F477078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 716 | 267 | 1432 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0279796|Ga0501069_0279796_643_888 |
| Length | 75 |
| Sequence | MRLACVDSGHAPGERAVLAEMESTSGRPPSDVLKTLYYRPEIFGLDLAMRGESDWSHAERELFAAFVSSLNQCPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 143 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 155 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 156 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 157 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 158 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 12.85 |
| Rhizosphere | 86.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501069_0279796 | 3300049585 | Bacteria | 976 |
| 2 | rootL2_10301789 | 3300003322 | Bacteria | 2507 |
| 3 | Ga0070690_100346472 | 3300005330 | Bacteria | 1077 |
| 4 | Ga0070690_101423652 | 3300005330 | Bacteria | 558 |
| 5 | Ga0068869_100801970 | 3300005334 | Unclassified | 809 |
| 6 | Ga0070680_100021495 | 3300005336 | Bacteria | 5129 |
| 7 | Ga0070680_100037189 | 3300005336 | Bacteria | 3933 |
| 8 | Ga0070682_100049009 | 3300005337 | Bacteria | 2632 |
| 9 | Ga0070682_102003697 | 3300005337 | Unclassified | 509 |
| 10 | Ga0068868_100588019 | 3300005338 | Bacteria | 985 |
| 11 | Ga0070660_101828276 | 3300005339 | Bacteria | 518 |
| 12 | Ga0070689_100648573 | 3300005340 | Bacteria | 918 |
| 13 | Ga0070691_10031861 | 3300005341 | Bacteria | 2474 |
| 14 | Ga0070691_10587440 | 3300005341 | Bacteria | 656 |
| 15 | Ga0070687_100208408 | 3300005343 | Unclassified | 1189 |
| 16 | Ga0070661_100794294 | 3300005344 | Unclassified | 776 |
| 17 | Ga0070675_100266215 | 3300005354 | Bacteria | 1503 |
| 18 | Ga0070675_101599667 | 3300005354 | Bacteria | 601 |
| 19 | Ga0070671_100400417 | 3300005355 | Unclassified | 1174 |
| 20 | Ga0070671_100709168 | 3300005355 | Unclassified | 873 |
| 21 | Ga0070674_100184560 | 3300005356 | Bacteria | 1600 |
| 22 | Ga0070673_100231623 | 3300005364 | Bacteria | 1603 |
| 23 | Ga0070688_100083307 | 3300005365 | Bacteria | 2075 |
| 24 | Ga0070688_101161929 | 3300005365 | Bacteria | 619 |
| 25 | Ga0070659_100464585 | 3300005366 | Unclassified | 1075 |
| 26 | Ga0070703_10000230 | 3300005406 | Bacteria | 27012 |
| 27 | Ga0070703_10006711 | 3300005406 | Unclassified | 3225 |
| 28 | Ga0070703_10282840 | 3300005406 | Bacteria | 685 |
| 29 | Ga0070703_10616936 | 3300005406 | Bacteria | 502 |
| 30 | Ga0070709_10807829 | 3300005434 | Unclassified | 736 |
| 31 | Ga0070713_100490178 | 3300005436 | Bacteria | 1158 |
| 32 | Ga0070713_101203960 | 3300005436 | Bacteria | 733 |
| 33 | Ga0070701_10043208 | 3300005438 | Bacteria | 2304 |
| 34 | Ga0070701_10988496 | 3300005438 | Bacteria | 586 |
| 35 | Ga0070705_100035845 | 3300005440 | Bacteria | 2784 |
| 36 | Ga0070705_100219478 | 3300005440 | Bacteria | 1316 |
| 37 | Ga0070705_100257360 | 3300005440 | Bacteria | 1229 |
| 38 | Ga0070705_100913776 | 3300005440 | Unclassified | 707 |
| 39 | Ga0070705_101085048 | 3300005440 | Bacteria | 654 |
| 40 | Ga0070705_101390365 | 3300005440 | Unclassified | 585 |
| 41 | Ga0070700_100163385 | 3300005441 | Bacteria | 1535 |
| 42 | Ga0070694_100011445 | 3300005444 | Bacteria | 5494 |
| 43 | Ga0070694_100013517 | 3300005444 | Bacteria | 5098 |
| 44 | Ga0070694_100019602 | 3300005444 | Bacteria | 4303 |
| 45 | Ga0070694_100071888 | 3300005444 | Unclassified | 2385 |
| 46 | Ga0070694_100910146 | 3300005444 | Bacteria | 726 |
| 47 | Ga0070708_100005088 | 3300005445 | Bacteria | 10405 |
| 48 | Ga0070708_100008231 | 3300005445 | Bacteria | 8370 |
| 49 | Ga0070708_100020929 | 3300005445 | Bacteria | 5523 |
| 50 | Ga0070708_100045978 | 3300005445 | Bacteria | 3850 |
| 51 | Ga0070708_100088049 | 3300005445 | Bacteria | 2822 |
| 52 | Ga0070708_100316883 | 3300005445 | Bacteria | 1469 |
| 53 | Ga0070708_100557261 | 3300005445 | Bacteria | 1081 |
| 54 | Ga0070708_100657692 | 3300005445 | Unclassified | 987 |
| 55 | Ga0070708_101022635 | 3300005445 | Bacteria | 775 |
| 56 | Ga0070708_102033887 | 3300005445 | Bacteria | 532 |
| 57 | Ga0070678_100598486 | 3300005456 | Bacteria | 984 |
| 58 | Ga0070678_101964580 | 3300005456 | Bacteria | 553 |
| 59 | Ga0070662_100245297 | 3300005457 | Bacteria | 1438 |
| 60 | Ga0070681_10038394 | 3300005458 | Bacteria | 4801 |
| 61 | Ga0068867_100228489 | 3300005459 | Bacteria | 1503 |
| 62 | Ga0070706_100003964 | 3300005467 | Bacteria | 14418 |
| 63 | Ga0070706_100005843 | 3300005467 | Bacteria | 11673 |
| 64 | Ga0070706_100086419 | 3300005467 | Unclassified | 2906 |
| 65 | Ga0070706_100110911 | 3300005467 | Unclassified | 2553 |
| 66 | Ga0070706_100166188 | 3300005467 | Bacteria | 2060 |
| 67 | Ga0070706_100174314 | 3300005467 | Unclassified | 2008 |
| 68 | Ga0070706_100847532 | 3300005467 | Unclassified | 845 |
| 69 | Ga0070706_100968346 | 3300005467 | Bacteria | 785 |
| 70 | Ga0070706_101015547 | 3300005467 | Unclassified | 765 |
| 71 | Ga0070707_100039633 | 3300005468 | Bacteria | 4503 |
| 72 | Ga0070707_100062881 | 3300005468 | Unclassified | 3561 |
| 73 | Ga0070707_100079243 | 3300005468 | Bacteria | 3170 |
| 74 | Ga0070707_100109752 | 3300005468 | Unclassified | 2675 |
| 75 | Ga0070707_100218829 | 3300005468 | Bacteria | 1855 |
| 76 | Ga0070707_100712498 | 3300005468 | Bacteria | 966 |
| 77 | Ga0070707_100719969 | 3300005468 | Unclassified | 961 |
| 78 | Ga0070707_100851914 | 3300005468 | Bacteria | 875 |
| 79 | Ga0070707_101148564 | 3300005468 | Bacteria | 743 |
| 80 | Ga0070707_101315166 | 3300005468 | Unclassified | 689 |
| 81 | Ga0070707_101505653 | 3300005468 | Unclassified | 640 |
| 82 | Ga0070698_100000025 | 3300005471 | Bacteria | 101563 |
| 83 | Ga0070698_100019797 | 3300005471 | Bacteria | 7058 |
| 84 | Ga0070698_100020843 | 3300005471 | Bacteria | 6870 |
| 85 | Ga0070698_100049839 | 3300005471 | Unclassified | 4273 |
| 86 | Ga0070698_100159402 | 3300005471 | Bacteria | 2201 |
| 87 | Ga0070698_100207207 | 3300005471 | Bacteria | 1896 |
| 88 | Ga0070698_100225760 | 3300005471 | Bacteria | 1806 |
| 89 | Ga0070698_100542199 | 3300005471 | Unclassified | 1102 |
| 90 | Ga0070698_100738720 | 3300005471 | Bacteria | 927 |
| 91 | Ga0070698_101392850 | 3300005471 | Unclassified | 652 |
| 92 | Ga0070698_101952554 | 3300005471 | Bacteria | 540 |
| 93 | Ga0070699_100008464 | 3300005518 | Bacteria | 8911 |
| 94 | Ga0070699_100019885 | 3300005518 | Bacteria | 5788 |
| 95 | Ga0070699_100020840 | 3300005518 | Bacteria | 5653 |
| 96 | Ga0070699_100043530 | 3300005518 | Bacteria | 3885 |
| 97 | Ga0070699_100096038 | 3300005518 | Bacteria | 2596 |
| 98 | Ga0070699_100281956 | 3300005518 | Unclassified | 1488 |
| 99 | Ga0070699_100963748 | 3300005518 | Bacteria | 782 |
| 100 | Ga0070699_101084661 | 3300005518 | Bacteria | 734 |
| 101 | Ga0070699_102160615 | 3300005518 | Bacteria | 508 |
| 102 | Ga0070679_100004051 | 3300005530 | Bacteria | 13496 |
| 103 | Ga0070679_100116366 | 3300005530 | Bacteria | 2658 |
| 104 | Ga0070679_100718104 | 3300005530 | Bacteria | 942 |
| 105 | Ga0070679_101811335 | 3300005530 | Unclassified | 559 |
| 106 | Ga0070684_100000243 | 3300005535 | Bacteria | 37686 |
| 107 | Ga0070697_100006092 | 3300005536 | Bacteria | 9329 |
| 108 | Ga0070697_100015617 | 3300005536 | Bacteria | 5962 |
| 109 | Ga0070697_100029743 | 3300005536 | Unclassified | 4382 |
| 110 | Ga0070697_100061447 | 3300005536 | Bacteria | 3064 |
| 111 | Ga0070697_100073417 | 3300005536 | Bacteria | 2809 |
| 112 | Ga0070697_100103672 | 3300005536 | Unclassified | 2365 |
| 113 | Ga0070697_100249529 | 3300005536 | Bacteria | 1517 |
| 114 | Ga0070697_100264450 | 3300005536 | Bacteria | 1473 |
| 115 | Ga0070697_100468514 | 3300005536 | Unclassified | 1099 |
| 116 | Ga0070697_100688159 | 3300005536 | Unclassified | 902 |
| 117 | Ga0070686_100131230 | 3300005544 | Bacteria | 1733 |
| 118 | Ga0070695_100017169 | 3300005545 | Unclassified | 4388 |
| 119 | Ga0070695_100047463 | 3300005545 | Bacteria | 2743 |
| 120 | Ga0070695_100132138 | 3300005545 | Bacteria | 1721 |
| 121 | Ga0070695_100528074 | 3300005545 | Bacteria | 917 |
| 122 | Ga0070695_100960886 | 3300005545 | Unclassified | 693 |
| 123 | Ga0070696_100004243 | 3300005546 | Bacteria | 9556 |
| 124 | Ga0070696_100004674 | 3300005546 | Bacteria | 9147 |
| 125 | Ga0070696_100016063 | 3300005546 | Bacteria | 5035 |
| 126 | Ga0070696_100077285 | 3300005546 | Unclassified | 2352 |
| 127 | Ga0070696_100284976 | 3300005546 | Bacteria | 1261 |
| 128 | Ga0070696_100342402 | 3300005546 | Unclassified | 1156 |
| 129 | Ga0070693_100025481 | 3300005547 | Bacteria | 3184 |
| 130 | Ga0070693_101016727 | 3300005547 | Unclassified | 628 |
| 131 | Ga0070693_101134233 | 3300005547 | Bacteria | 598 |
| 132 | Ga0070704_100005113 | 3300005549 | Bacteria | 7624 |
| 133 | Ga0070704_100007606 | 3300005549 | Bacteria | 6456 |
| 134 | Ga0070704_100019184 | 3300005549 | Unclassified | 4390 |
| 135 | Ga0070704_100165209 | 3300005549 | Bacteria | 1754 |
| 136 | Ga0070704_100577683 | 3300005549 | Bacteria | 985 |
| 137 | Ga0070704_100922143 | 3300005549 | Unclassified | 787 |
| 138 | Ga0068854_100262139 | 3300005578 | Unclassified | 1384 |
| 139 | Ga0068856_100011791 | 3300005614 | Bacteria | 8473 |
| 140 | Ga0068856_100407099 | 3300005614 | Unclassified | 1380 |
| 141 | Ga0070702_100127794 | 3300005615 | Bacteria | 1601 |
| 142 | Ga0070702_100199685 | 3300005615 | Bacteria | 1323 |
| 143 | Ga0068859_100950470 | 3300005617 | Unclassified | 943 |
| 144 | Ga0068864_100393385 | 3300005618 | Unclassified | 1316 |
| 145 | Ga0068861_102656397 | 3300005719 | Bacteria | 505 |
| 146 | Ga0068863_102354467 | 3300005841 | Unclassified | 542 |
| 147 | Ga0068858_101400063 | 3300005842 | Unclassified | 689 |
| 148 | Ga0068858_102063033 | 3300005842 | Unclassified | 564 |
| 149 | Ga0081455_10103667 | 3300005937 | Bacteria | 2277 |
| 150 | Ga0081455_10457626 | 3300005937 | Bacteria | 870 |
| 151 | Ga0081455_10708394 | 3300005937 | Unclassified | 641 |
| 152 | Ga0081539_10121156 | 3300005985 | Bacteria | 1299 |
| 153 | Ga0070717_10320257 | 3300006028 | Unclassified | 1381 |
| 154 | Ga0070717_10836023 | 3300006028 | Bacteria | 838 |
| 155 | Ga0075363_100758437 | 3300006048 | Bacteria | 588 |
| 156 | Ga0070715_10734436 | 3300006163 | Unclassified | 593 |
| 157 | Ga0070716_100422808 | 3300006173 | Bacteria | 964 |
| 158 | Ga0070716_100473010 | 3300006173 | Bacteria | 918 |
| 159 | Ga0070712_100152461 | 3300006175 | Bacteria | 1776 |
| 160 | Ga0070712_100247350 | 3300006175 | Unclassified | 1423 |
| 161 | Ga0068871_100119122 | 3300006358 | Unclassified | 2228 |
| 162 | Ga0075428_100013124 | 3300006844 | Bacteria | 9215 |
| 163 | Ga0075428_100080558 | 3300006844 | Bacteria | 3553 |
| 164 | Ga0075428_101829466 | 3300006844 | Bacteria | 632 |
| 165 | Ga0075428_101886126 | 3300006844 | Bacteria | 621 |
| 166 | Ga0075428_102467147 | 3300006844 | Unclassified | 533 |
| 167 | Ga0075430_100071797 | 3300006846 | Bacteria | 2904 |
| 168 | Ga0075430_100261163 | 3300006846 | Unclassified | 1434 |
| 169 | Ga0075431_100992218 | 3300006847 | Bacteria | 807 |
| 170 | Ga0075431_101111585 | 3300006847 | Bacteria | 755 |
| 171 | Ga0075431_101552248 | 3300006847 | Bacteria | 620 |
| 172 | Ga0075431_101671457 | 3300006847 | Unclassified | 594 |
| 173 | Ga0075433_10013586 | 3300006852 | Bacteria | 6628 |
| 174 | Ga0075433_10024662 | 3300006852 | Bacteria | 5079 |
| 175 | Ga0075433_10025253 | 3300006852 | Bacteria | 5021 |
| 176 | Ga0075433_10085645 | 3300006852 | Bacteria | 2782 |
| 177 | Ga0075433_10161375 | 3300006852 | Unclassified | 1995 |
| 178 | Ga0075433_11817977 | 3300006852 | Bacteria | 523 |
| 179 | Ga0075434_100008712 | 3300006871 | Bacteria | 9439 |
| 180 | Ga0075434_100034322 | 3300006871 | Bacteria | 5009 |
| 181 | Ga0075434_100127360 | 3300006871 | Unclassified | 2563 |
| 182 | Ga0075434_100128594 | 3300006871 | Bacteria | 2551 |
| 183 | Ga0075434_100983181 | 3300006871 | Bacteria | 858 |
| 184 | Ga0075434_101676893 | 3300006871 | Bacteria | 644 |
| 185 | Ga0075429_101442844 | 3300006880 | Bacteria | 599 |
| 186 | Ga0075436_100035772 | 3300006914 | Unclassified | 3425 |
| 187 | Ga0075436_100046644 | 3300006914 | Bacteria | 2988 |
| 188 | Ga0075436_100162058 | 3300006914 | Bacteria | 1577 |
| 189 | Ga0075436_100366140 | 3300006914 | Unclassified | 1041 |
| 190 | Ga0097620_100950399 | 3300006931 | Unclassified | 943 |
| 191 | Ga0075435_100069048 | 3300007076 | Bacteria | 2880 |
| 192 | Ga0075435_100080524 | 3300007076 | Bacteria | 2674 |
| 193 | Ga0075435_100159717 | 3300007076 | Bacteria | 1898 |
| 194 | Ga0075435_100700258 | 3300007076 | Bacteria | 880 |
| 195 | Ga0075435_100842438 | 3300007076 | Bacteria | 799 |
| 196 | Ga0075435_101133736 | 3300007076 | Bacteria | 684 |
| 197 | Ga0075435_101877306 | 3300007076 | Unclassified | 526 |
| 198 | Ga0099794_10000015 | 3300007265 | Bacteria | 80127 |
| 199 | Ga0099794_10034076 | 3300007265 | Bacteria | 2397 |
| 200 | Ga0099794_10147325 | 3300007265 | Bacteria | 1194 |
| 201 | Ga0099794_10294923 | 3300007265 | Bacteria | 839 |
| 202 | Ga0099794_10328951 | 3300007265 | Unclassified | 793 |
| 203 | Ga0111539_10003768 | 3300009094 | Bacteria | 19955 |
| 204 | Ga0111539_10815606 | 3300009094 | Bacteria | 1086 |
| 205 | Ga0111539_11445465 | 3300009094 | Bacteria | 797 |
| 206 | Ga0111539_11930097 | 3300009094 | Bacteria | 685 |
| 207 | Ga0111539_12316876 | 3300009094 | Bacteria | 623 |
| 208 | Ga0111539_12981176 | 3300009094 | Bacteria | 547 |
| 209 | Ga0105245_10009810 | 3300009098 | Bacteria | 8343 |
| 210 | Ga0105245_10071777 | 3300009098 | Bacteria | 3145 |
| 211 | Ga0105245_10767101 | 3300009098 | Bacteria | 1001 |
| 212 | Ga0105245_11387882 | 3300009098 | Bacteria | 752 |
| 213 | Ga0114129_10079878 | 3300009147 | Bacteria | 4547 |
| 214 | Ga0114129_10283949 | 3300009147 | Unclassified | 2211 |
| 215 | Ga0114129_10458309 | 3300009147 | Bacteria | 1671 |
| 216 | Ga0114129_11417072 | 3300009147 | Unclassified | 857 |
| 217 | Ga0114129_11954517 | 3300009147 | Bacteria | 710 |
| 218 | Ga0114129_12095532 | 3300009147 | Unclassified | 682 |
| 219 | Ga0105243_10984521 | 3300009148 | Bacteria | 845 |
| 220 | Ga0105243_11015160 | 3300009148 | Unclassified | 833 |
| 221 | Ga0105243_11145917 | 3300009148 | Bacteria | 788 |
| 222 | Ga0105241_10084371 | 3300009174 | Bacteria | 2494 |
| 223 | Ga0105241_10954610 | 3300009174 | Bacteria | 799 |
| 224 | Ga0105242_10358132 | 3300009176 | Unclassified | 1349 |
| 225 | Ga0105242_10661461 | 3300009176 | Unclassified | 1017 |
| 226 | Ga0105248_10472944 | 3300009177 | Unclassified | 1413 |
| 227 | Ga0105248_12821590 | 3300009177 | Bacteria | 554 |
| 228 | Ga0105248_13028458 | 3300009177 | Unclassified | 535 |
| 229 | Ga0105237_11774577 | 3300009545 | Bacteria | 625 |
| 230 | Ga0105238_10766842 | 3300009551 | Unclassified | 979 |
| 231 | Ga0105249_10906967 | 3300009553 | Bacteria | 948 |
| 232 | Ga0105249_12176558 | 3300009553 | Unclassified | 627 |
| 233 | Ga0105239_10241240 | 3300010375 | Bacteria | 2028 |
| 234 | Ga0105239_11966633 | 3300010375 | Bacteria | 678 |
| 235 | Ga0105239_12694419 | 3300010375 | Unclassified | 580 |
| 236 | Ga0105246_10029552 | 3300011119 | Bacteria | 3611 |
| 237 | Ga0105246_10257883 | 3300011119 | Bacteria | 1387 |
| 238 | Ga0105246_10594871 | 3300011119 | Unclassified | 955 |
| 239 | Ga0157369_10443746 | 3300013105 | Bacteria | 1344 |
| 240 | Ga0157378_10718045 | 3300013297 | Bacteria | 1020 |
| 241 | Ga0163162_12659019 | 3300013306 | Bacteria | 576 |
| 242 | Ga0157375_10105228 | 3300013308 | Unclassified | 2912 |
| 243 | Ga0157375_10164295 | 3300013308 | Bacteria | 2364 |
| 244 | Ga0157375_13607894 | 3300013308 | Bacteria | 515 |
| 245 | Ga0163163_10095181 | 3300014325 | Bacteria | 2998 |
| 246 | Ga0163163_10600349 | 3300014325 | Bacteria | 1164 |
| 247 | Ga0163163_11474087 | 3300014325 | Bacteria | 742 |
| 248 | Ga0163163_12190301 | 3300014325 | Unclassified | 612 |
| 249 | Ga0157380_13435598 | 3300014326 | Unclassified | 507 |
| 250 | Ga0157380_13494310 | 3300014326 | Bacteria | 503 |
| 251 | Ga0157379_11130342 | 3300014968 | Unclassified | 751 |
| 252 | Ga0157379_11298508 | 3300014968 | Unclassified | 703 |
| 253 | Ga0157379_11956218 | 3300014968 | Unclassified | 579 |
| 254 | Ga0157376_10160230 | 3300014969 | Bacteria | 2039 |
| 255 | Ga0157376_11223376 | 3300014969 | Unclassified | 780 |
| 256 | Ga0207653_10000005 | 3300025885 | Bacteria | 257928 |
| 257 | Ga0207653_10028555 | 3300025885 | Bacteria | 1795 |
| 258 | Ga0207653_10102607 | 3300025885 | Unclassified | 1013 |
| 259 | Ga0207653_10106470 | 3300025885 | Bacteria | 997 |
| 260 | Ga0207692_11052409 | 3300025898 | Bacteria | 538 |
| 261 | Ga0207688_10785303 | 3300025901 | Bacteria | 603 |
| 262 | Ga0207680_11248800 | 3300025903 | Bacteria | 529 |
| 263 | Ga0207685_10205209 | 3300025905 | Bacteria | 928 |
| 264 | Ga0207699_10298287 | 3300025906 | Unclassified | 1125 |
| 265 | Ga0207643_10500119 | 3300025908 | Unclassified | 777 |
| 266 | Ga0207684_10006714 | 3300025910 | Bacteria | 10449 |
| 267 | Ga0207684_10070974 | 3300025910 | Bacteria | 2960 |
| 268 | Ga0207684_10210605 | 3300025910 | Bacteria | 1677 |
| 269 | Ga0207684_10289954 | 3300025910 | Bacteria | 1411 |
| 270 | Ga0207684_10296808 | 3300025910 | Bacteria | 1393 |
| 271 | Ga0207684_10345759 | 3300025910 | Bacteria | 1281 |
| 272 | Ga0207684_10998306 | 3300025910 | Bacteria | 700 |
| 273 | Ga0207684_11184141 | 3300025910 | Unclassified | 633 |
| 274 | Ga0207684_11699924 | 3300025910 | Bacteria | 509 |
| 275 | Ga0207654_10056739 | 3300025911 | Bacteria | 2273 |
| 276 | Ga0207707_10006530 | 3300025912 | Bacteria | 10179 |
| 277 | Ga0207707_10308722 | 3300025912 | Unclassified | 1367 |
| 278 | Ga0207693_10022570 | 3300025915 | Bacteria | 5000 |
| 279 | Ga0207693_10153282 | 3300025915 | Bacteria | 1813 |
| 280 | Ga0207663_11201733 | 3300025916 | Bacteria | 610 |
| 281 | Ga0207663_11617675 | 3300025916 | Unclassified | 521 |
| 282 | Ga0207660_10006097 | 3300025917 | Bacteria | 7825 |
| 283 | Ga0207660_10024169 | 3300025917 | Bacteria | 4110 |
| 284 | Ga0207662_10369265 | 3300025918 | Bacteria | 967 |
| 285 | Ga0207662_10676458 | 3300025918 | Bacteria | 722 |
| 286 | Ga0207657_10285498 | 3300025919 | Bacteria | 1309 |
| 287 | Ga0207649_10717174 | 3300025920 | Unclassified | 776 |
| 288 | Ga0207652_10000845 | 3300025921 | Bacteria | 29187 |
| 289 | Ga0207652_10556089 | 3300025921 | Bacteria | 1031 |
| 290 | Ga0207646_10003801 | 3300025922 | Bacteria | 16795 |
| 291 | Ga0207646_10103820 | 3300025922 | Unclassified | 2549 |
| 292 | Ga0207646_10123499 | 3300025922 | Bacteria | 2327 |
| 293 | Ga0207646_10492587 | 3300025922 | Bacteria | 1105 |
| 294 | Ga0207646_10922219 | 3300025922 | Unclassified | 774 |
| 295 | Ga0207646_10935952 | 3300025922 | Unclassified | 768 |
| 296 | Ga0207694_10558789 | 3300025924 | Unclassified | 961 |
| 297 | Ga0207659_11347255 | 3300025926 | Bacteria | 612 |
| 298 | Ga0207659_11391714 | 3300025926 | Bacteria | 601 |
| 299 | Ga0207687_10005539 | 3300025927 | Bacteria | 8348 |
| 300 | Ga0207687_10411648 | 3300025927 | Bacteria | 1114 |
| 301 | Ga0207687_10430148 | 3300025927 | Unclassified | 1091 |
| 302 | Ga0207700_10923450 | 3300025928 | Unclassified | 781 |
| 303 | Ga0207664_10226094 | 3300025929 | Bacteria | 1625 |
| 304 | Ga0207664_11401594 | 3300025929 | Bacteria | 620 |
| 305 | Ga0207706_10261667 | 3300025933 | Bacteria | 1510 |
| 306 | Ga0207686_10302311 | 3300025934 | Bacteria | 1189 |
| 307 | Ga0207709_10297652 | 3300025935 | Bacteria | 1198 |
| 308 | Ga0207709_10585861 | 3300025935 | Bacteria | 881 |
| 309 | Ga0207709_10906180 | 3300025935 | Bacteria | 717 |
| 310 | Ga0207670_10363001 | 3300025936 | Bacteria | 1150 |
| 311 | Ga0207669_10299248 | 3300025937 | Bacteria | 1222 |
| 312 | Ga0207704_10371066 | 3300025938 | Bacteria | 1120 |
| 313 | Ga0207665_10404772 | 3300025939 | Unclassified | 1040 |
| 314 | Ga0207665_11000300 | 3300025939 | Bacteria | 665 |
| 315 | Ga0207665_11069280 | 3300025939 | Bacteria | 643 |
| 316 | Ga0207711_10096448 | 3300025941 | Bacteria | 2610 |
| 317 | Ga0207711_11415065 | 3300025941 | Bacteria | 638 |
| 318 | Ga0207711_11460219 | 3300025941 | Bacteria | 627 |
| 319 | Ga0207689_10108260 | 3300025942 | Bacteria | 2284 |
| 320 | Ga0207661_10012284 | 3300025944 | Bacteria | 6220 |
| 321 | Ga0207661_11214390 | 3300025944 | Bacteria | 694 |
| 322 | Ga0207679_11769482 | 3300025945 | Unclassified | 565 |
| 323 | Ga0207651_10690479 | 3300025960 | Bacteria | 899 |
| 324 | Ga0207640_10303552 | 3300025981 | Unclassified | 1264 |
| 325 | Ga0207640_10812244 | 3300025981 | Bacteria | 811 |
| 326 | Ga0207658_11480613 | 3300025986 | Unclassified | 621 |
| 327 | Ga0207703_11537163 | 3300026035 | Unclassified | 640 |
| 328 | Ga0207678_10738929 | 3300026067 | Unclassified | 867 |
| 329 | Ga0207708_10180247 | 3300026075 | Bacteria | 1677 |
| 330 | Ga0207708_10292668 | 3300026075 | Bacteria | 1322 |
| 331 | Ga0207702_10004111 | 3300026078 | Bacteria | 13059 |
| 332 | Ga0207702_10039417 | 3300026078 | Bacteria | 3958 |
| 333 | Ga0207641_11002768 | 3300026088 | Unclassified | 832 |
| 334 | Ga0207648_10271930 | 3300026089 | Bacteria | 1514 |
| 335 | Ga0207648_12041901 | 3300026089 | Unclassified | 534 |
| 336 | Ga0207676_10376496 | 3300026095 | Unclassified | 1320 |
| 337 | Ga0207683_10021748 | 3300026121 | Bacteria | 5498 |
| 338 | Ga0207683_10038254 | 3300026121 | Bacteria | 4180 |
| 339 | Ga0207683_10411037 | 3300026121 | Bacteria | 1245 |
| 340 | Ga0209969_1081550 | 3300027360 | Bacteria | 518 |
| 341 | Ga0209588_1000541 | 3300027671 | Bacteria | 9704 |
| 342 | Ga0207428_10008584 | 3300027907 | Bacteria | 9220 |
| 343 | Ga0268264_12679282 | 3300028381 | Bacteria | 502 |
| 344 | Ga0307409_101287572 | 3300031995 | Bacteria | 756 |
| 345 | Ga0307416_100522742 | 3300032002 | Bacteria | 1255 |
| 346 | Ga0307416_102783925 | 3300032002 | Unclassified | 585 |
| 347 | Ga0373928_0105625 | 3300035084 | Bacteria | 740 |
| 348 | Ga0373943_0017137 | 3300035170 | Bacteria | 3314 |
| 349 | Ga0373955_0510819 | 3300035172 | Bacteria | 734 |
| 350 | Ga0373961_0253442 | 3300035241 | Bacteria | 638 |
| 351 | Ga0373935_0944122 | 3300035692 | Bacteria | 640 |
| 352 | Ga0373937_0131903 | 3300036401 | Bacteria | 2334 |
| 353 | Ga0373925_0733032 | 3300037068 | Bacteria | 815 |
| 354 | Ga0395899_0082996 | 3300037312 | Bacteria | 2330 |
| 355 | Ga0395899_0328334 | 3300037312 | Bacteria | 1029 |
| 356 | Ga0395900_0002502 | 3300037418 | Bacteria | 20199 |
| 357 | Ga0395900_0007559 | 3300037418 | Bacteria | 11224 |
| 358 | Ga0395900_0054551 | 3300037418 | Bacteria | 4115 |
| 359 | Ga0395900_0106678 | 3300037418 | Bacteria | 2878 |
| 360 | Ga0395900_0190094 | 3300037418 | Bacteria | 2083 |
| 361 | Ga0395900_0319263 | 3300037418 | Bacteria | 1534 |
| 362 | Ga0395900_0349974 | 3300037418 | Bacteria | 1451 |
| 363 | Ga0395900_0690220 | 3300037418 | Unclassified | 955 |
| 364 | Ga0395900_1141513 | 3300037418 | Bacteria | 696 |
| 365 | Ga0395900_1385031 | 3300037418 | Bacteria | 616 |
| 366 | Ga0395900_1526688 | 3300037418 | Unclassified | 580 |
| 367 | Ga0395900_1625396 | 3300037418 | Bacteria | 557 |
| 368 | Ga0395898_0002628 | 3300037466 | Bacteria | 20892 |
| 369 | Ga0395898_0010897 | 3300037466 | Bacteria | 9488 |
| 370 | Ga0395898_0080159 | 3300037466 | Bacteria | 3149 |
| 371 | Ga0395898_0085001 | 3300037466 | Bacteria | 3050 |
| 372 | Ga0395898_0803160 | 3300037466 | Bacteria | 881 |
| 373 | Ga0395898_1065708 | 3300037466 | Bacteria | 742 |
| 374 | Ga0395905_0003689 | 3300037471 | Bacteria | 16209 |
| 375 | Ga0395905_0009707 | 3300037471 | Bacteria | 9391 |
| 376 | Ga0395905_0230212 | 3300037471 | Bacteria | 1733 |
| 377 | Ga0395905_0603199 | 3300037471 | Bacteria | 1000 |
| 378 | Ga0395905_1201863 | 3300037471 | Bacteria | 662 |
| 379 | Ga0395905_1355168 | 3300037471 | Bacteria | 615 |
| 380 | Ga0395905_1500074 | 3300037471 | Unclassified | 578 |
| 381 | Ga0395901_0002394 | 3300038443 | Bacteria | 19063 |
| 382 | Ga0395901_0004101 | 3300038443 | Bacteria | 14687 |
| 383 | Ga0395901_0006554 | 3300038443 | Bacteria | 11774 |
| 384 | Ga0395901_0045980 | 3300038443 | Bacteria | 4533 |
| 385 | Ga0395901_0072123 | 3300038443 | Bacteria | 3599 |
| 386 | Ga0395901_0168446 | 3300038443 | Bacteria | 2299 |
| 387 | Ga0395901_0180702 | 3300038443 | Bacteria | 2213 |
| 388 | Ga0395901_0268214 | 3300038443 | Bacteria | 1776 |
| 389 | Ga0395901_0375935 | 3300038443 | Bacteria | 1463 |
| 390 | Ga0395901_0472974 | 3300038443 | Bacteria | 1279 |
| 391 | Ga0395901_0916986 | 3300038443 | Bacteria | 857 |
| 392 | Ga0395901_1273188 | 3300038443 | Bacteria | 698 |
| 393 | Ga0451800_0340282 | 3300041459 | Unclassified | 699 |
| 394 | Ga0451807_2148327 | 3300041486 | Archaea | 684 |
| 395 | Ga0451847_0679139 | 3300041503 | Unclassified | 766 |
| 396 | Ga0439434_0056352 | 3300042435 | Bacteria | 1224 |
| 397 | Ga0450918_118375 | 3300042531 | Bacteria | 528 |
| 398 | Ga0451577_0124184 | 3300042876 | Bacteria | 2313 |
| 399 | Ga0453683_0126904 | 3300044673 | Bacteria | 1607 |
| 400 | Ga0453683_0674982 | 3300044673 | Bacteria | 676 |
| 401 | Ga0466960_0055360 | 3300044901 | Bacteria | 1929 |
| 402 | Ga0451576_0007821 | 3300045051 | Bacteria | 12667 |
| 403 | Ga0451576_0021937 | 3300045051 | Bacteria | 6932 |
| 404 | Ga0451576_0171764 | 3300045051 | Bacteria | 2262 |
| 405 | Ga0451576_0254993 | 3300045051 | Bacteria | 1833 |
| 406 | Ga0451576_0388183 | 3300045051 | Bacteria | 1463 |
| 407 | Ga0451576_1185185 | 3300045051 | Unclassified | 798 |
| 408 | Ga0466967_2355488 | 3300045976 | Unclassified | 528 |
| 409 | Ga0495592_0148827 | 3300046454 | Bacteria | 1621 |
| 410 | Ga0495603_0022075 | 3300046455 | Bacteria | 3854 |
| 411 | Ga0495603_0023420 | 3300046455 | Bacteria | 3737 |
| 412 | Ga0495590_0190284 | 3300046457 | Unclassified | 752 |
| 413 | Ga0495629_1026746 | 3300046459 | Unclassified | 536 |
| 414 | Ga0495641_0143644 | 3300046461 | Bacteria | 1066 |
| 415 | Ga0495582_0006708 | 3300046473 | Bacteria | 6397 |
| 416 | Ga0495662_0132691 | 3300046476 | Bacteria | 1225 |
| 417 | Ga0495662_0258697 | 3300046476 | Unclassified | 857 |
| 418 | Ga0495664_0328062 | 3300046477 | Bacteria | 923 |
| 419 | Ga0495584_0154635 | 3300046491 | Bacteria | 1165 |
| 420 | Ga0495584_0174388 | 3300046491 | Bacteria | 1093 |
| 421 | Ga0495585_0045528 | 3300046492 | Bacteria | 2449 |
| 422 | Ga0495585_0107592 | 3300046492 | Unclassified | 1486 |
| 423 | Ga0495585_0269715 | 3300046492 | Bacteria | 844 |
| 424 | Ga0495594_0328344 | 3300046499 | Bacteria | 871 |
| 425 | Ga0495596_0045763 | 3300046500 | Bacteria | 1720 |
| 426 | Ga0495596_0056931 | 3300046500 | Bacteria | 1526 |
| 427 | Ga0495596_0320552 | 3300046500 | Unclassified | 603 |
| 428 | Ga0495607_0352443 | 3300046501 | Bacteria | 679 |
| 429 | Ga0495583_0433564 | 3300046506 | Unclassified | 515 |
| 430 | Ga0495616_0058094 | 3300046513 | Bacteria | 1906 |
| 431 | Ga0495620_0328356 | 3300046515 | Unclassified | 581 |
| 432 | Ga0495630_1047277 | 3300046517 | Bacteria | 619 |
| 433 | Ga0495631_0198554 | 3300046518 | Unclassified | 858 |
| 434 | Ga0495631_0492486 | 3300046518 | Unclassified | 522 |
| 435 | Ga0495632_0459512 | 3300046519 | Unclassified | 552 |
| 436 | Ga0495644_0238090 | 3300046523 | Bacteria | 706 |
| 437 | Ga0495644_0252724 | 3300046523 | Bacteria | 685 |
| 438 | Ga0495644_0253504 | 3300046523 | Bacteria | 684 |
| 439 | Ga0495663_0199456 | 3300046525 | Bacteria | 698 |
| 440 | Ga0495663_0257776 | 3300046525 | Unclassified | 621 |
| 441 | Ga0495663_0318694 | 3300046525 | Bacteria | 562 |
| 442 | Ga0495666_0546582 | 3300046526 | Unclassified | 517 |
| 443 | Ga0495642_0168473 | 3300046528 | Bacteria | 951 |
| 444 | Ga0495642_0252638 | 3300046528 | Unclassified | 771 |
| 445 | Ga0495642_0310421 | 3300046528 | Unclassified | 691 |
| 446 | Ga0495654_0447067 | 3300046530 | Bacteria | 509 |
| 447 | Ga0495598_0240938 | 3300046537 | Bacteria | 667 |
| 448 | Ga0495598_0325336 | 3300046537 | Bacteria | 587 |
| 449 | Ga0495598_0399533 | 3300046537 | Bacteria | 537 |
| 450 | Ga0495609_0041283 | 3300046538 | Bacteria | 2074 |
| 451 | Ga0495609_0088616 | 3300046538 | Bacteria | 1347 |
| 452 | Ga0495609_0149601 | 3300046538 | Bacteria | 993 |
| 453 | Ga0495609_0411243 | 3300046538 | Unclassified | 541 |
| 454 | Ga0495621_0097724 | 3300046539 | Bacteria | 1114 |
| 455 | Ga0495621_0267062 | 3300046539 | Bacteria | 702 |
| 456 | Ga0495621_0443997 | 3300046539 | Unclassified | 555 |
| 457 | Ga0495656_0018342 | 3300046615 | Bacteria | 2685 |
| 458 | Ga0495656_0067423 | 3300046615 | Bacteria | 1579 |
| 459 | Ga0495656_0421503 | 3300046615 | Unclassified | 700 |
| 460 | Ga0495656_0450541 | 3300046615 | Bacteria | 678 |
| 461 | Ga0495656_0713830 | 3300046615 | Bacteria | 540 |
| 462 | Ga0495656_0718572 | 3300046615 | Bacteria | 538 |
| 463 | Ga0495656_0747585 | 3300046615 | Unclassified | 527 |
| 464 | Ga0495668_0182064 | 3300046616 | Bacteria | 1151 |
| 465 | Ga0495634_0031690 | 3300046642 | Unclassified | 3640 |
| 466 | Ga0495611_0313812 | 3300046648 | Bacteria | 722 |
| 467 | Ga0495659_0011492 | 3300046664 | Bacteria | 2853 |
| 468 | Ga0495659_0053957 | 3300046664 | Bacteria | 1470 |
| 469 | Ga0495659_0183192 | 3300046664 | Unclassified | 853 |
| 470 | Ga0495659_0247391 | 3300046664 | Unclassified | 742 |
| 471 | Ga0495659_0406105 | 3300046664 | Unclassified | 588 |
| 472 | Ga0495661_0616459 | 3300046665 | Unclassified | 509 |
| 473 | Ga0495588_0461615 | 3300046674 | Bacteria | 666 |
| 474 | Ga0495588_0764302 | 3300046674 | Bacteria | 505 |
| 475 | Ga0495647_0012783 | 3300046681 | Bacteria | 2896 |
| 476 | Ga0495647_0029246 | 3300046681 | Bacteria | 2037 |
| 477 | Ga0495647_0040215 | 3300046681 | Bacteria | 1776 |
| 478 | Ga0495658_0128999 | 3300046683 | Bacteria | 1537 |
| 479 | Ga0495669_0269357 | 3300046684 | Bacteria | 819 |
| 480 | Ga0495669_0391630 | 3300046684 | Bacteria | 673 |
| 481 | Ga0495669_0488314 | 3300046684 | Bacteria | 599 |
| 482 | Ga0495613_0029171 | 3300046689 | Bacteria | 4103 |
| 483 | Ga0495613_0979522 | 3300046689 | Bacteria | 544 |
| 484 | Ga0495670_0109282 | 3300046691 | Bacteria | 1430 |
| 485 | Ga0495670_0262500 | 3300046691 | Bacteria | 922 |
| 486 | Ga0495671_0388972 | 3300046692 | Unclassified | 668 |
| 487 | Ga0495671_0442060 | 3300046692 | Unclassified | 622 |
| 488 | Ga0495589_0051100 | 3300046794 | Bacteria | 2044 |
| 489 | Ga0495589_0195575 | 3300046794 | Bacteria | 956 |
| 490 | Ga0495589_0266345 | 3300046794 | Bacteria | 798 |
| 491 | Ga0495581_0031266 | 3300047315 | Bacteria | 3085 |
| 492 | Ga0495581_0279134 | 3300047315 | Bacteria | 977 |
| 493 | Ga0495636_0124205 | 3300047318 | Bacteria | 1144 |
| 494 | Ga0495636_0522878 | 3300047318 | Unclassified | 575 |
| 495 | Ga0495674_0104981 | 3300047319 | Bacteria | 2402 |
| 496 | Ga0495676_0050600 | 3300047321 | Bacteria | 3331 |
| 497 | Ga0495676_0854551 | 3300047321 | Bacteria | 584 |
| 498 | Ga0495680_0062751 | 3300047322 | Bacteria | 2856 |
| 499 | Ga0495680_0549498 | 3300047322 | Bacteria | 778 |
| 500 | Ga0495677_0012583 | 3300047445 | Bacteria | 3085 |
| 501 | Ga0495679_096074 | 3300047446 | Bacteria | 827 |
| 502 | Ga0495685_045421 | 3300047447 | Bacteria | 1496 |
| 503 | Ga0495684_0398349 | 3300047471 | Bacteria | 967 |
| 504 | Ga0495684_0795282 | 3300047471 | Unclassified | 618 |
| 505 | Ga0496100_0003614 | 3300048903 | Bacteria | 8074 |
| 506 | Ga0496100_0690034 | 3300048903 | Unclassified | 796 |
| 507 | Ga0496101_0000920 | 3300048904 | Bacteria | 17369 |
| 508 | Ga0496101_0059236 | 3300048904 | Bacteria | 2775 |
| 509 | Ga0496101_0167052 | 3300048904 | Bacteria | 1690 |
| 510 | Ga0496101_0244398 | 3300048904 | Bacteria | 1397 |
| 511 | Ga0496101_0366175 | 3300048904 | Unclassified | 1133 |
| 512 | Ga0496101_1180051 | 3300048904 | Unclassified | 600 |
| 513 | Ga0496102_0011412 | 3300048905 | Bacteria | 7658 |
| 514 | Ga0496102_0029921 | 3300048905 | Bacteria | 4873 |
| 515 | Ga0496102_1903175 | 3300048905 | Unclassified | 511 |
| 516 | Ga0496103_0002423 | 3300048906 | Bacteria | 11733 |
| 517 | Ga0496103_0149915 | 3300048906 | Bacteria | 1494 |
| 518 | Ga0496103_0200375 | 3300048906 | Bacteria | 1284 |
| 519 | Ga0496103_0431120 | 3300048906 | Unclassified | 846 |
| 520 | Ga0496104_0000283 | 3300048907 | Bacteria | 44806 |
| 521 | Ga0496104_0003705 | 3300048907 | Bacteria | 13190 |
| 522 | Ga0496104_0005790 | 3300048907 | Bacteria | 10819 |
| 523 | Ga0496104_0158250 | 3300048907 | Unclassified | 2174 |
| 524 | Ga0496104_0469699 | 3300048907 | Bacteria | 1169 |
| 525 | Ga0496104_0504740 | 3300048907 | Bacteria | 1121 |
| 526 | Ga0496104_0966619 | 3300048907 | Unclassified | 756 |
| 527 | Ga0496104_0999806 | 3300048907 | Bacteria | 740 |
| 528 | Ga0496105_0000464 | 3300048908 | Bacteria | 26670 |
| 529 | Ga0496105_0005049 | 3300048908 | Bacteria | 9996 |
| 530 | Ga0496105_0007098 | 3300048908 | Bacteria | 8639 |
| 531 | Ga0496105_0051963 | 3300048908 | Bacteria | 3384 |
| 532 | Ga0496105_0113912 | 3300048908 | Bacteria | 2231 |
| 533 | Ga0496105_0488772 | 3300048908 | Bacteria | 968 |
| 534 | Ga0496106_0867408 | 3300048909 | Bacteria | 714 |
| 535 | Ga0496106_1027429 | 3300048909 | Bacteria | 648 |
| 536 | Ga0496106_1313565 | 3300048909 | Unclassified | 561 |
| 537 | Ga0496106_1391882 | 3300048909 | Bacteria | 542 |
| 538 | Ga0496107_0205150 | 3300048910 | Bacteria | 1465 |
| 539 | Ga0496107_0334703 | 3300048910 | Bacteria | 1126 |
| 540 | Ga0496107_0352965 | 3300048910 | Unclassified | 1094 |
| 541 | Ga0496107_1241237 | 3300048910 | Bacteria | 535 |
| 542 | Ga0496107_1382488 | 3300048910 | Bacteria | 502 |
| 543 | Ga0496108_0004985 | 3300048911 | Bacteria | 10731 |
| 544 | Ga0496108_0019487 | 3300048911 | Bacteria | 5572 |
| 545 | Ga0496108_0037303 | 3300048911 | Bacteria | 4047 |
| 546 | Ga0496108_0165263 | 3300048911 | Bacteria | 1913 |
| 547 | Ga0496108_0378438 | 3300048911 | Unclassified | 1236 |
| 548 | Ga0496108_1561120 | 3300048911 | Bacteria | 547 |
| 549 | Ga0496109_0000801 | 3300048912 | Bacteria | 26213 |
| 550 | Ga0496109_0001949 | 3300048912 | Bacteria | 17135 |
| 551 | Ga0496109_0003556 | 3300048912 | Bacteria | 13009 |
| 552 | Ga0496109_0251621 | 3300048912 | Archaea | 1664 |
| 553 | Ga0496109_0392230 | 3300048912 | Bacteria | 1312 |
| 554 | Ga0496109_0396562 | 3300048912 | Unclassified | 1304 |
| 555 | Ga0496109_0421995 | 3300048912 | Bacteria | 1260 |
| 556 | Ga0496109_0584091 | 3300048912 | Bacteria | 1053 |
| 557 | Ga0496109_1535064 | 3300048912 | Bacteria | 601 |
| 558 | Ga0496110_0000198 | 3300048913 | Bacteria | 38202 |
| 559 | Ga0496110_0068801 | 3300048913 | Unclassified | 3134 |
| 560 | Ga0496110_0351886 | 3300048913 | Bacteria | 1342 |
| 561 | Ga0496110_0421278 | 3300048913 | Unclassified | 1217 |
| 562 | Ga0496110_0490942 | 3300048913 | Unclassified | 1118 |
| 563 | Ga0496110_0508389 | 3300048913 | Bacteria | 1096 |
| 564 | Ga0496110_0616117 | 3300048913 | Bacteria | 984 |
| 565 | Ga0496110_1354434 | 3300048913 | Bacteria | 621 |
| 566 | Ga0496111_0003476 | 3300048914 | Bacteria | 9749 |
| 567 | Ga0496111_0015827 | 3300048914 | Bacteria | 5187 |
| 568 | Ga0496111_0040418 | 3300048914 | Unclassified | 3345 |
| 569 | Ga0496111_0049673 | 3300048914 | Bacteria | 3025 |
| 570 | Ga0496111_0062414 | 3300048914 | Bacteria | 2702 |
| 571 | Ga0496111_0237748 | 3300048914 | Bacteria | 1353 |
| 572 | Ga0496111_0367977 | 3300048914 | Bacteria | 1064 |
| 573 | Ga0496111_1229208 | 3300048914 | Unclassified | 530 |
| 574 | Ga0496112_0018974 | 3300048915 | Bacteria | 6483 |
| 575 | Ga0496112_0272506 | 3300048915 | Unclassified | 1641 |
| 576 | Ga0496112_0363410 | 3300048915 | Unclassified | 1389 |
| 577 | Ga0496112_0417809 | 3300048915 | Bacteria | 1280 |
| 578 | Ga0496112_0529894 | 3300048915 | Bacteria | 1112 |
| 579 | Ga0496112_0679672 | 3300048915 | Bacteria | 958 |
| 580 | Ga0496112_1223086 | 3300048915 | Unclassified | 668 |
| 581 | Ga0496113_0006862 | 3300048916 | Bacteria | 7263 |
| 582 | Ga0496113_0017920 | 3300048916 | Bacteria | 4924 |
| 583 | Ga0496113_0484708 | 3300048916 | Bacteria | 993 |
| 584 | Ga0496113_0502067 | 3300048916 | Unclassified | 974 |
| 585 | Ga0496113_0603259 | 3300048916 | Unclassified | 879 |
| 586 | Ga0496113_0982057 | 3300048916 | Bacteria | 666 |
| 587 | Ga0496113_1496354 | 3300048916 | Bacteria | 521 |
| 588 | Ga0496114_0001179 | 3300048917 | Bacteria | 19806 |
| 589 | Ga0496114_0008595 | 3300048917 | Bacteria | 8093 |
| 590 | Ga0496114_0068411 | 3300048917 | Bacteria | 2981 |
| 591 | Ga0496114_0224143 | 3300048917 | Bacteria | 1651 |
| 592 | Ga0496114_0836760 | 3300048917 | Unclassified | 800 |
| 593 | Ga0496115_0040738 | 3300048918 | Bacteria | 3694 |
| 594 | Ga0496115_0198076 | 3300048918 | Bacteria | 1659 |
| 595 | Ga0501297_056002 | 3300049520 | Unclassified | 592 |
| 596 | Ga0501032_0663898 | 3300049569 | Bacteria | 662 |
| 597 | Ga0501036_0345286 | 3300049572 | Unclassified | 1243 |
| 598 | Ga0501036_0766286 | 3300049572 | Unclassified | 796 |
| 599 | Ga0501037_0973124 | 3300049573 | Bacteria | 554 |
| 600 | Ga0501039_0264919 | 3300049575 | Unclassified | 1351 |
| 601 | Ga0501039_0431368 | 3300049575 | Unclassified | 1035 |
| 602 | Ga0501039_0765511 | 3300049575 | Bacteria | 754 |
| 603 | Ga0501040_0012960 | 3300049576 | Bacteria | 5480 |
| 604 | Ga0501040_0031609 | 3300049576 | Bacteria | 3579 |
| 605 | Ga0501040_0216650 | 3300049576 | Unclassified | 1362 |
| 606 | Ga0501040_0293529 | 3300049576 | Bacteria | 1162 |
| 607 | Ga0501041_0090603 | 3300049577 | Bacteria | 1888 |
| 608 | Ga0501041_0117460 | 3300049577 | Bacteria | 1652 |
| 609 | Ga0501041_0389893 | 3300049577 | Bacteria | 882 |
| 610 | Ga0501042_1061640 | 3300049578 | Unclassified | 590 |
| 611 | Ga0501042_1119494 | 3300049578 | Bacteria | 574 |
| 612 | Ga0501043_0706351 | 3300049579 | Bacteria | 736 |
| 613 | Ga0501043_0878449 | 3300049579 | Unclassified | 644 |
| 614 | Ga0501043_1088843 | 3300049579 | Bacteria | 565 |
| 615 | Ga0501046_1278645 | 3300049580 | Unclassified | 502 |
| 616 | Ga0501048_0413276 | 3300049582 | Unclassified | 965 |
| 617 | Ga0501048_1189930 | 3300049582 | Bacteria | 548 |
| 618 | Ga0501067_0058709 | 3300049583 | Bacteria | 2130 |
| 619 | Ga0501067_0116024 | 3300049583 | Unclassified | 1489 |
| 620 | Ga0501067_0809148 | 3300049583 | Bacteria | 528 |
| 621 | Ga0501068_0262801 | 3300049584 | Unclassified | 1101 |
| 622 | Ga0501069_0048677 | 3300049585 | Bacteria | 2355 |
| 623 | Ga0501071_0046241 | 3300049587 | Bacteria | 3126 |
| 624 | Ga0501071_0112547 | 3300049587 | Unclassified | 2013 |
| 625 | Ga0501071_0119481 | 3300049587 | Bacteria | 1953 |
| 626 | Ga0501071_0590057 | 3300049587 | Unclassified | 854 |
| 627 | Ga0501072_0067370 | 3300049588 | Bacteria | 2825 |
| 628 | Ga0501072_0093538 | 3300049588 | Bacteria | 2388 |
| 629 | Ga0501072_0175939 | 3300049588 | Unclassified | 1707 |
| 630 | Ga0501075_0025202 | 3300049591 | Bacteria | 4370 |
| 631 | Ga0501075_0078368 | 3300049591 | Bacteria | 2501 |
| 632 | Ga0501075_0134240 | 3300049591 | Bacteria | 1885 |
| 633 | Ga0501075_0401676 | 3300049591 | Bacteria | 1045 |
| 634 | Ga0501075_0752057 | 3300049591 | Bacteria | 742 |
| 635 | Ga0501075_0827378 | 3300049591 | Unclassified | 704 |
| 636 | Ga0501075_0871027 | 3300049591 | Unclassified | 685 |
| 637 | Ga0501076_0020972 | 3300049592 | Bacteria | 5006 |
| 638 | Ga0501076_0275097 | 3300049592 | Bacteria | 1379 |
| 639 | Ga0501076_0700876 | 3300049592 | Unclassified | 836 |
| 640 | Ga0501076_0740357 | 3300049592 | Bacteria | 811 |
| 641 | Ga0501077_0125238 | 3300049593 | Bacteria | 1629 |
| 642 | Ga0501077_0411019 | 3300049593 | Bacteria | 865 |
| 643 | Ga0501077_0514216 | 3300049593 | Unclassified | 768 |
| 644 | Ga0501079_0098937 | 3300049741 | Unclassified | 2261 |
| 645 | Ga0501079_0467365 | 3300049741 | Bacteria | 991 |
| 646 | Ga0501080_0739146 | 3300049742 | Unclassified | 866 |
| 647 | Ga0501081_0113460 | 3300049743 | Bacteria | 1924 |
| 648 | Ga0501081_0342041 | 3300049743 | Unclassified | 1102 |
| 649 | Ga0501083_0365825 | 3300049744 | Bacteria | 938 |
| 650 | Ga0501035_0271020 | 3300049822 | Bacteria | 1437 |
| 651 | Ga0501045_0026948 | 3300049824 | Bacteria | 4137 |
| 652 | Ga0501045_0045942 | 3300049824 | Bacteria | 3180 |
| 653 | Ga0501045_0210964 | 3300049824 | Unclassified | 1447 |
| 654 | Ga0501045_0581503 | 3300049824 | Bacteria | 830 |
| 655 | nmdc:mga04h51_84818_c1 | 3300050495 | Bacteria | 1130 |
| 656 | nmdc:mga05p37_1317228_c1 | 3300050507 | Bacteria | 735 |
| 657 | nmdc:mga05p37_213080_c1 | 3300050507 | Unclassified | 2334 |
| 658 | nmdc:mga05p37_300944_c1 | 3300050507 | Bacteria | 1905 |
| 659 | nmdc:mga05p37_712864_c1 | 3300050507 | Unclassified | 1112 |
| 660 | nmdc:mga09592_598_c1 | 3300050508 | Bacteria | 27378 |
| 661 | nmdc:mga0qj67_334079_c1 | 3300050509 | Unclassified | 1226 |
| 662 | nmdc:mga0qj67_60034_c1 | 3300050509 | Bacteria | 3016 |
| 663 | nmdc:mga06r32_1590996_c1 | 3300050510 | Unclassified | 592 |
| 664 | nmdc:mga06r32_1683387_c1 | 3300050510 | Bacteria | 572 |
| 665 | nmdc:mga06r32_1771928_c1 | 3300050510 | Bacteria | 553 |
| 666 | nmdc:mga06r32_2012375_c1 | 3300050510 | Bacteria | 511 |
| 667 | nmdc:mga06r32_30602_c1 | 3300050510 | Bacteria | 5051 |
| 668 | nmdc:mga06r32_583228_c1 | 3300050510 | Bacteria | 1090 |
| 669 | nmdc:mga06r32_886635_c1 | 3300050510 | Bacteria | 849 |
| 670 | nmdc:mga06r32_995614_c1 | 3300050510 | Bacteria | 791 |
| 671 | nmdc:mga08y16_1047668_c1 | 3300050511 | Unclassified | 793 |
| 672 | nmdc:mga08y16_1512511_c1 | 3300050511 | Bacteria | 631 |
| 673 | nmdc:mga08y16_413279_c1 | 3300050511 | Bacteria | 1379 |
| 674 | nmdc:mga08y16_46733_c1 | 3300050511 | Unclassified | 4532 |
| 675 | nmdc:mga0n895_10047_c1 | 3300050512 | Bacteria | 8329 |
| 676 | nmdc:mga0n895_1080421_c1 | 3300050512 | Bacteria | 780 |
| 677 | nmdc:mga0n895_1697702_c1 | 3300050512 | Bacteria | 594 |
| 678 | nmdc:mga0n895_21073_c1 | 3300050512 | Bacteria | 6091 |
| 679 | nmdc:mga0n895_380881_c1 | 3300050512 | Unclassified | 1428 |
| 680 | nmdc:mga0n895_680671_c1 | 3300050512 | Bacteria | 1026 |
| 681 | nmdc:mga0n895_756693_c1 | 3300050512 | Unclassified | 964 |
| 682 | nmdc:mga0n895_8415_c1 | 3300050512 | Bacteria | 8929 |
| 683 | nmdc:mga0n895_844390_c1 | 3300050512 | Bacteria | 904 |
| 684 | nmdc:mga0n895_873077_c1 | 3300050512 | Bacteria | 886 |
| 685 | nmdc:mga0n895_953926_c1 | 3300050512 | Unclassified | 841 |
| 686 | nmdc:mga0rr50_2019_c1 | 3300050513 | Bacteria | 11303 |
| 687 | nmdc:mga0rr50_382632_c1 | 3300050513 | Bacteria | 1187 |
| 688 | nmdc:mga0rr50_45616_c1 | 3300050513 | Bacteria | 3223 |
| 689 | nmdc:mga0rr50_499420_c1 | 3300050513 | Bacteria | 1034 |
| 690 | nmdc:mga0rr50_771695_c1 | 3300050513 | Bacteria | 820 |
| 691 | nmdc:mga0rr50_79440_c1 | 3300050513 | Bacteria | 2527 |
| 692 | nmdc:mga0rr50_897196_c1 | 3300050513 | Bacteria | 756 |
| 693 | nmdc:mga0rr50_911278_c1 | 3300050513 | Bacteria | 749 |
| 694 | nmdc:mga08x19_112051_c1 | 3300050514 | Bacteria | 1821 |
| 695 | nmdc:mga08x19_150073_c1 | 3300050514 | Bacteria | 1578 |
| 696 | nmdc:mga08x19_256003_c1 | 3300050514 | Bacteria | 1209 |
| 697 | nmdc:mga08x19_40988_c1 | 3300050514 | Unclassified | 2949 |
| 698 | nmdc:mga0a205_140348_c1 | 3300050515 | Bacteria | 2317 |
| 699 | nmdc:mga0a205_166406_c1 | 3300050515 | Bacteria | 2100 |
| 700 | nmdc:mga0a205_234657_c1 | 3300050515 | Bacteria | 1717 |
| 701 | nmdc:mga0a205_58613_c2 | 3300050515 | Unclassified | 2745 |
| 702 | nmdc:mga0a205_6284_c1 | 3300050515 | Bacteria | 10722 |
| 703 | Ga0495612_0279954 | 3300053078 | Bacteria | 745 |
| 704 | Ga0495655_0312885 | 3300053083 | Unclassified | 542 |
| 705 | Ga0495619_0331208 | 3300053085 | Unclassified | 1054 |
| 706 | Ga0501084_0139689 | 3300054114 | Bacteria | 2040 |
| 707 | Ga0501084_0272490 | 3300054114 | Unclassified | 1429 |
| 708 | Ga0501082_0039156 | 3300060353 | Bacteria | 4090 |
| 709 | Ga0501082_0263682 | 3300060353 | Unclassified | 1499 |
| 710 | Ga0501082_1224398 | 3300060353 | Unclassified | 656 |
| 711 | Ga0530510_0043913 | 3300061734 | Bacteria | 3229 |
| 712 | Ga0530510_0098201 | 3300061734 | Bacteria | 2141 |
| 713 | Ga0530510_0371170 | 3300061734 | Bacteria | 1076 |
| 714 | Ga0530510_0693638 | 3300061734 | Unclassified | 776 |
| 715 | Ga0530510_0696667 | 3300061734 | Bacteria | 774 |
| 716 | Ga0530510_0827290 | 3300061734 | Bacteria | 707 |
| 717 | Ga0501069_0279796 | |||
| 718 | rootL2_10301789 | |||
| 719 | Ga0070690_100346472 | |||
| 720 | Ga0070690_101423652 | |||
| 721 | Ga0068869_100801970 | |||
| 722 | Ga0070680_100021495 | |||
| 723 | Ga0070680_100037189 | |||
| 724 | Ga0070682_100049009 | |||
| 725 | Ga0070682_102003697 | |||
| 726 | Ga0068868_100588019 | |||
| 727 | Ga0070660_101828276 | |||
| 728 | Ga0070689_100648573 | |||
| 729 | Ga0070691_10031861 | |||
| 730 | Ga0070691_10587440 | |||
| 731 | Ga0070687_100208408 | |||
| 732 | Ga0070661_100794294 | |||
| 733 | Ga0070675_100266215 | |||
| 734 | Ga0070675_101599667 | |||
| 735 | Ga0070671_100400417 | |||
| 736 | Ga0070671_100709168 | |||
| 737 | Ga0070674_100184560 | |||
| 738 | Ga0070673_100231623 | |||
| 739 | Ga0070688_100083307 | |||
| 740 | Ga0070688_101161929 | |||
| 741 | Ga0070659_100464585 | |||
| 742 | Ga0070703_10000230 | |||
| 743 | Ga0070703_10006711 | |||
| 744 | Ga0070703_10282840 | |||
| 745 | Ga0070703_10616936 | |||
| 746 | Ga0070709_10807829 | |||
| 747 | Ga0070713_100490178 | |||
| 748 | Ga0070713_101203960 | |||
| 749 | Ga0070701_10043208 | |||
| 750 | Ga0070701_10988496 | |||
| 751 | Ga0070705_100035845 | |||
| 752 | Ga0070705_100219478 | |||
| 753 | Ga0070705_100257360 | |||
| 754 | Ga0070705_100913776 | |||
| 755 | Ga0070705_101085048 | |||
| 756 | Ga0070705_101390365 | |||
| 757 | Ga0070700_100163385 | |||
| 758 | Ga0070694_100011445 | |||
| 759 | Ga0070694_100013517 | |||
| 760 | Ga0070694_100019602 | |||
| 761 | Ga0070694_100071888 | |||
| 762 | Ga0070694_100910146 | |||
| 763 | Ga0070708_100005088 | |||
| 764 | Ga0070708_100008231 | |||
| 765 | Ga0070708_100020929 | |||
| 766 | Ga0070708_100045978 | |||
| 767 | Ga0070708_100088049 | |||
| 768 | Ga0070708_100316883 | |||
| 769 | Ga0070708_100557261 | |||
| 770 | Ga0070708_100657692 | |||
| 771 | Ga0070708_101022635 | |||
| 772 | Ga0070708_102033887 | |||
| 773 | Ga0070678_100598486 | |||
| 774 | Ga0070678_101964580 | |||
| 775 | Ga0070662_100245297 | |||
| 776 | Ga0070681_10038394 | |||
| 777 | Ga0068867_100228489 | |||
| 778 | Ga0070706_100003964 | |||
| 779 | Ga0070706_100005843 | |||
| 780 | Ga0070706_100086419 | |||
| 781 | Ga0070706_100110911 | |||
| 782 | Ga0070706_100166188 | |||
| 783 | Ga0070706_100174314 | |||
| 784 | Ga0070706_100847532 | |||
| 785 | Ga0070706_100968346 | |||
| 786 | Ga0070706_101015547 | |||
| 787 | Ga0070707_100039633 | |||
| 788 | Ga0070707_100062881 | |||
| 789 | Ga0070707_100079243 | |||
| 790 | Ga0070707_100109752 | |||
| 791 | Ga0070707_100218829 | |||
| 792 | Ga0070707_100712498 | |||
| 793 | Ga0070707_100719969 | |||
| 794 | Ga0070707_100851914 | |||
| 795 | Ga0070707_101148564 | |||
| 796 | Ga0070707_101315166 | |||
| 797 | Ga0070707_101505653 | |||
| 798 | Ga0070698_100000025 | |||
| 799 | Ga0070698_100019797 | |||
| 800 | Ga0070698_100020843 | |||
| 801 | Ga0070698_100049839 | |||
| 802 | Ga0070698_100159402 | |||
| 803 | Ga0070698_100207207 | |||
| 804 | Ga0070698_100225760 | |||
| 805 | Ga0070698_100542199 | |||
| 806 | Ga0070698_100738720 | |||
| 807 | Ga0070698_101392850 | |||
| 808 | Ga0070698_101952554 | |||
| 809 | Ga0070699_100008464 | |||
| 810 | Ga0070699_100019885 | |||
| 811 | Ga0070699_100020840 | |||
| 812 | Ga0070699_100043530 | |||
| 813 | Ga0070699_100096038 | |||
| 814 | Ga0070699_100281956 | |||
| 815 | Ga0070699_100963748 | |||
| 816 | Ga0070699_101084661 | |||
| 817 | Ga0070699_102160615 | |||
| 818 | Ga0070679_100004051 | |||
| 819 | Ga0070679_100116366 | |||
| 820 | Ga0070679_100718104 | |||
| 821 | Ga0070679_101811335 | |||
| 822 | Ga0070684_100000243 | |||
| 823 | Ga0070697_100006092 | |||
| 824 | Ga0070697_100015617 | |||
| 825 | Ga0070697_100029743 | |||
| 826 | Ga0070697_100061447 | |||
| 827 | Ga0070697_100073417 | |||
| 828 | Ga0070697_100103672 | |||
| 829 | Ga0070697_100249529 | |||
| 830 | Ga0070697_100264450 | |||
| 831 | Ga0070697_100468514 | |||
| 832 | Ga0070697_100688159 | |||
| 833 | Ga0070686_100131230 | |||
| 834 | Ga0070695_100017169 | |||
| 835 | Ga0070695_100047463 | |||
| 836 | Ga0070695_100132138 | |||
| 837 | Ga0070695_100528074 | |||
| 838 | Ga0070695_100960886 | |||
| 839 | Ga0070696_100004243 | |||
| 840 | Ga0070696_100004674 | |||
| 841 | Ga0070696_100016063 | |||
| 842 | Ga0070696_100077285 | |||
| 843 | Ga0070696_100284976 | |||
| 844 | Ga0070696_100342402 | |||
| 845 | Ga0070693_100025481 | |||
| 846 | Ga0070693_101016727 | |||
| 847 | Ga0070693_101134233 | |||
| 848 | Ga0070704_100005113 | |||
| 849 | Ga0070704_100007606 | |||
| 850 | Ga0070704_100019184 | |||
| 851 | Ga0070704_100165209 | |||
| 852 | Ga0070704_100577683 | |||
| 853 | Ga0070704_100922143 | |||
| 854 | Ga0068854_100262139 | |||
| 855 | Ga0068856_100011791 | |||
| 856 | Ga0068856_100407099 | |||
| 857 | Ga0070702_100127794 | |||
| 858 | Ga0070702_100199685 | |||
| 859 | Ga0068859_100950470 | |||
| 860 | Ga0068864_100393385 | |||
| 861 | Ga0068861_102656397 | |||
| 862 | Ga0068863_102354467 | |||
| 863 | Ga0068858_101400063 | |||
| 864 | Ga0068858_102063033 | |||
| 865 | Ga0081455_10103667 | |||
| 866 | Ga0081455_10457626 | |||
| 867 | Ga0081455_10708394 | |||
| 868 | Ga0081539_10121156 | |||
| 869 | Ga0070717_10320257 | |||
| 870 | Ga0070717_10836023 | |||
| 871 | Ga0075363_100758437 | |||
| 872 | Ga0070715_10734436 | |||
| 873 | Ga0070716_100422808 | |||
| 874 | Ga0070716_100473010 | |||
| 875 | Ga0070712_100152461 | |||
| 876 | Ga0070712_100247350 | |||
| 877 | Ga0068871_100119122 | |||
| 878 | Ga0075428_100013124 | |||
| 879 | Ga0075428_100080558 | |||
| 880 | Ga0075428_101829466 | |||
| 881 | Ga0075428_101886126 | |||
| 882 | Ga0075428_102467147 | |||
| 883 | Ga0075430_100071797 | |||
| 884 | Ga0075430_100261163 | |||
| 885 | Ga0075431_100992218 | |||
| 886 | Ga0075431_101111585 | |||
| 887 | Ga0075431_101552248 | |||
| 888 | Ga0075431_101671457 | |||
| 889 | Ga0075433_10013586 | |||
| 890 | Ga0075433_10024662 | |||
| 891 | Ga0075433_10025253 | |||
| 892 | Ga0075433_10085645 | |||
| 893 | Ga0075433_10161375 | |||
| 894 | Ga0075433_11817977 | |||
| 895 | Ga0075434_100008712 | |||
| 896 | Ga0075434_100034322 | |||
| 897 | Ga0075434_100127360 | |||
| 898 | Ga0075434_100128594 | |||
| 899 | Ga0075434_100983181 | |||
| 900 | Ga0075434_101676893 | |||
| 901 | Ga0075429_101442844 | |||
| 902 | Ga0075436_100035772 | |||
| 903 | Ga0075436_100046644 | |||
| 904 | Ga0075436_100162058 | |||
| 905 | Ga0075436_100366140 | |||
| 906 | Ga0097620_100950399 | |||
| 907 | Ga0075435_100069048 | |||
| 908 | Ga0075435_100080524 | |||
| 909 | Ga0075435_100159717 | |||
| 910 | Ga0075435_100700258 | |||
| 911 | Ga0075435_100842438 | |||
| 912 | Ga0075435_101133736 | |||
| 913 | Ga0075435_101877306 | |||
| 914 | Ga0099794_10000015 | |||
| 915 | Ga0099794_10034076 | |||
| 916 | Ga0099794_10147325 | |||
| 917 | Ga0099794_10294923 | |||
| 918 | Ga0099794_10328951 | |||
| 919 | Ga0111539_10003768 | |||
| 920 | Ga0111539_10815606 | |||
| 921 | Ga0111539_11445465 | |||
| 922 | Ga0111539_11930097 | |||
| 923 | Ga0111539_12316876 | |||
| 924 | Ga0111539_12981176 | |||
| 925 | Ga0105245_10009810 | |||
| 926 | Ga0105245_10071777 | |||
| 927 | Ga0105245_10767101 | |||
| 928 | Ga0105245_11387882 | |||
| 929 | Ga0114129_10079878 | |||
| 930 | Ga0114129_10283949 | |||
| 931 | Ga0114129_10458309 | |||
| 932 | Ga0114129_11417072 | |||
| 933 | Ga0114129_11954517 | |||
| 934 | Ga0114129_12095532 | |||
| 935 | Ga0105243_10984521 | |||
| 936 | Ga0105243_11015160 | |||
| 937 | Ga0105243_11145917 | |||
| 938 | Ga0105241_10084371 | |||
| 939 | Ga0105241_10954610 | |||
| 940 | Ga0105242_10358132 | |||
| 941 | Ga0105242_10661461 | |||
| 942 | Ga0105248_10472944 | |||
| 943 | Ga0105248_12821590 | |||
| 944 | Ga0105248_13028458 | |||
| 945 | Ga0105237_11774577 | |||
| 946 | Ga0105238_10766842 | |||
| 947 | Ga0105249_10906967 | |||
| 948 | Ga0105249_12176558 | |||
| 949 | Ga0105239_10241240 | |||
| 950 | Ga0105239_11966633 | |||
| 951 | Ga0105239_12694419 | |||
| 952 | Ga0105246_10029552 | |||
| 953 | Ga0105246_10257883 | |||
| 954 | Ga0105246_10594871 | |||
| 955 | Ga0157369_10443746 | |||
| 956 | Ga0157378_10718045 | |||
| 957 | Ga0163162_12659019 | |||
| 958 | Ga0157375_10105228 | |||
| 959 | Ga0157375_10164295 | |||
| 960 | Ga0157375_13607894 | |||
| 961 | Ga0163163_10095181 | |||
| 962 | Ga0163163_10600349 | |||
| 963 | Ga0163163_11474087 | |||
| 964 | Ga0163163_12190301 | |||
| 965 | Ga0157380_13435598 | |||
| 966 | Ga0157380_13494310 | |||
| 967 | Ga0157379_11130342 | |||
| 968 | Ga0157379_11298508 | |||
| 969 | Ga0157379_11956218 | |||
| 970 | Ga0157376_10160230 | |||
| 971 | Ga0157376_11223376 | |||
| 972 | Ga0207653_10000005 | |||
| 973 | Ga0207653_10028555 | |||
| 974 | Ga0207653_10102607 | |||
| 975 | Ga0207653_10106470 | |||
| 976 | Ga0207692_11052409 | |||
| 977 | Ga0207688_10785303 | |||
| 978 | Ga0207680_11248800 | |||
| 979 | Ga0207685_10205209 | |||
| 980 | Ga0207699_10298287 | |||
| 981 | Ga0207643_10500119 | |||
| 982 | Ga0207684_10006714 | |||
| 983 | Ga0207684_10070974 | |||
| 984 | Ga0207684_10210605 | |||
| 985 | Ga0207684_10289954 | |||
| 986 | Ga0207684_10296808 | |||
| 987 | Ga0207684_10345759 | |||
| 988 | Ga0207684_10998306 | |||
| 989 | Ga0207684_11184141 | |||
| 990 | Ga0207684_11699924 | |||
| 991 | Ga0207654_10056739 | |||
| 992 | Ga0207707_10006530 | |||
| 993 | Ga0207707_10308722 | |||
| 994 | Ga0207693_10022570 | |||
| 995 | Ga0207693_10153282 | |||
| 996 | Ga0207663_11201733 | |||
| 997 | Ga0207663_11617675 | |||
| 998 | Ga0207660_10006097 | |||
| 999 | Ga0207660_10024169 | |||
| 1000 | Ga0207662_10369265 | |||
| 1001 | Ga0207662_10676458 | |||
| 1002 | Ga0207657_10285498 | |||
| 1003 | Ga0207649_10717174 | |||
| 1004 | Ga0207652_10000845 | |||
| 1005 | Ga0207652_10556089 | |||
| 1006 | Ga0207646_10003801 | |||
| 1007 | Ga0207646_10103820 | |||
| 1008 | Ga0207646_10123499 | |||
| 1009 | Ga0207646_10492587 | |||
| 1010 | Ga0207646_10922219 | |||
| 1011 | Ga0207646_10935952 | |||
| 1012 | Ga0207694_10558789 | |||
| 1013 | Ga0207659_11347255 | |||
| 1014 | Ga0207659_11391714 | |||
| 1015 | Ga0207687_10005539 | |||
| 1016 | Ga0207687_10411648 | |||
| 1017 | Ga0207687_10430148 | |||
| 1018 | Ga0207700_10923450 | |||
| 1019 | Ga0207664_10226094 | |||
| 1020 | Ga0207664_11401594 | |||
| 1021 | Ga0207706_10261667 | |||
| 1022 | Ga0207686_10302311 | |||
| 1023 | Ga0207709_10297652 | |||
| 1024 | Ga0207709_10585861 | |||
| 1025 | Ga0207709_10906180 | |||
| 1026 | Ga0207670_10363001 | |||
| 1027 | Ga0207669_10299248 | |||
| 1028 | Ga0207704_10371066 | |||
| 1029 | Ga0207665_10404772 | |||
| 1030 | Ga0207665_11000300 | |||
| 1031 | Ga0207665_11069280 | |||
| 1032 | Ga0207711_10096448 | |||
| 1033 | Ga0207711_11415065 | |||
| 1034 | Ga0207711_11460219 | |||
| 1035 | Ga0207689_10108260 | |||
| 1036 | Ga0207661_10012284 | |||
| 1037 | Ga0207661_11214390 | |||
| 1038 | Ga0207679_11769482 | |||
| 1039 | Ga0207651_10690479 | |||
| 1040 | Ga0207640_10303552 | |||
| 1041 | Ga0207640_10812244 | |||
| 1042 | Ga0207658_11480613 | |||
| 1043 | Ga0207703_11537163 | |||
| 1044 | Ga0207678_10738929 | |||
| 1045 | Ga0207708_10180247 | |||
| 1046 | Ga0207708_10292668 | |||
| 1047 | Ga0207702_10004111 | |||
| 1048 | Ga0207702_10039417 | |||
| 1049 | Ga0207641_11002768 | |||
| 1050 | Ga0207648_10271930 | |||
| 1051 | Ga0207648_12041901 | |||
| 1052 | Ga0207676_10376496 | |||
| 1053 | Ga0207683_10021748 | |||
| 1054 | Ga0207683_10038254 | |||
| 1055 | Ga0207683_10411037 | |||
| 1056 | Ga0209969_1081550 | |||
| 1057 | Ga0209588_1000541 | |||
| 1058 | Ga0207428_10008584 | |||
| 1059 | Ga0268264_12679282 | |||
| 1060 | Ga0307409_101287572 | |||
| 1061 | Ga0307416_100522742 | |||
| 1062 | Ga0307416_102783925 | |||
| 1063 | Ga0373928_0105625 | |||
| 1064 | Ga0373943_0017137 | |||
| 1065 | Ga0373955_0510819 | |||
| 1066 | Ga0373961_0253442 | |||
| 1067 | Ga0373935_0944122 | |||
| 1068 | Ga0373937_0131903 | |||
| 1069 | Ga0373925_0733032 | |||
| 1070 | Ga0395899_0082996 | |||
| 1071 | Ga0395899_0328334 | |||
| 1072 | Ga0395900_0002502 | |||
| 1073 | Ga0395900_0007559 | |||
| 1074 | Ga0395900_0054551 | |||
| 1075 | Ga0395900_0106678 | |||
| 1076 | Ga0395900_0190094 | |||
| 1077 | Ga0395900_0319263 | |||
| 1078 | Ga0395900_0349974 | |||
| 1079 | Ga0395900_0690220 | |||
| 1080 | Ga0395900_1141513 | |||
| 1081 | Ga0395900_1385031 | |||
| 1082 | Ga0395900_1526688 | |||
| 1083 | Ga0395900_1625396 | |||
| 1084 | Ga0395898_0002628 | |||
| 1085 | Ga0395898_0010897 | |||
| 1086 | Ga0395898_0080159 | |||
| 1087 | Ga0395898_0085001 | |||
| 1088 | Ga0395898_0803160 | |||
| 1089 | Ga0395898_1065708 | |||
| 1090 | Ga0395905_0003689 | |||
| 1091 | Ga0395905_0009707 | |||
| 1092 | Ga0395905_0230212 | |||
| 1093 | Ga0395905_0603199 | |||
| 1094 | Ga0395905_1201863 | |||
| 1095 | Ga0395905_1355168 | |||
| 1096 | Ga0395905_1500074 | |||
| 1097 | Ga0395901_0002394 | |||
| 1098 | Ga0395901_0004101 | |||
| 1099 | Ga0395901_0006554 | |||
| 1100 | Ga0395901_0045980 | |||
| 1101 | Ga0395901_0072123 | |||
| 1102 | Ga0395901_0168446 | |||
| 1103 | Ga0395901_0180702 | |||
| 1104 | Ga0395901_0268214 | |||
| 1105 | Ga0395901_0375935 | |||
| 1106 | Ga0395901_0472974 | |||
| 1107 | Ga0395901_0916986 | |||
| 1108 | Ga0395901_1273188 | |||
| 1109 | Ga0451800_0340282 | |||
| 1110 | Ga0451807_2148327 | |||
| 1111 | Ga0451847_0679139 | |||
| 1112 | Ga0439434_0056352 | |||
| 1113 | Ga0450918_118375 | |||
| 1114 | Ga0451577_0124184 | |||
| 1115 | Ga0453683_0126904 | |||
| 1116 | Ga0453683_0674982 | |||
| 1117 | Ga0466960_0055360 | |||
| 1118 | Ga0451576_0007821 | |||
| 1119 | Ga0451576_0021937 | |||
| 1120 | Ga0451576_0171764 | |||
| 1121 | Ga0451576_0254993 | |||
| 1122 | Ga0451576_0388183 | |||
| 1123 | Ga0451576_1185185 | |||
| 1124 | Ga0466967_2355488 | |||
| 1125 | Ga0495592_0148827 | |||
| 1126 | Ga0495603_0022075 | |||
| 1127 | Ga0495603_0023420 | |||
| 1128 | Ga0495590_0190284 | |||
| 1129 | Ga0495629_1026746 | |||
| 1130 | Ga0495641_0143644 | |||
| 1131 | Ga0495582_0006708 | |||
| 1132 | Ga0495662_0132691 | |||
| 1133 | Ga0495662_0258697 | |||
| 1134 | Ga0495664_0328062 | |||
| 1135 | Ga0495584_0154635 | |||
| 1136 | Ga0495584_0174388 | |||
| 1137 | Ga0495585_0045528 | |||
| 1138 | Ga0495585_0107592 | |||
| 1139 | Ga0495585_0269715 | |||
| 1140 | Ga0495594_0328344 | |||
| 1141 | Ga0495596_0045763 | |||
| 1142 | Ga0495596_0056931 | |||
| 1143 | Ga0495596_0320552 | |||
| 1144 | Ga0495607_0352443 | |||
| 1145 | Ga0495583_0433564 | |||
| 1146 | Ga0495616_0058094 | |||
| 1147 | Ga0495620_0328356 | |||
| 1148 | Ga0495630_1047277 | |||
| 1149 | Ga0495631_0198554 | |||
| 1150 | Ga0495631_0492486 | |||
| 1151 | Ga0495632_0459512 | |||
| 1152 | Ga0495644_0238090 | |||
| 1153 | Ga0495644_0252724 | |||
| 1154 | Ga0495644_0253504 | |||
| 1155 | Ga0495663_0199456 | |||
| 1156 | Ga0495663_0257776 | |||
| 1157 | Ga0495663_0318694 | |||
| 1158 | Ga0495666_0546582 | |||
| 1159 | Ga0495642_0168473 | |||
| 1160 | Ga0495642_0252638 | |||
| 1161 | Ga0495642_0310421 | |||
| 1162 | Ga0495654_0447067 | |||
| 1163 | Ga0495598_0240938 | |||
| 1164 | Ga0495598_0325336 | |||
| 1165 | Ga0495598_0399533 | |||
| 1166 | Ga0495609_0041283 | |||
| 1167 | Ga0495609_0088616 | |||
| 1168 | Ga0495609_0149601 | |||
| 1169 | Ga0495609_0411243 | |||
| 1170 | Ga0495621_0097724 | |||
| 1171 | Ga0495621_0267062 | |||
| 1172 | Ga0495621_0443997 | |||
| 1173 | Ga0495656_0018342 | |||
| 1174 | Ga0495656_0067423 | |||
| 1175 | Ga0495656_0421503 | |||
| 1176 | Ga0495656_0450541 | |||
| 1177 | Ga0495656_0713830 | |||
| 1178 | Ga0495656_0718572 | |||
| 1179 | Ga0495656_0747585 | |||
| 1180 | Ga0495668_0182064 | |||
| 1181 | Ga0495634_0031690 | |||
| 1182 | Ga0495611_0313812 | |||
| 1183 | Ga0495659_0011492 | |||
| 1184 | Ga0495659_0053957 | |||
| 1185 | Ga0495659_0183192 | |||
| 1186 | Ga0495659_0247391 | |||
| 1187 | Ga0495659_0406105 | |||
| 1188 | Ga0495661_0616459 | |||
| 1189 | Ga0495588_0461615 | |||
| 1190 | Ga0495588_0764302 | |||
| 1191 | Ga0495647_0012783 | |||
| 1192 | Ga0495647_0029246 | |||
| 1193 | Ga0495647_0040215 | |||
| 1194 | Ga0495658_0128999 | |||
| 1195 | Ga0495669_0269357 | |||
| 1196 | Ga0495669_0391630 | |||
| 1197 | Ga0495669_0488314 | |||
| 1198 | Ga0495613_0029171 | |||
| 1199 | Ga0495613_0979522 | |||
| 1200 | Ga0495670_0109282 | |||
| 1201 | Ga0495670_0262500 | |||
| 1202 | Ga0495671_0388972 | |||
| 1203 | Ga0495671_0442060 | |||
| 1204 | Ga0495589_0051100 | |||
| 1205 | Ga0495589_0195575 | |||
| 1206 | Ga0495589_0266345 | |||
| 1207 | Ga0495581_0031266 | |||
| 1208 | Ga0495581_0279134 | |||
| 1209 | Ga0495636_0124205 | |||
| 1210 | Ga0495636_0522878 | |||
| 1211 | Ga0495674_0104981 | |||
| 1212 | Ga0495676_0050600 | |||
| 1213 | Ga0495676_0854551 | |||
| 1214 | Ga0495680_0062751 | |||
| 1215 | Ga0495680_0549498 | |||
| 1216 | Ga0495677_0012583 | |||
| 1217 | Ga0495679_096074 | |||
| 1218 | Ga0495685_045421 | |||
| 1219 | Ga0495684_0398349 | |||
| 1220 | Ga0495684_0795282 | |||
| 1221 | Ga0496100_0003614 | |||
| 1222 | Ga0496100_0690034 | |||
| 1223 | Ga0496101_0000920 | |||
| 1224 | Ga0496101_0059236 | |||
| 1225 | Ga0496101_0167052 | |||
| 1226 | Ga0496101_0244398 | |||
| 1227 | Ga0496101_0366175 | |||
| 1228 | Ga0496101_1180051 | |||
| 1229 | Ga0496102_0011412 | |||
| 1230 | Ga0496102_0029921 | |||
| 1231 | Ga0496102_1903175 | |||
| 1232 | Ga0496103_0002423 | |||
| 1233 | Ga0496103_0149915 | |||
| 1234 | Ga0496103_0200375 | |||
| 1235 | Ga0496103_0431120 | |||
| 1236 | Ga0496104_0000283 | |||
| 1237 | Ga0496104_0003705 | |||
| 1238 | Ga0496104_0005790 | |||
| 1239 | Ga0496104_0158250 | |||
| 1240 | Ga0496104_0469699 | |||
| 1241 | Ga0496104_0504740 | |||
| 1242 | Ga0496104_0966619 | |||
| 1243 | Ga0496104_0999806 | |||
| 1244 | Ga0496105_0000464 | |||
| 1245 | Ga0496105_0005049 | |||
| 1246 | Ga0496105_0007098 | |||
| 1247 | Ga0496105_0051963 | |||
| 1248 | Ga0496105_0113912 | |||
| 1249 | Ga0496105_0488772 | |||
| 1250 | Ga0496106_0867408 | |||
| 1251 | Ga0496106_1027429 | |||
| 1252 | Ga0496106_1313565 | |||
| 1253 | Ga0496106_1391882 | |||
| 1254 | Ga0496107_0205150 | |||
| 1255 | Ga0496107_0334703 | |||
| 1256 | Ga0496107_0352965 | |||
| 1257 | Ga0496107_1241237 | |||
| 1258 | Ga0496107_1382488 | |||
| 1259 | Ga0496108_0004985 | |||
| 1260 | Ga0496108_0019487 | |||
| 1261 | Ga0496108_0037303 | |||
| 1262 | Ga0496108_0165263 | |||
| 1263 | Ga0496108_0378438 | |||
| 1264 | Ga0496108_1561120 | |||
| 1265 | Ga0496109_0000801 | |||
| 1266 | Ga0496109_0001949 | |||
| 1267 | Ga0496109_0003556 | |||
| 1268 | Ga0496109_0251621 | |||
| 1269 | Ga0496109_0392230 | |||
| 1270 | Ga0496109_0396562 | |||
| 1271 | Ga0496109_0421995 | |||
| 1272 | Ga0496109_0584091 | |||
| 1273 | Ga0496109_1535064 | |||
| 1274 | Ga0496110_0000198 | |||
| 1275 | Ga0496110_0068801 | |||
| 1276 | Ga0496110_0351886 | |||
| 1277 | Ga0496110_0421278 | |||
| 1278 | Ga0496110_0490942 | |||
| 1279 | Ga0496110_0508389 | |||
| 1280 | Ga0496110_0616117 | |||
| 1281 | Ga0496110_1354434 | |||
| 1282 | Ga0496111_0003476 | |||
| 1283 | Ga0496111_0015827 | |||
| 1284 | Ga0496111_0040418 | |||
| 1285 | Ga0496111_0049673 | |||
| 1286 | Ga0496111_0062414 | |||
| 1287 | Ga0496111_0237748 | |||
| 1288 | Ga0496111_0367977 | |||
| 1289 | Ga0496111_1229208 | |||
| 1290 | Ga0496112_0018974 | |||
| 1291 | Ga0496112_0272506 | |||
| 1292 | Ga0496112_0363410 | |||
| 1293 | Ga0496112_0417809 | |||
| 1294 | Ga0496112_0529894 | |||
| 1295 | Ga0496112_0679672 | |||
| 1296 | Ga0496112_1223086 | |||
| 1297 | Ga0496113_0006862 | |||
| 1298 | Ga0496113_0017920 | |||
| 1299 | Ga0496113_0484708 | |||
| 1300 | Ga0496113_0502067 | |||
| 1301 | Ga0496113_0603259 | |||
| 1302 | Ga0496113_0982057 | |||
| 1303 | Ga0496113_1496354 | |||
| 1304 | Ga0496114_0001179 | |||
| 1305 | Ga0496114_0008595 | |||
| 1306 | Ga0496114_0068411 | |||
| 1307 | Ga0496114_0224143 | |||
| 1308 | Ga0496114_0836760 | |||
| 1309 | Ga0496115_0040738 | |||
| 1310 | Ga0496115_0198076 | |||
| 1311 | Ga0501297_056002 | |||
| 1312 | Ga0501032_0663898 | |||
| 1313 | Ga0501036_0345286 | |||
| 1314 | Ga0501036_0766286 | |||
| 1315 | Ga0501037_0973124 | |||
| 1316 | Ga0501039_0264919 | |||
| 1317 | Ga0501039_0431368 | |||
| 1318 | Ga0501039_0765511 | |||
| 1319 | Ga0501040_0012960 | |||
| 1320 | Ga0501040_0031609 | |||
| 1321 | Ga0501040_0216650 | |||
| 1322 | Ga0501040_0293529 | |||
| 1323 | Ga0501041_0090603 | |||
| 1324 | Ga0501041_0117460 | |||
| 1325 | Ga0501041_0389893 | |||
| 1326 | Ga0501042_1061640 | |||
| 1327 | Ga0501042_1119494 | |||
| 1328 | Ga0501043_0706351 | |||
| 1329 | Ga0501043_0878449 | |||
| 1330 | Ga0501043_1088843 | |||
| 1331 | Ga0501046_1278645 | |||
| 1332 | Ga0501048_0413276 | |||
| 1333 | Ga0501048_1189930 | |||
| 1334 | Ga0501067_0058709 | |||
| 1335 | Ga0501067_0116024 | |||
| 1336 | Ga0501067_0809148 | |||
| 1337 | Ga0501068_0262801 | |||
| 1338 | Ga0501069_0048677 | |||
| 1339 | Ga0501071_0046241 | |||
| 1340 | Ga0501071_0112547 | |||
| 1341 | Ga0501071_0119481 | |||
| 1342 | Ga0501071_0590057 | |||
| 1343 | Ga0501072_0067370 | |||
| 1344 | Ga0501072_0093538 | |||
| 1345 | Ga0501072_0175939 | |||
| 1346 | Ga0501075_0025202 | |||
| 1347 | Ga0501075_0078368 | |||
| 1348 | Ga0501075_0134240 | |||
| 1349 | Ga0501075_0401676 | |||
| 1350 | Ga0501075_0752057 | |||
| 1351 | Ga0501075_0827378 | |||
| 1352 | Ga0501075_0871027 | |||
| 1353 | Ga0501076_0020972 | |||
| 1354 | Ga0501076_0275097 | |||
| 1355 | Ga0501076_0700876 | |||
| 1356 | Ga0501076_0740357 | |||
| 1357 | Ga0501077_0125238 | |||
| 1358 | Ga0501077_0411019 | |||
| 1359 | Ga0501077_0514216 | |||
| 1360 | Ga0501079_0098937 | |||
| 1361 | Ga0501079_0467365 | |||
| 1362 | Ga0501080_0739146 | |||
| 1363 | Ga0501081_0113460 | |||
| 1364 | Ga0501081_0342041 | |||
| 1365 | Ga0501083_0365825 | |||
| 1366 | Ga0501035_0271020 | |||
| 1367 | Ga0501045_0026948 | |||
| 1368 | Ga0501045_0045942 | |||
| 1369 | Ga0501045_0210964 | |||
| 1370 | Ga0501045_0581503 | |||
| 1371 | nmdc:mga04h51_84818_c1 | |||
| 1372 | nmdc:mga05p37_1317228_c1 | |||
| 1373 | nmdc:mga05p37_213080_c1 | |||
| 1374 | nmdc:mga05p37_300944_c1 | |||
| 1375 | nmdc:mga05p37_712864_c1 | |||
| 1376 | nmdc:mga09592_598_c1 | |||
| 1377 | nmdc:mga0qj67_334079_c1 | |||
| 1378 | nmdc:mga0qj67_60034_c1 | |||
| 1379 | nmdc:mga06r32_1590996_c1 | |||
| 1380 | nmdc:mga06r32_1683387_c1 | |||
| 1381 | nmdc:mga06r32_1771928_c1 | |||
| 1382 | nmdc:mga06r32_2012375_c1 | |||
| 1383 | nmdc:mga06r32_30602_c1 | |||
| 1384 | nmdc:mga06r32_583228_c1 | |||
| 1385 | nmdc:mga06r32_886635_c1 | |||
| 1386 | nmdc:mga06r32_995614_c1 | |||
| 1387 | nmdc:mga08y16_1047668_c1 | |||
| 1388 | nmdc:mga08y16_1512511_c1 | |||
| 1389 | nmdc:mga08y16_413279_c1 | |||
| 1390 | nmdc:mga08y16_46733_c1 | |||
| 1391 | nmdc:mga0n895_10047_c1 | |||
| 1392 | nmdc:mga0n895_1080421_c1 | |||
| 1393 | nmdc:mga0n895_1697702_c1 | |||
| 1394 | nmdc:mga0n895_21073_c1 | |||
| 1395 | nmdc:mga0n895_380881_c1 | |||
| 1396 | nmdc:mga0n895_680671_c1 | |||
| 1397 | nmdc:mga0n895_756693_c1 | |||
| 1398 | nmdc:mga0n895_8415_c1 | |||
| 1399 | nmdc:mga0n895_844390_c1 | |||
| 1400 | nmdc:mga0n895_873077_c1 | |||
| 1401 | nmdc:mga0n895_953926_c1 | |||
| 1402 | nmdc:mga0rr50_2019_c1 | |||
| 1403 | nmdc:mga0rr50_382632_c1 | |||
| 1404 | nmdc:mga0rr50_45616_c1 | |||
| 1405 | nmdc:mga0rr50_499420_c1 | |||
| 1406 | nmdc:mga0rr50_771695_c1 | |||
| 1407 | nmdc:mga0rr50_79440_c1 | |||
| 1408 | nmdc:mga0rr50_897196_c1 | |||
| 1409 | nmdc:mga0rr50_911278_c1 | |||
| 1410 | nmdc:mga08x19_112051_c1 | |||
| 1411 | nmdc:mga08x19_150073_c1 | |||
| 1412 | nmdc:mga08x19_256003_c1 | |||
| 1413 | nmdc:mga08x19_40988_c1 | |||
| 1414 | nmdc:mga0a205_140348_c1 | |||
| 1415 | nmdc:mga0a205_166406_c1 | |||
| 1416 | nmdc:mga0a205_234657_c1 | |||
| 1417 | nmdc:mga0a205_58613_c2 | |||
| 1418 | nmdc:mga0a205_6284_c1 | |||
| 1419 | Ga0495612_0279954 | |||
| 1420 | Ga0495655_0312885 | |||
| 1421 | Ga0495619_0331208 | |||
| 1422 | Ga0501084_0139689 | |||
| 1423 | Ga0501084_0272490 | |||
| 1424 | Ga0501082_0039156 | |||
| 1425 | Ga0501082_0263682 | |||
| 1426 | Ga0501082_1224398 | |||
| 1427 | Ga0530510_0043913 | |||
| 1428 | Ga0530510_0098201 | |||
| 1429 | Ga0530510_0371170 | |||
| 1430 | Ga0530510_0693638 | |||
| 1431 | Ga0530510_0696667 | |||
| 1432 | Ga0530510_0827290 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qm7-assembly1.cif.gz_E | leishmania tarentolae proteasome 20s subunit complexed with gsk3494245 | 0.5597 | 14 | 49 |
| 4mfe-assembly1.cif.gz_B | structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with 3-hydroxypyruvate | 0.4981 | 14 | 44 |
| 4mim-assembly1.cif.gz_D | structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with 3-bromopyruvate | 0.4065 | 7 | 44 |
| 4m6v-assembly1.cif.gz_D | structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with pyruvate and biocytin | 0.4003 | 14 | 58 |
| 3dsb-assembly1.cif.gz_B | the crystal structure of a possible acetyltransferase from clostridium difficile 630 | 0.3756 | 1 | 43 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r2xC00 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Apc36109-like domain | 0.6328 | 14 | 40 | 1.10.340.20 |
| 3c1lD01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.601 | 10 | 59 | 1.20.5.810 |
| 3c1lD01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.5696 | 10 | 59 | 1.20.5.810 |
| af_Q84WE9_58_466_1.10.4160.10 | Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease | 0.5607 | 13 | 55 | 1.10.4160.10 |
| af_P11989_169_277_1.10.1790.10 | Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD;PRD domain | 0.5555 | 14 | 46 | 1.10.1790.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9PDE4-F1-model_v4 | Putative peroxidase-related enzyme | 0.6431 | 1 | 81 |
GO:0004601
|
| AF-A0A538GJ28-F1-model_v4 | Peroxidase | 0.6406 | 1 | 81 |
|
| AF-A0A7W9PDE4-F1-model_v4 | Putative peroxidase-related enzyme | 0.637 | 1 | 81 |
GO:0004601
|
| AF-K0EMP8-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.6326 | 1 | 81 |
|
| AF-K0EMP8-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.6267 | 1 | 81 |
|