 325
446 3300013297 Ga0157378_10437162 Ga0157378_104371621 325
447 3300013306 Ga0163162_10064438 Ga0163162_100644383 325
448 3300013306 Ga0163162_10122274 Ga0163162_101222741 325
449 3300013306 Ga0163162_10511373 Ga0163162_105113732 325
450 3300013307 Ga0157372_10003571 Ga0157372_100035716 325
451 3300013307 Ga0157372_10244011 Ga0157372_102440113 325
452 3300013308 Ga0157375_10026969 Ga0157375_100269693 325
453 3300013308 Ga0157375_10100575 Ga0157375_101005752 325
454 3300014325 Ga0163163_10003435 Ga0163163_1000343513 325
455 3300014968 Ga0157379_10006683 Ga0157379_100066833 325
456 3300025245 Ga0207425_1000022 Ga0207425_1000022189 325
457 3300025258 Ga0209129_1000286 Ga0209129_100028614 325
458 3300025292 Ga0209676_1009141 Ga0209676_10091412 325
459 3300025294 Ga0209025_1001464 Ga0209025_10014646 325
460 3300025297 Ga0209758_1000004 Ga0209758_1000004816 325
461 3300025298 Ga0209050_1000001 Ga0209050_10000012820 325
462 3300025303 Ga0209051_1000246 Ga0209051_100024620 325
463 3300025304 Ga0209257_1011642 Ga0209257_10116423 325
464 3300025315 Ga0207697_10000297 Ga0207697_100002978 325
465 3300025321 Ga0207656_10008833 Ga0207656_100088332 325
466 3300025321 Ga0207656_10013262 Ga0207656_100132623 325
467 3300025321 Ga0207656_10026133 Ga0207656_100261333 325
468 3300025901 Ga0207688_10000214 Ga0207688_1000021425 325
469 3300025904 Ga0207647_10000450 Ga0207647_1000045014 325
470 3300025904 Ga0207647_10000550 Ga0207647_100005508 325
471 3300025904 Ga0207647_10001333 Ga0207647_100013336 325
472 3300025904 Ga0207647_10051388 Ga0207647_100513884 325
473 3300025907 Ga0207645_10047073 Ga0207645_100470732 325
474 3300025909 Ga0207705_10000733 Ga0207705_1000073315 325
475 3300025909 Ga0207705_10012679 Ga0207705_100126795 325
476 3300025909 Ga0207705_10021334 Ga0207705_100213346 325
477 3300025909 Ga0207705_10036186 Ga0207705_100361864 325
478 3300025909 Ga0207705_10038781 Ga0207705_100387813 325
479 3300025909 Ga0207705_10043296 Ga0207705_100432962 325
480 3300025911 Ga0207654_10129313 Ga0207654_101293132 325
481 3300025912 Ga0207707_10031408 Ga0207707_100314082 325
482 3300025913 Ga0207695_10048907 Ga0207695_100489073 325
483 3300025913 Ga0207695_10105071 Ga0207695_101050712 325
484 3300025917 Ga0207660_10000753 Ga0207660_100007533 325
485 3300025917 Ga0207660_10002951 Ga0207660_100029514 325
486 3300025917 Ga0207660_10026504 Ga0207660_100265042 325
487 3300025917 Ga0207660_10400218 Ga0207660_104002181 325
488 3300025919 Ga0207657_10002019 Ga0207657_100020194 325
489 3300025919 Ga0207657_10003530 Ga0207657_100035306 325
490 3300025919 Ga0207657_10009031 Ga0207657_100090319 325
491 3300025919 Ga0207657_10010446 Ga0207657_1001044610 325
492 3300025919 Ga0207657_10011217 Ga0207657_100112173 325
493 3300025919 Ga0207657_10016702 Ga0207657_100167022 325
494 3300025919 Ga0207657_10028287 Ga0207657_100282872 325
495 3300025919 Ga0207657_10296054 Ga0207657_102960542 325
496 3300025919 Ga0207657_10317974 Ga0207657_103179742 325
497 3300025920 Ga0207649_10010422 Ga0207649_100104221 325
498 3300025920 Ga0207649_10021475 Ga0207649_100214753 325
499 3300025920 Ga0207649_10028353 Ga0207649_100283533 325
500 3300025920 Ga0207649_10056575 Ga0207649_100565752 325
501 3300025921 Ga0207652_10115640 Ga0207652_101156402 325
502 3300025921 Ga0207652_10287960 Ga0207652_102879602 325
503 3300025923 Ga0207681_10002797 Ga0207681_100027978 325
504 3300025923 Ga0207681_10045621 Ga0207681_100456212 325
505 3300025924 Ga0207694_10009321 Ga0207694_100093213 325
506 3300025924 Ga0207694_10102113 Ga0207694_101021132 325
507 3300025926 Ga0207659_10011048 Ga0207659_100110482 325
508 3300025926 Ga0207659_10277564 Ga0207659_102775641 325
509 3300025927 Ga0207687_10004719 Ga0207687_100047193 325
510 3300025931 Ga0207644_10021354 Ga0207644_100213542 325
511 3300025931 Ga0207644_10021704 Ga0207644_100217043 325
512 3300025931 Ga0207644_10028811 Ga0207644_100288112 325
513 3300025931 Ga0207644_10067500 Ga0207644_100675002 325
514 3300025931 Ga0207644_10178978 Ga0207644_101789782 325
515 3300025932 Ga0207690_10004314 Ga0207690_100043145 325
516 3300025932 Ga0207690_10031546 Ga0207690_100315462 325
517 3300025932 Ga0207690_10061653 Ga0207690_100616531 325
518 3300025932 Ga0207690_10069839 Ga0207690_100698392 325
519 3300025932 Ga0207690_10174621 Ga0207690_101746212 325
520 3300025932 Ga0207690_10247107 Ga0207690_102471072 325
521 3300025933 Ga0207706_10001953 Ga0207706_1000195310 325
522 3300025933 Ga0207706_10002890 Ga0207706_100028908 325
523 3300025933 Ga0207706_10019463 Ga0207706_100194637 325
524 3300025933 Ga0207706_10109711 Ga0207706_101097113 325
525 3300025935 Ga0207709_10069381 Ga0207709_100693813 325
526 3300025935 Ga0207709_10101297 Ga0207709_101012971 325
527 3300025937 Ga0207669_10052976 Ga0207669_100529761 325
528 3300025938 Ga0207704_10043071 Ga0207704_100430712 325
529 3300025940 Ga0207691_10000047 Ga0207691_100000478 325
530 3300025940 Ga0207691_10073755 Ga0207691_100737553 325
531 3300025940 Ga0207691_10228695 Ga0207691_102286952 325
532 3300025941 Ga0207711_10001028 Ga0207711_100010282 325
533 3300025941 Ga0207711_10003195 Ga0207711_100031956 325
534 3300025941 Ga0207711_10003281 Ga0207711_1000328114 325
535 3300025942 Ga0207689_10000002 Ga0207689_100000028 325
536 3300025942 Ga0207689_10014038 Ga0207689_100140387 325
537 3300025944 Ga0207661_10322527 Ga0207661_103225272 325
538 3300025945 Ga0207679_10034440 Ga0207679_100344403 325
539 3300025945 Ga0207679_10058928 Ga0207679_100589282 325
540 3300025949 Ga0207667_10004932 Ga0207667_100049323 325
541 3300025949 Ga0207667_10015484 Ga0207667_100154842 325
542 3300025949 Ga0207667_10017570 Ga0207667_100175704 325
543 3300025949 Ga0207667_10051008 Ga0207667_100510082 325
544 3300025960 Ga0207651_10010367 Ga0207651_100103674 325
545 3300025960 Ga0207651_10027820 Ga0207651_100278202 325
546 3300025960 Ga0207651_10254231 Ga0207651_102542311 325
547 3300025961 Ga0207712_10000969 Ga0207712_100009695 325
548 3300025961 Ga0207712_10095457 Ga0207712_100954572 325
549 3300025972 Ga0207668_10113779 Ga0207668_101137792 325
550 3300025981 Ga0207640_10010650 Ga0207640_100106504 325
551 3300025981 Ga0207640_10024071 Ga0207640_100240713 325
552 3300025981 Ga0207640_10283999 Ga0207640_102839991 325
553 3300025986 Ga0207658_10003561 Ga0207658_100035619 325
554 3300025986 Ga0207658_10023648 Ga0207658_100236482 325
555 3300025986 Ga0207658_10230416 Ga0207658_102304162 325
556 3300026023 Ga0207677_10361972 Ga0207677_103619722 325
557 3300026035 Ga0207703_10002189 Ga0207703_100021896 325
558 3300026035 Ga0207703_10030569 Ga0207703_100305693 325
559 3300026035 Ga0207703_10065739 Ga0207703_100657392 325
560 3300026035 Ga0207703_10204788 Ga0207703_102047882 325
561 3300026041 Ga0207639_10002813 Ga0207639_100028134 325
562 3300026041 Ga0207639_10013429 Ga0207639_100134292 325
563 3300026041 Ga0207639_10014834 Ga0207639_100148343 325
564 3300026041 Ga0207639_10028477 Ga0207639_100284772 325
565 3300026041 Ga0207639_10030303 Ga0207639_100303032 325
566 3300026041 Ga0207639_10088370 Ga0207639_100883703 325
567 3300026041 Ga0207639_10111414 Ga0207639_101114142 325
568 3300026067 Ga0207678_10001895 Ga0207678_1000189521 325
569 3300026067 Ga0207678_10003129 Ga0207678_1000312912 325
570 3300026067 Ga0207678_10047684 Ga0207678_100476842 325
571 3300026067 Ga0207678_10061702 Ga0207678_100617022 325
572 3300026067 Ga0207678_10062991 Ga0207678_100629912 325
573 3300026067 Ga0207678_10172896 Ga0207678_101728961 325
574 3300026078 Ga0207702_10031490 Ga0207702_100314902 325
575 3300026078 Ga0207702_10045727 Ga0207702_100457272 325
576 3300026078 Ga0207702_10196823 Ga0207702_101968232 325
577 3300026078 Ga0207702_10314046 Ga0207702_103140462 325
578 3300026088 Ga0207641_10000761 Ga0207641_1000076136 325
579 3300026088 Ga0207641_10002113 Ga0207641_100021138 325
580 3300026089 Ga0207648_10001403 Ga0207648_1000140320 325
581 3300026089 Ga0207648_10017420 Ga0207648_100174202 325
582 3300026089 Ga0207648_10048809 Ga0207648_100488092 325
583 3300026095 Ga0207676_10000731 Ga0207676_1000073114 325
584 3300026095 Ga0207676_10012400 Ga0207676_100124005 325
585 3300026095 Ga0207676_10565241 Ga0207676_105652411 325
586 3300026116 Ga0207674_10000850 Ga0207674_100008508 325
587 3300026116 Ga0207674_10011911 Ga0207674_100119115 325
588 3300026116 Ga0207674_10012448 Ga0207674_100124487 325
589 3300026116 Ga0207674_10035053 Ga0207674_100350532 325
590 3300026116 Ga0207674_10036991 Ga0207674_100369914 325
591 3300026116 Ga0207674_10054898 Ga0207674_100548983 325
592 3300026116 Ga0207674_10422338 Ga0207674_104223382 325
593 3300026142 Ga0207698_10006372 Ga0207698_100063724 325
594 3300026142 Ga0207698_10009246 Ga0207698_100092463 325
595 3300026142 Ga0207698_10046586 Ga0207698_100465865 325
596 3300026142 Ga0207698_10069575 Ga0207698_100695752 325
597 3300026142 Ga0207698_10093468 Ga0207698_100934682 325
598 3300026142 Ga0207698_10147759 Ga0207698_101477592 325
599 3300026142 Ga0207698_10319786 Ga0207698_103197862 325
600 3300027866 Ga0209813_10005352 Ga0209813_100053524 325
601 3300028379 Ga0268266_10000256 Ga0268266_1000025695 325
602 3300028379 Ga0268266_10102025 Ga0268266_101020252 325
603 3300028380 Ga0268265_10007223 Ga0268265_100072235 325
604 3300028380 Ga0268265_10047457 Ga0268265_100474574 325
605 3300028380 Ga0268265_10232819 Ga0268265_102328192 325
606 3300028380 Ga0268265_10245348 Ga0268265_102453482 325
607 3300028381 Ga0268264_10000755 Ga0268264_1000075522 325
608 3300028381 Ga0268264_10032295 Ga0268264_100322953 325
609 3300028577 Ga0265318_10069592 Ga0265318_100695922 325
610 3300028794 Ga0307515_10000186 Ga0307515_1000018674 325
611 3300028800 Ga0265338_10006667 Ga0265338_1000666715 325
612 3300031238 Ga0265332_10042963 Ga0265332_100429631 325
613 3300031240 Ga0265320_10000088 Ga0265320_1000008853 325
614 3300031241 Ga0265325_10019084 Ga0265325_100190842 325
615 3300031344 Ga0265316_10085401 Ga0265316_100854012 325
616 3300031595 Ga0265313_10034458 Ga0265313_100344582 325
617 3300031711 Ga0265314_10011566 Ga0265314_100115662 325
618 3300031712 Ga0265342_10013637 Ga0265342_100136372 325
619 3300031824 Ga0307413_10033399 Ga0307413_100333994 325
620 3300031852 Ga0307410_10103090 Ga0307410_101030903 325
621 3300031852 Ga0307410_10440576 Ga0307410_104405761 325
622 3300031903 Ga0307407_10088573 Ga0307407_100885732 325
623 3300031911 Ga0307412_10019158 Ga0307412_100191582 325
624 3300031995 Ga0307409_100018531 Ga0307409_1000185315 325
625 3300031995 Ga0307409_100074682 Ga0307409_1000746822 325
626 3300032004 Ga0307414_10009782 Ga0307414_100097823 325
627 3300032004 Ga0307414_10010095 Ga0307414_100100954 325
628 3300032004 Ga0307414_10044469 Ga0307414_100444693 325
629 3300032004 Ga0307414_10154988 Ga0307414_101549882 325
630 3300032004 Ga0307414_10465226 Ga0307414_104652261 325
631 3300032005 Ga0307411_10000948 Ga0307411_100009484 325
632 3300032005 Ga0307411_10020582 Ga0307411_100205822 325
633 3300032005 Ga0307411_10025486 Ga0307411_100254863 325
634 3300032005 Ga0307411_10027338 Ga0307411_100273386 325
635 3300032126 Ga0307415_100001833 Ga0307415_1000018335 325
636 3300032126 Ga0307415_100033428 Ga0307415_1000334287 325
637 3300037418 Ga0395900_0001617 Ga0395900_0001617_6500_7486 325
638 3300037418 Ga0395900_0023841 Ga0395900_0023841_3061_4038 325
639 3300037418 Ga0395900_0070364 Ga0395900_0070364_2347_3324 325
640 3300037418 Ga0395900_0073310 Ga0395900_0073310_1988_2965 325
641 3300037418 Ga0395900_0297051 Ga0395900_0297051_573_1565 325
642 3300037466 Ga0395898_0001594 Ga0395898_0001594_24350_25327 325
643 3300037466 Ga0395898_0038614 Ga0395898_0038614_2032_3009 325
644 3300037466 Ga0395898_0121876 Ga0395898_0121876_15_1007 325
645 3300037471 Ga0395905_0004005 Ga0395905_0004005_7825_8811 325
646 3300037471 Ga0395905_0014247 Ga0395905_0014247_5394_6371 325
647 3300037471 Ga0395905_0016641 Ga0395905_0016641_175_1152 325
648 3300037471 Ga0395905_0024162 Ga0395905_0024162_2167_3147 325
649 3300037471 Ga0395905_0066005 Ga0395905_0066005_178_1155 325
650 3300037471 Ga0395905_0213911 Ga0395905_0213911_573_1565 325
651 3300037471 Ga0395905_0380168 Ga0395905_0380168_213_1190 325
652 3300037471 Ga0395905_0397782 Ga0395905_0397782_197_1174 325
653 3300038443 Ga0395901_0002443 Ga0395901_0002443_9424_10410 325
654 3300038443 Ga0395901_0012539 Ga0395901_0012539_3867_4844 325
655 3300038443 Ga0395901_0041312 Ga0395901_0041312_2664_3641 325
656 3300038443 Ga0395901_0061864 Ga0395901_0061864_1785_2762 325
657 3300038443 Ga0395901_0139342 Ga0395901_0139342_1369_2361 325
658 3300038443 Ga0395901_0287881 Ga0395901_0287881_239_1216 325
659 3300039438 Ga0436360_0764336 Ga0436360_0764336_60_1058 325
660 3300039450 Ga0436363_1352830 Ga0436363_1352830_39_1025 325
661 3300042005 Ga0439448_0002573 Ga0439448_0002573_3592_4569 325
662 3300042007 Ga0439449_0000498 Ga0439449_0000498_3912_4892 325
663 3300042010 Ga0439452_011492 Ga0439452_011492_365_1345 325
664 3300042012 Ga0439455_0000252 Ga0439455_0000252_5463_6440 325
665 3300042157 Ga0439458_0000255 Ga0439458_0000255_3316_4293 325
666 3300042157 Ga0439458_0006263 Ga0439458_0006263_1074_2051 325
667 3300042439 Ga0439464_0000114 Ga0439464_0000114_4413_5390 325
668 3300042461 Ga0439460_0046173 Ga0439460_0046173_240_1217 325
669 3300044694 Ga0466963_0035095 Ga0466963_0035095_1216_2205 325
670 3300044842 Ga0466957_0312078 Ga0466957_0312078_61_1038 325
671 3300045976 Ga0466967_0072406 Ga0466967_0072406_1421_2398 325
672 3300046453 Ga0495627_000650 Ga0495627_000650_12453_13430 325
673 3300046460 Ga0495638_0004955 Ga0495638_0004955_7707_8684 325
674 3300046512 Ga0495610_0006803 Ga0495610_0006803_231_1208 325
675 3300046520 Ga0495637_0026938 Ga0495637_0026938_760_1737 325
676 3300046674 Ga0495588_0035246 Ga0495588_0035246_41_1024 325
677 3300046684 Ga0495669_0000556 Ga0495669_0000556_5997_6980 325
678 3300046691 Ga0495670_0000014 Ga0495670_0000014_115226_116203 325
679 3300046694 Ga0495649_0012204 Ga0495649_0012204_2536_3513 325
680 3300047469 Ga0495673_0000078 Ga0495673_0000078_58760_59737 325
681 3300047472 Ga0495686_0000147 Ga0495686_0000147_67246_68223 325
682 3300047472 Ga0495686_0000661 Ga0495686_0000661_537_1514 325
683 3300047472 Ga0495686_0121210 Ga0495686_0121210_413_1390 325
684 3300047472 Ga0495686_0185313 Ga0495686_0185313_132_1109 325
685 3300048905 Ga0496102_0265920 Ga0496102_0265920_485_1555 325
686 3300048905 Ga0496102_0275836 Ga0496102_0275836_288_1265 325
687 3300048910 Ga0496107_0032008 Ga0496107_0032008_1939_2919 325
688 3300048910 Ga0496107_0136217 Ga0496107_0136217_297_1310 325
689 3300048913 Ga0496110_0130977 Ga0496110_0130977_966_1979 325
690 3300048914 Ga0496111_0146163 Ga0496111_0146163_508_1521 325
691 3300048915 Ga0496112_0210036 Ga0496112_0210036_718_1698 325
692 3300048917 Ga0496114_0090799 Ga0496114_0090799_184_1197 325
693 3300048921 Ga0496118_0001617 Ga0496118_0001617_122_1108 325
694 3300048923 Ga0496120_0161911 Ga0496120_0161911_49_1026 325
695 3300048924 Ga0496121_0000031 Ga0496121_0000031_121655_122635 325
696 3300048924 Ga0496121_0003131 Ga0496121_0003131_12413_13399 325
697 3300048926 Ga0496123_0002459 Ga0496123_0002459_4835_5812 325
698 3300048927 Ga0496124_0015727 Ga0496124_0015727_2156_3133 325
699 3300048927 Ga0496124_0142495 Ga0496124_0142495_653_1639 325
700 3300049570 Ga0501033_0014079 Ga0501033_0014079_169_1146 325
701 3300049572 Ga0501036_0282734 Ga0501036_0282734_251_1228 325
702 3300049579 Ga0501043_0020865 Ga0501043_0020865_3006_3992 325
703 3300049581 Ga0501047_0001117 Ga0501047_0001117_12781_13767 325
704 3300049581 Ga0501047_0013021 Ga0501047_0013021_5348_6325 325
705 3300049585 Ga0501069_0036991 Ga0501069_0036991_150_1127 325
706 3300049823 Ga0501044_0014571 Ga0501044_0014571_1362_2339 325
707 3300050493 nmdc:mga0k408_161782_c1 nmdc:mga0k408_161782_c1_157_1134 325
708 3300050493 nmdc:mga0k408_25112_c1 nmdc:mga0k408_25112_c1_1736_2722 325
709 3300050496 nmdc:mga07m45_2_c1 nmdc:mga07m45_2_c1_118438_119424 325
710 3300053096 Ga0500641_0021781 Ga0500641_0021781_729_1715 325
711 3300053120 Ga0500597_024094 Ga0500597_024094_1280_2272 325
712 3300053125 Ga0500618_000514 Ga0500618_000514_8309_9289 325
713 3300053153 Ga0500616_0008861 Ga0500616_0008861_4175_5161 325
714 3300053156 Ga0500622_0034813 Ga0500622_0034813_1628_2611 325
715 3300053157 Ga0500624_000020 Ga0500624_000020_38489_39481 325
716 3300053178 Ga0500637_0000022 Ga0500637_0000022_38464_39456 325
717 iso_pu_bacteria 2919675420 2919678829 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

33

190

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

216

338

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9498 1 32
5y7a-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn 0.9496 2 31
6foy-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 9 0.9484 1 31
6foz-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 0.9482 2 31
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9391 2 31
ID Description Score Start End Superfamily
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 1 178 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 1 137 3.40.50.720
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 1 178 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9371 2 31 3.50.50.60
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9309 2 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9956 1 115 GO:0004616
GO:0050661
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9934 1 115
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9917 47 154 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.991 1 134 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9903 1 88 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
90.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map