F477078

General Info

Members Datasets Scaffolds Average Seq Length
716 267 1432 78

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0279796|Ga0501069_0279796_643_888
Length 75
Sequence MRLACVDSGHAPGERAVLAEMESTSGRPPSDVLKTLYYRPEIFGLDLAMRGESDWSHAERELFAAFVSSLNQCPF

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 12.85
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 27.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0279796 3300049585 Bacteria 976
2 rootL2_10301789 3300003322 Bacteria 2507
3 Ga0070690_100346472 3300005330 Bacteria 1077
4 Ga0070690_101423652 3300005330 Bacteria 558
5 Ga0068869_100801970 3300005334 Unclassified 809
6 Ga0070680_100021495 3300005336 Bacteria 5129
7 Ga0070680_100037189 3300005336 Bacteria 3933
8 Ga0070682_100049009 3300005337 Bacteria 2632
9 Ga0070682_102003697 3300005337 Unclassified 509
10 Ga0068868_100588019 3300005338 Bacteria 985
11 Ga0070660_101828276 3300005339 Bacteria 518
12 Ga0070689_100648573 3300005340 Bacteria 918
13 Ga0070691_10031861 3300005341 Bacteria 2474
14 Ga0070691_10587440 3300005341 Bacteria 656
15 Ga0070687_100208408 3300005343 Unclassified 1189
16 Ga0070661_100794294 3300005344 Unclassified 776
17 Ga0070675_100266215 3300005354 Bacteria 1503
18 Ga0070675_101599667 3300005354 Bacteria 601
19 Ga0070671_100400417 3300005355 Unclassified 1174
20 Ga0070671_100709168 3300005355 Unclassified 873
21 Ga0070674_100184560 3300005356 Bacteria 1600
22 Ga0070673_100231623 3300005364 Bacteria 1603
23 Ga0070688_100083307 3300005365 Bacteria 2075
24 Ga0070688_101161929 3300005365 Bacteria 619
25 Ga0070659_100464585 3300005366 Unclassified 1075
26 Ga0070703_10000230 3300005406 Bacteria 27012
27 Ga0070703_10006711 3300005406 Unclassified 3225
28 Ga0070703_10282840 3300005406 Bacteria 685
29 Ga0070703_10616936 3300005406 Bacteria 502
30 Ga0070709_10807829 3300005434 Unclassified 736
31 Ga0070713_100490178 3300005436 Bacteria 1158
32 Ga0070713_101203960 3300005436 Bacteria 733
33 Ga0070701_10043208 3300005438 Bacteria 2304
34 Ga0070701_10988496 3300005438 Bacteria 586
35 Ga0070705_100035845 3300005440 Bacteria 2784
36 Ga0070705_100219478 3300005440 Bacteria 1316
37 Ga0070705_100257360 3300005440 Bacteria 1229
38 Ga0070705_100913776 3300005440 Unclassified 707
39 Ga0070705_101085048 3300005440 Bacteria 654
40 Ga0070705_101390365 3300005440 Unclassified 585
41 Ga0070700_100163385 3300005441 Bacteria 1535
42 Ga0070694_100011445 3300005444 Bacteria 5494
43 Ga0070694_100013517 3300005444 Bacteria 5098
44 Ga0070694_100019602 3300005444 Bacteria 4303
45 Ga0070694_100071888 3300005444 Unclassified 2385
46 Ga0070694_100910146 3300005444 Bacteria 726
47 Ga0070708_100005088 3300005445 Bacteria 10405
48 Ga0070708_100008231 3300005445 Bacteria 8370
49 Ga0070708_100020929 3300005445 Bacteria 5523
50 Ga0070708_100045978 3300005445 Bacteria 3850
51 Ga0070708_100088049 3300005445 Bacteria 2822
52 Ga0070708_100316883 3300005445 Bacteria 1469
53 Ga0070708_100557261 3300005445 Bacteria 1081
54 Ga0070708_100657692 3300005445 Unclassified 987
55 Ga0070708_101022635 3300005445 Bacteria 775
56 Ga0070708_102033887 3300005445 Bacteria 532
57 Ga0070678_100598486 3300005456 Bacteria 984
58 Ga0070678_101964580 3300005456 Bacteria 553
59 Ga0070662_100245297 3300005457 Bacteria 1438
60 Ga0070681_10038394 3300005458 Bacteria 4801
61 Ga0068867_100228489 3300005459 Bacteria 1503
62 Ga0070706_100003964 3300005467 Bacteria 14418
63 Ga0070706_100005843 3300005467 Bacteria 11673
64 Ga0070706_100086419 3300005467 Unclassified 2906
65 Ga0070706_100110911 3300005467 Unclassified 2553
66 Ga0070706_100166188 3300005467 Bacteria 2060
67 Ga0070706_100174314 3300005467 Unclassified 2008
68 Ga0070706_100847532 3300005467 Unclassified 845
69 Ga0070706_100968346 3300005467 Bacteria 785
70 Ga0070706_101015547 3300005467 Unclassified 765
71 Ga0070707_100039633 3300005468 Bacteria 4503
72 Ga0070707_100062881 3300005468 Unclassified 3561
73 Ga0070707_100079243 3300005468 Bacteria 3170
74 Ga0070707_100109752 3300005468 Unclassified 2675
75 Ga0070707_100218829 3300005468 Bacteria 1855
76 Ga0070707_100712498 3300005468 Bacteria 966
77 Ga0070707_100719969 3300005468 Unclassified 961
78 Ga0070707_100851914 3300005468 Bacteria 875
79 Ga0070707_101148564 3300005468 Bacteria 743
80 Ga0070707_101315166 3300005468 Unclassified 689
81 Ga0070707_101505653 3300005468 Unclassified 640
82 Ga0070698_100000025 3300005471 Bacteria 101563
83 Ga0070698_100019797 3300005471 Bacteria 7058
84 Ga0070698_100020843 3300005471 Bacteria 6870
85 Ga0070698_100049839 3300005471 Unclassified 4273
86 Ga0070698_100159402 3300005471 Bacteria 2201
87 Ga0070698_100207207 3300005471 Bacteria 1896
88 Ga0070698_100225760 3300005471 Bacteria 1806
89 Ga0070698_100542199 3300005471 Unclassified 1102
90 Ga0070698_100738720 3300005471 Bacteria 927
91 Ga0070698_101392850 3300005471 Unclassified 652
92 Ga0070698_101952554 3300005471 Bacteria 540
93 Ga0070699_100008464 3300005518 Bacteria 8911
94 Ga0070699_100019885 3300005518 Bacteria 5788
95 Ga0070699_100020840 3300005518 Bacteria 5653
96 Ga0070699_100043530 3300005518 Bacteria 3885
97 Ga0070699_100096038 3300005518 Bacteria 2596
98 Ga0070699_100281956 3300005518 Unclassified 1488
99 Ga0070699_100963748 3300005518 Bacteria 782
100 Ga0070699_101084661 3300005518 Bacteria 734
101 Ga0070699_102160615 3300005518 Bacteria 508
102 Ga0070679_100004051 3300005530 Bacteria 13496
103 Ga0070679_100116366 3300005530 Bacteria 2658
104 Ga0070679_100718104 3300005530 Bacteria 942
105 Ga0070679_101811335 3300005530 Unclassified 559
106 Ga0070684_100000243 3300005535 Bacteria 37686
107 Ga0070697_100006092 3300005536 Bacteria 9329
108 Ga0070697_100015617 3300005536 Bacteria 5962
109 Ga0070697_100029743 3300005536 Unclassified 4382
110 Ga0070697_100061447 3300005536 Bacteria 3064
111 Ga0070697_100073417 3300005536 Bacteria 2809
112 Ga0070697_100103672 3300005536 Unclassified 2365
113 Ga0070697_100249529 3300005536 Bacteria 1517
114 Ga0070697_100264450 3300005536 Bacteria 1473
115 Ga0070697_100468514 3300005536 Unclassified 1099
116 Ga0070697_100688159 3300005536 Unclassified 902
117 Ga0070686_100131230 3300005544 Bacteria 1733
118 Ga0070695_100017169 3300005545 Unclassified 4388
119 Ga0070695_100047463 3300005545 Bacteria 2743
120 Ga0070695_100132138 3300005545 Bacteria 1721
121 Ga0070695_100528074 3300005545 Bacteria 917
122 Ga0070695_100960886 3300005545 Unclassified 693
123 Ga0070696_100004243 3300005546 Bacteria 9556
124 Ga0070696_100004674 3300005546 Bacteria 9147
125 Ga0070696_100016063 3300005546 Bacteria 5035
126 Ga0070696_100077285 3300005546 Unclassified 2352
127 Ga0070696_100284976 3300005546 Bacteria 1261
128 Ga0070696_100342402 3300005546 Unclassified 1156
129 Ga0070693_100025481 3300005547 Bacteria 3184
130 Ga0070693_101016727 3300005547 Unclassified 628
131 Ga0070693_101134233 3300005547 Bacteria 598
132 Ga0070704_100005113 3300005549 Bacteria 7624
133 Ga0070704_100007606 3300005549 Bacteria 6456
134 Ga0070704_100019184 3300005549 Unclassified 4390
135 Ga0070704_100165209 3300005549 Bacteria 1754
136 Ga0070704_100577683 3300005549 Bacteria 985
137 Ga0070704_100922143 3300005549 Unclassified 787
138 Ga0068854_100262139 3300005578 Unclassified 1384
139 Ga0068856_100011791 3300005614 Bacteria 8473
140 Ga0068856_100407099 3300005614 Unclassified 1380
141 Ga0070702_100127794 3300005615 Bacteria 1601
142 Ga0070702_100199685 3300005615 Bacteria 1323
143 Ga0068859_100950470 3300005617 Unclassified 943
144 Ga0068864_100393385 3300005618 Unclassified 1316
145 Ga0068861_102656397 3300005719 Bacteria 505
146 Ga0068863_102354467 3300005841 Unclassified 542
147 Ga0068858_101400063 3300005842 Unclassified 689
148 Ga0068858_102063033 3300005842 Unclassified 564
149 Ga0081455_10103667 3300005937 Bacteria 2277
150 Ga0081455_10457626 3300005937 Bacteria 870
151 Ga0081455_10708394 3300005937 Unclassified 641
152 Ga0081539_10121156 3300005985 Bacteria 1299
153 Ga0070717_10320257 3300006028 Unclassified 1381
154 Ga0070717_10836023 3300006028 Bacteria 838
155 Ga0075363_100758437 3300006048 Bacteria 588
156 Ga0070715_10734436 3300006163 Unclassified 593
157 Ga0070716_100422808 3300006173 Bacteria 964
158 Ga0070716_100473010 3300006173 Bacteria 918
159 Ga0070712_100152461 3300006175 Bacteria 1776
160 Ga0070712_100247350 3300006175 Unclassified 1423
161 Ga0068871_100119122 3300006358 Unclassified 2228
162 Ga0075428_100013124 3300006844 Bacteria 9215
163 Ga0075428_100080558 3300006844 Bacteria 3553
164 Ga0075428_101829466 3300006844 Bacteria 632
165 Ga0075428_101886126 3300006844 Bacteria 621
166 Ga0075428_102467147 3300006844 Unclassified 533
167 Ga0075430_100071797 3300006846 Bacteria 2904
168 Ga0075430_100261163 3300006846 Unclassified 1434
169 Ga0075431_100992218 3300006847 Bacteria 807
170 Ga0075431_101111585 3300006847 Bacteria 755
171 Ga0075431_101552248 3300006847 Bacteria 620
172 Ga0075431_101671457 3300006847 Unclassified 594
173 Ga0075433_10013586 3300006852 Bacteria 6628
174 Ga0075433_10024662 3300006852 Bacteria 5079
175 Ga0075433_10025253 3300006852 Bacteria 5021
176 Ga0075433_10085645 3300006852 Bacteria 2782
177 Ga0075433_10161375 3300006852 Unclassified 1995
178 Ga0075433_11817977 3300006852 Bacteria 523
179 Ga0075434_100008712 3300006871 Bacteria 9439
180 Ga0075434_100034322 3300006871 Bacteria 5009
181 Ga0075434_100127360 3300006871 Unclassified 2563
182 Ga0075434_100128594 3300006871 Bacteria 2551
183 Ga0075434_100983181 3300006871 Bacteria 858
184 Ga0075434_101676893 3300006871 Bacteria 644
185 Ga0075429_101442844 3300006880 Bacteria 599
186 Ga0075436_100035772 3300006914 Unclassified 3425
187 Ga0075436_100046644 3300006914 Bacteria 2988
188 Ga0075436_100162058 3300006914 Bacteria 1577
189 Ga0075436_100366140 3300006914 Unclassified 1041
190 Ga0097620_100950399 3300006931 Unclassified 943
191 Ga0075435_100069048 3300007076 Bacteria 2880
192 Ga0075435_100080524 3300007076 Bacteria 2674
193 Ga0075435_100159717 3300007076 Bacteria 1898
194 Ga0075435_100700258 3300007076 Bacteria 880
195 Ga0075435_100842438 3300007076 Bacteria 799
196 Ga0075435_101133736 3300007076 Bacteria 684
197 Ga0075435_101877306 3300007076 Unclassified 526
198 Ga0099794_10000015 3300007265 Bacteria 80127
199 Ga0099794_10034076 3300007265 Bacteria 2397
200 Ga0099794_10147325 3300007265 Bacteria 1194
201 Ga0099794_10294923 3300007265 Bacteria 839
202 Ga0099794_10328951 3300007265 Unclassified 793
203 Ga0111539_10003768 3300009094 Bacteria 19955
204 Ga0111539_10815606 3300009094 Bacteria 1086
205 Ga0111539_11445465 3300009094 Bacteria 797
206 Ga0111539_11930097 3300009094 Bacteria 685
207 Ga0111539_12316876 3300009094 Bacteria 623
208 Ga0111539_12981176 3300009094 Bacteria 547
209 Ga0105245_10009810 3300009098 Bacteria 8343
210 Ga0105245_10071777 3300009098 Bacteria 3145
211 Ga0105245_10767101 3300009098 Bacteria 1001
212 Ga0105245_11387882 3300009098 Bacteria 752
213 Ga0114129_10079878 3300009147 Bacteria 4547
214 Ga0114129_10283949 3300009147 Unclassified 2211
215 Ga0114129_10458309 3300009147 Bacteria 1671
216 Ga0114129_11417072 3300009147 Unclassified 857
217 Ga0114129_11954517 3300009147 Bacteria 710
218 Ga0114129_12095532 3300009147 Unclassified 682
219 Ga0105243_10984521 3300009148 Bacteria 845
220 Ga0105243_11015160 3300009148 Unclassified 833
221 Ga0105243_11145917 3300009148 Bacteria 788
222 Ga0105241_10084371 3300009174 Bacteria 2494
223 Ga0105241_10954610 3300009174 Bacteria 799
224 Ga0105242_10358132 3300009176 Unclassified 1349
225 Ga0105242_10661461 3300009176 Unclassified 1017
226 Ga0105248_10472944 3300009177 Unclassified 1413
227 Ga0105248_12821590 3300009177 Bacteria 554
228 Ga0105248_13028458 3300009177 Unclassified 535
229 Ga0105237_11774577 3300009545 Bacteria 625
230 Ga0105238_10766842 3300009551 Unclassified 979
231 Ga0105249_10906967 3300009553 Bacteria 948
232 Ga0105249_12176558 3300009553 Unclassified 627
233 Ga0105239_10241240 3300010375 Bacteria 2028
234 Ga0105239_11966633 3300010375 Bacteria 678
235 Ga0105239_12694419 3300010375 Unclassified 580
236 Ga0105246_10029552 3300011119 Bacteria 3611
237 Ga0105246_10257883 3300011119 Bacteria 1387
238 Ga0105246_10594871 3300011119 Unclassified 955
239 Ga0157369_10443746 3300013105 Bacteria 1344
240 Ga0157378_10718045 3300013297 Bacteria 1020
241 Ga0163162_12659019 3300013306 Bacteria 576
242 Ga0157375_10105228 3300013308 Unclassified 2912
243 Ga0157375_10164295 3300013308 Bacteria 2364
244 Ga0157375_13607894 3300013308 Bacteria 515
245 Ga0163163_10095181 3300014325 Bacteria 2998
246 Ga0163163_10600349 3300014325 Bacteria 1164
247 Ga0163163_11474087 3300014325 Bacteria 742
248 Ga0163163_12190301 3300014325 Unclassified 612
249 Ga0157380_13435598 3300014326 Unclassified 507
250 Ga0157380_13494310 3300014326 Bacteria 503
251 Ga0157379_11130342 3300014968 Unclassified 751
252 Ga0157379_11298508 3300014968 Unclassified 703
253 Ga0157379_11956218 3300014968 Unclassified 579
254 Ga0157376_10160230 3300014969 Bacteria 2039
255 Ga0157376_11223376 3300014969 Unclassified 780
256 Ga0207653_10000005 3300025885 Bacteria 257928
257 Ga0207653_10028555 3300025885 Bacteria 1795
258 Ga0207653_10102607 3300025885 Unclassified 1013
259 Ga0207653_10106470 3300025885 Bacteria 997
260 Ga0207692_11052409 3300025898 Bacteria 538
261 Ga0207688_10785303 3300025901 Bacteria 603
262 Ga0207680_11248800 3300025903 Bacteria 529
263 Ga0207685_10205209 3300025905 Bacteria 928
264 Ga0207699_10298287 3300025906 Unclassified 1125
265 Ga0207643_10500119 3300025908 Unclassified 777
266 Ga0207684_10006714 3300025910 Bacteria 10449
267 Ga0207684_10070974 3300025910 Bacteria 2960
268 Ga0207684_10210605 3300025910 Bacteria 1677
269 Ga0207684_10289954 3300025910 Bacteria 1411
270 Ga0207684_10296808 3300025910 Bacteria 1393
271 Ga0207684_10345759 3300025910 Bacteria 1281
272 Ga0207684_10998306 3300025910 Bacteria 700
273 Ga0207684_11184141 3300025910 Unclassified 633
274 Ga0207684_11699924 3300025910 Bacteria 509
275 Ga0207654_10056739 3300025911 Bacteria 2273
276 Ga0207707_10006530 3300025912 Bacteria 10179
277 Ga0207707_10308722 3300025912 Unclassified 1367
278 Ga0207693_10022570 3300025915 Bacteria 5000
279 Ga0207693_10153282 3300025915 Bacteria 1813
280 Ga0207663_11201733 3300025916 Bacteria 610
281 Ga0207663_11617675 3300025916 Unclassified 521
282 Ga0207660_10006097 3300025917 Bacteria 7825
283 Ga0207660_10024169 3300025917 Bacteria 4110
284 Ga0207662_10369265 3300025918 Bacteria 967
285 Ga0207662_10676458 3300025918 Bacteria 722
286 Ga0207657_10285498 3300025919 Bacteria 1309
287 Ga0207649_10717174 3300025920 Unclassified 776
288 Ga0207652_10000845 3300025921 Bacteria 29187
289 Ga0207652_10556089 3300025921 Bacteria 1031
290 Ga0207646_10003801 3300025922 Bacteria 16795
291 Ga0207646_10103820 3300025922 Unclassified 2549
292 Ga0207646_10123499 3300025922 Bacteria 2327
293 Ga0207646_10492587 3300025922 Bacteria 1105
294 Ga0207646_10922219 3300025922 Unclassified 774
295 Ga0207646_10935952 3300025922 Unclassified 768
296 Ga0207694_10558789 3300025924 Unclassified 961
297 Ga0207659_11347255 3300025926 Bacteria 612
298 Ga0207659_11391714 3300025926 Bacteria 601
299 Ga0207687_10005539 3300025927 Bacteria 8348
300 Ga0207687_10411648 3300025927 Bacteria 1114
301 Ga0207687_10430148 3300025927 Unclassified 1091
302 Ga0207700_10923450 3300025928 Unclassified 781
303 Ga0207664_10226094 3300025929 Bacteria 1625
304 Ga0207664_11401594 3300025929 Bacteria 620
305 Ga0207706_10261667 3300025933 Bacteria 1510
306 Ga0207686_10302311 3300025934 Bacteria 1189
307 Ga0207709_10297652 3300025935 Bacteria 1198
308 Ga0207709_10585861 3300025935 Bacteria 881
309 Ga0207709_10906180 3300025935 Bacteria 717
310 Ga0207670_10363001 3300025936 Bacteria 1150
311 Ga0207669_10299248 3300025937 Bacteria 1222
312 Ga0207704_10371066 3300025938 Bacteria 1120
313 Ga0207665_10404772 3300025939 Unclassified 1040
314 Ga0207665_11000300 3300025939 Bacteria 665
315 Ga0207665_11069280 3300025939 Bacteria 643
316 Ga0207711_10096448 3300025941 Bacteria 2610
317 Ga0207711_11415065 3300025941 Bacteria 638
318 Ga0207711_11460219 3300025941 Bacteria 627
319 Ga0207689_10108260 3300025942 Bacteria 2284
320 Ga0207661_10012284 3300025944 Bacteria 6220
321 Ga0207661_11214390 3300025944 Bacteria 694
322 Ga0207679_11769482 3300025945 Unclassified 565
323 Ga0207651_10690479 3300025960 Bacteria 899
324 Ga0207640_10303552 3300025981 Unclassified 1264
325 Ga0207640_10812244 3300025981 Bacteria 811
326 Ga0207658_11480613 3300025986 Unclassified 621
327 Ga0207703_11537163 3300026035 Unclassified 640
328 Ga0207678_10738929 3300026067 Unclassified 867
329 Ga0207708_10180247 3300026075 Bacteria 1677
330 Ga0207708_10292668 3300026075 Bacteria 1322
331 Ga0207702_10004111 3300026078 Bacteria 13059
332 Ga0207702_10039417 3300026078 Bacteria 3958
333 Ga0207641_11002768 3300026088 Unclassified 832
334 Ga0207648_10271930 3300026089 Bacteria 1514
335 Ga0207648_12041901 3300026089 Unclassified 534
336 Ga0207676_10376496 3300026095 Unclassified 1320
337 Ga0207683_10021748 3300026121 Bacteria 5498
338 Ga0207683_10038254 3300026121 Bacteria 4180
339 Ga0207683_10411037 3300026121 Bacteria 1245
340 Ga0209969_1081550 3300027360 Bacteria 518
341 Ga0209588_1000541 3300027671 Bacteria 9704
342 Ga0207428_10008584 3300027907 Bacteria 9220
343 Ga0268264_12679282 3300028381 Bacteria 502
344 Ga0307409_101287572 3300031995 Bacteria 756
345 Ga0307416_100522742 3300032002 Bacteria 1255
346 Ga0307416_102783925 3300032002 Unclassified 585
347 Ga0373928_0105625 3300035084 Bacteria 740
348 Ga0373943_0017137 3300035170 Bacteria 3314
349 Ga0373955_0510819 3300035172 Bacteria 734
350 Ga0373961_0253442 3300035241 Bacteria 638
351 Ga0373935_0944122 3300035692 Bacteria 640
352 Ga0373937_0131903 3300036401 Bacteria 2334
353 Ga0373925_0733032 3300037068 Bacteria 815
354 Ga0395899_0082996 3300037312 Bacteria 2330
355 Ga0395899_0328334 3300037312 Bacteria 1029
356 Ga0395900_0002502 3300037418 Bacteria 20199
357 Ga0395900_0007559 3300037418 Bacteria 11224
358 Ga0395900_0054551 3300037418 Bacteria 4115
359 Ga0395900_0106678 3300037418 Bacteria 2878
360 Ga0395900_0190094 3300037418 Bacteria 2083
361 Ga0395900_0319263 3300037418 Bacteria 1534
362 Ga0395900_0349974 3300037418 Bacteria 1451
363 Ga0395900_0690220 3300037418 Unclassified 955
364 Ga0395900_1141513 3300037418 Bacteria 696
365 Ga0395900_1385031 3300037418 Bacteria 616
366 Ga0395900_1526688 3300037418 Unclassified 580
367 Ga0395900_1625396 3300037418 Bacteria 557
368 Ga0395898_0002628 3300037466 Bacteria 20892
369 Ga0395898_0010897 3300037466 Bacteria 9488
370 Ga0395898_0080159 3300037466 Bacteria 3149
371 Ga0395898_0085001 3300037466 Bacteria 3050
372 Ga0395898_0803160 3300037466 Bacteria 881
373 Ga0395898_1065708 3300037466 Bacteria 742
374 Ga0395905_0003689 3300037471 Bacteria 16209
375 Ga0395905_0009707 3300037471 Bacteria 9391
376 Ga0395905_0230212 3300037471 Bacteria 1733
377 Ga0395905_0603199 3300037471 Bacteria 1000
378 Ga0395905_1201863 3300037471 Bacteria 662
379 Ga0395905_1355168 3300037471 Bacteria 615
380 Ga0395905_1500074 3300037471 Unclassified 578
381 Ga0395901_0002394 3300038443 Bacteria 19063
382 Ga0395901_0004101 3300038443 Bacteria 14687
383 Ga0395901_0006554 3300038443 Bacteria 11774
384 Ga0395901_0045980 3300038443 Bacteria 4533
385 Ga0395901_0072123 3300038443 Bacteria 3599
386 Ga0395901_0168446 3300038443 Bacteria 2299
387 Ga0395901_0180702 3300038443 Bacteria 2213
388 Ga0395901_0268214 3300038443 Bacteria 1776
389 Ga0395901_0375935 3300038443 Bacteria 1463
390 Ga0395901_0472974 3300038443 Bacteria 1279
391 Ga0395901_0916986 3300038443 Bacteria 857
392 Ga0395901_1273188 3300038443 Bacteria 698
393 Ga0451800_0340282 3300041459 Unclassified 699
394 Ga0451807_2148327 3300041486 Archaea 684
395 Ga0451847_0679139 3300041503 Unclassified 766
396 Ga0439434_0056352 3300042435 Bacteria 1224
397 Ga0450918_118375 3300042531 Bacteria 528
398 Ga0451577_0124184 3300042876 Bacteria 2313
399 Ga0453683_0126904 3300044673 Bacteria 1607
400 Ga0453683_0674982 3300044673 Bacteria 676
401 Ga0466960_0055360 3300044901 Bacteria 1929
402 Ga0451576_0007821 3300045051 Bacteria 12667
403 Ga0451576_0021937 3300045051 Bacteria 6932
404 Ga0451576_0171764 3300045051 Bacteria 2262
405 Ga0451576_0254993 3300045051 Bacteria 1833
406 Ga0451576_0388183 3300045051 Bacteria 1463
407 Ga0451576_1185185 3300045051 Unclassified 798
408 Ga0466967_2355488 3300045976 Unclassified 528
409 Ga0495592_0148827 3300046454 Bacteria 1621
410 Ga0495603_0022075 3300046455 Bacteria 3854
411 Ga0495603_0023420 3300046455 Bacteria 3737
412 Ga0495590_0190284 3300046457 Unclassified 752
413 Ga0495629_1026746 3300046459 Unclassified 536
414 Ga0495641_0143644 3300046461 Bacteria 1066
415 Ga0495582_0006708 3300046473 Bacteria 6397
416 Ga0495662_0132691 3300046476 Bacteria 1225
417 Ga0495662_0258697 3300046476 Unclassified 857
418 Ga0495664_0328062 3300046477 Bacteria 923
419 Ga0495584_0154635 3300046491 Bacteria 1165
420 Ga0495584_0174388 3300046491 Bacteria 1093
421 Ga0495585_0045528 3300046492 Bacteria 2449
422 Ga0495585_0107592 3300046492 Unclassified 1486
423 Ga0495585_0269715 3300046492 Bacteria 844
424 Ga0495594_0328344 3300046499 Bacteria 871
425 Ga0495596_0045763 3300046500 Bacteria 1720
426 Ga0495596_0056931 3300046500 Bacteria 1526
427 Ga0495596_0320552 3300046500 Unclassified 603
428 Ga0495607_0352443 3300046501 Bacteria 679
429 Ga0495583_0433564 3300046506 Unclassified 515
430 Ga0495616_0058094 3300046513 Bacteria 1906
431 Ga0495620_0328356 3300046515 Unclassified 581
432 Ga0495630_1047277 3300046517 Bacteria 619
433 Ga0495631_0198554 3300046518 Unclassified 858
434 Ga0495631_0492486 3300046518 Unclassified 522
435 Ga0495632_0459512 3300046519 Unclassified 552
436 Ga0495644_0238090 3300046523 Bacteria 706
437 Ga0495644_0252724 3300046523 Bacteria 685
438 Ga0495644_0253504 3300046523 Bacteria 684
439 Ga0495663_0199456 3300046525 Bacteria 698
440 Ga0495663_0257776 3300046525 Unclassified 621
441 Ga0495663_0318694 3300046525 Bacteria 562
442 Ga0495666_0546582 3300046526 Unclassified 517
443 Ga0495642_0168473 3300046528 Bacteria 951
444 Ga0495642_0252638 3300046528 Unclassified 771
445 Ga0495642_0310421 3300046528 Unclassified 691
446 Ga0495654_0447067 3300046530 Bacteria 509
447 Ga0495598_0240938 3300046537 Bacteria 667
448 Ga0495598_0325336 3300046537 Bacteria 587
449 Ga0495598_0399533 3300046537 Bacteria 537
450 Ga0495609_0041283 3300046538 Bacteria 2074
451 Ga0495609_0088616 3300046538 Bacteria 1347
452 Ga0495609_0149601 3300046538 Bacteria 993
453 Ga0495609_0411243 3300046538 Unclassified 541
454 Ga0495621_0097724 3300046539 Bacteria 1114
455 Ga0495621_0267062 3300046539 Bacteria 702
456 Ga0495621_0443997 3300046539 Unclassified 555
457 Ga0495656_0018342 3300046615 Bacteria 2685
458 Ga0495656_0067423 3300046615 Bacteria 1579
459 Ga0495656_0421503 3300046615 Unclassified 700
460 Ga0495656_0450541 3300046615 Bacteria 678
461 Ga0495656_0713830 3300046615 Bacteria 540
462 Ga0495656_0718572 3300046615 Bacteria 538
463 Ga0495656_0747585 3300046615 Unclassified 527
464 Ga0495668_0182064 3300046616 Bacteria 1151
465 Ga0495634_0031690 3300046642 Unclassified 3640
466 Ga0495611_0313812 3300046648 Bacteria 722
467 Ga0495659_0011492 3300046664 Bacteria 2853
468 Ga0495659_0053957 3300046664 Bacteria 1470
469 Ga0495659_0183192 3300046664 Unclassified 853
470 Ga0495659_0247391 3300046664 Unclassified 742
471 Ga0495659_0406105 3300046664 Unclassified 588
472 Ga0495661_0616459 3300046665 Unclassified 509
473 Ga0495588_0461615 3300046674 Bacteria 666
474 Ga0495588_0764302 3300046674 Bacteria 505
475 Ga0495647_0012783 3300046681 Bacteria 2896
476 Ga0495647_0029246 3300046681 Bacteria 2037
477 Ga0495647_0040215 3300046681 Bacteria 1776
478 Ga0495658_0128999 3300046683 Bacteria 1537
479 Ga0495669_0269357 3300046684 Bacteria 819
480 Ga0495669_0391630 3300046684 Bacteria 673
481 Ga0495669_0488314 3300046684 Bacteria 599
482 Ga0495613_0029171 3300046689 Bacteria 4103
483 Ga0495613_0979522 3300046689 Bacteria 544
484 Ga0495670_0109282 3300046691 Bacteria 1430
485 Ga0495670_0262500 3300046691 Bacteria 922
486 Ga0495671_0388972 3300046692 Unclassified 668
487 Ga0495671_0442060 3300046692 Unclassified 622
488 Ga0495589_0051100 3300046794 Bacteria 2044
489 Ga0495589_0195575 3300046794 Bacteria 956
490 Ga0495589_0266345 3300046794 Bacteria 798
491 Ga0495581_0031266 3300047315 Bacteria 3085
492 Ga0495581_0279134 3300047315 Bacteria 977
493 Ga0495636_0124205 3300047318 Bacteria 1144
494 Ga0495636_0522878 3300047318 Unclassified 575
495 Ga0495674_0104981 3300047319 Bacteria 2402
496 Ga0495676_0050600 3300047321 Bacteria 3331
497 Ga0495676_0854551 3300047321 Bacteria 584
498 Ga0495680_0062751 3300047322 Bacteria 2856
499 Ga0495680_0549498 3300047322 Bacteria 778
500 Ga0495677_0012583 3300047445 Bacteria 3085
501 Ga0495679_096074 3300047446 Bacteria 827
502 Ga0495685_045421 3300047447 Bacteria 1496
503 Ga0495684_0398349 3300047471 Bacteria 967
504 Ga0495684_0795282 3300047471 Unclassified 618
505 Ga0496100_0003614 3300048903 Bacteria 8074
506 Ga0496100_0690034 3300048903 Unclassified 796
507 Ga0496101_0000920 3300048904 Bacteria 17369
508 Ga0496101_0059236 3300048904 Bacteria 2775
509 Ga0496101_0167052 3300048904 Bacteria 1690
510 Ga0496101_0244398 3300048904 Bacteria 1397
511 Ga0496101_0366175 3300048904 Unclassified 1133
512 Ga0496101_1180051 3300048904 Unclassified 600
513 Ga0496102_0011412 3300048905 Bacteria 7658
514 Ga0496102_0029921 3300048905 Bacteria 4873
515 Ga0496102_1903175 3300048905 Unclassified 511
516 Ga0496103_0002423 3300048906 Bacteria 11733
517 Ga0496103_0149915 3300048906 Bacteria 1494
518 Ga0496103_0200375 3300048906 Bacteria 1284
519 Ga0496103_0431120 3300048906 Unclassified 846
520 Ga0496104_0000283 3300048907 Bacteria 44806
521 Ga0496104_0003705 3300048907 Bacteria 13190
522 Ga0496104_0005790 3300048907 Bacteria 10819
523 Ga0496104_0158250 3300048907 Unclassified 2174
524 Ga0496104_0469699 3300048907 Bacteria 1169
525 Ga0496104_0504740 3300048907 Bacteria 1121
526 Ga0496104_0966619 3300048907 Unclassified 756
527 Ga0496104_0999806 3300048907 Bacteria 740
528 Ga0496105_0000464 3300048908 Bacteria 26670
529 Ga0496105_0005049 3300048908 Bacteria 9996
530 Ga0496105_0007098 3300048908 Bacteria 8639
531 Ga0496105_0051963 3300048908 Bacteria 3384
532 Ga0496105_0113912 3300048908 Bacteria 2231
533 Ga0496105_0488772 3300048908 Bacteria 968
534 Ga0496106_0867408 3300048909 Bacteria 714
535 Ga0496106_1027429 3300048909 Bacteria 648
536 Ga0496106_1313565 3300048909 Unclassified 561
537 Ga0496106_1391882 3300048909 Bacteria 542
538 Ga0496107_0205150 3300048910 Bacteria 1465
539 Ga0496107_0334703 3300048910 Bacteria 1126
540 Ga0496107_0352965 3300048910 Unclassified 1094
541 Ga0496107_1241237 3300048910 Bacteria 535
542 Ga0496107_1382488 3300048910 Bacteria 502
543 Ga0496108_0004985 3300048911 Bacteria 10731
544 Ga0496108_0019487 3300048911 Bacteria 5572
545 Ga0496108_0037303 3300048911 Bacteria 4047
546 Ga0496108_0165263 3300048911 Bacteria 1913
547 Ga0496108_0378438 3300048911 Unclassified 1236
548 Ga0496108_1561120 3300048911 Bacteria 547
549 Ga0496109_0000801 3300048912 Bacteria 26213
550 Ga0496109_0001949 3300048912 Bacteria 17135
551 Ga0496109_0003556 3300048912 Bacteria 13009
552 Ga0496109_0251621 3300048912 Archaea 1664
553 Ga0496109_0392230 3300048912 Bacteria 1312
554 Ga0496109_0396562 3300048912 Unclassified 1304
555 Ga0496109_0421995 3300048912 Bacteria 1260
556 Ga0496109_0584091 3300048912 Bacteria 1053
557 Ga0496109_1535064 3300048912 Bacteria 601
558 Ga0496110_0000198 3300048913 Bacteria 38202
559 Ga0496110_0068801 3300048913 Unclassified 3134
560 Ga0496110_0351886 3300048913 Bacteria 1342
561 Ga0496110_0421278 3300048913 Unclassified 1217
562 Ga0496110_0490942 3300048913 Unclassified 1118
563 Ga0496110_0508389 3300048913 Bacteria 1096
564 Ga0496110_0616117 3300048913 Bacteria 984
565 Ga0496110_1354434 3300048913 Bacteria 621
566 Ga0496111_0003476 3300048914 Bacteria 9749
567 Ga0496111_0015827 3300048914 Bacteria 5187
568 Ga0496111_0040418 3300048914 Unclassified 3345
569 Ga0496111_0049673 3300048914 Bacteria 3025
570 Ga0496111_0062414 3300048914 Bacteria 2702
571 Ga0496111_0237748 3300048914 Bacteria 1353
572 Ga0496111_0367977 3300048914 Bacteria 1064
573 Ga0496111_1229208 3300048914 Unclassified 530
574 Ga0496112_0018974 3300048915 Bacteria 6483
575 Ga0496112_0272506 3300048915 Unclassified 1641
576 Ga0496112_0363410 3300048915 Unclassified 1389
577 Ga0496112_0417809 3300048915 Bacteria 1280
578 Ga0496112_0529894 3300048915 Bacteria 1112
579 Ga0496112_0679672 3300048915 Bacteria 958
580 Ga0496112_1223086 3300048915 Unclassified 668
581 Ga0496113_0006862 3300048916 Bacteria 7263
582 Ga0496113_0017920 3300048916 Bacteria 4924
583 Ga0496113_0484708 3300048916 Bacteria 993
584 Ga0496113_0502067 3300048916 Unclassified 974
585 Ga0496113_0603259 3300048916 Unclassified 879
586 Ga0496113_0982057 3300048916 Bacteria 666
587 Ga0496113_1496354 3300048916 Bacteria 521
588 Ga0496114_0001179 3300048917 Bacteria 19806
589 Ga0496114_0008595 3300048917 Bacteria 8093
590 Ga0496114_0068411 3300048917 Bacteria 2981
591 Ga0496114_0224143 3300048917 Bacteria 1651
592 Ga0496114_0836760 3300048917 Unclassified 800
593 Ga0496115_0040738 3300048918 Bacteria 3694
594 Ga0496115_0198076 3300048918 Bacteria 1659
595 Ga0501297_056002 3300049520 Unclassified 592
596 Ga0501032_0663898 3300049569 Bacteria 662
597 Ga0501036_0345286 3300049572 Unclassified 1243
598 Ga0501036_0766286 3300049572 Unclassified 796
599 Ga0501037_0973124 3300049573 Bacteria 554
600 Ga0501039_0264919 3300049575 Unclassified 1351
601 Ga0501039_0431368 3300049575 Unclassified 1035
602 Ga0501039_0765511 3300049575 Bacteria 754
603 Ga0501040_0012960 3300049576 Bacteria 5480
604 Ga0501040_0031609 3300049576 Bacteria 3579
605 Ga0501040_0216650 3300049576 Unclassified 1362
606 Ga0501040_0293529 3300049576 Bacteria 1162
607 Ga0501041_0090603 3300049577 Bacteria 1888
608 Ga0501041_0117460 3300049577 Bacteria 1652
609 Ga0501041_0389893 3300049577 Bacteria 882
610 Ga0501042_1061640 3300049578 Unclassified 590
611 Ga0501042_1119494 3300049578 Bacteria 574
612 Ga0501043_0706351 3300049579 Bacteria 736
613 Ga0501043_0878449 3300049579 Unclassified 644
614 Ga0501043_1088843 3300049579 Bacteria 565
615 Ga0501046_1278645 3300049580 Unclassified 502
616 Ga0501048_0413276 3300049582 Unclassified 965
617 Ga0501048_1189930 3300049582 Bacteria 548
618 Ga0501067_0058709 3300049583 Bacteria 2130
619 Ga0501067_0116024 3300049583 Unclassified 1489
620 Ga0501067_0809148 3300049583 Bacteria 528
621 Ga0501068_0262801 3300049584 Unclassified 1101
622 Ga0501069_0048677 3300049585 Bacteria 2355
623 Ga0501071_0046241 3300049587 Bacteria 3126
624 Ga0501071_0112547 3300049587 Unclassified 2013
625 Ga0501071_0119481 3300049587 Bacteria 1953
626 Ga0501071_0590057 3300049587 Unclassified 854
627 Ga0501072_0067370 3300049588 Bacteria 2825
628 Ga0501072_0093538 3300049588 Bacteria 2388
629 Ga0501072_0175939 3300049588 Unclassified 1707
630 Ga0501075_0025202 3300049591 Bacteria 4370
631 Ga0501075_0078368 3300049591 Bacteria 2501
632 Ga0501075_0134240 3300049591 Bacteria 1885
633 Ga0501075_0401676 3300049591 Bacteria 1045
634 Ga0501075_0752057 3300049591 Bacteria 742
635 Ga0501075_0827378 3300049591 Unclassified 704
636 Ga0501075_0871027 3300049591 Unclassified 685
637 Ga0501076_0020972 3300049592 Bacteria 5006
638 Ga0501076_0275097 3300049592 Bacteria 1379
639 Ga0501076_0700876 3300049592 Unclassified 836
640 Ga0501076_0740357 3300049592 Bacteria 811
641 Ga0501077_0125238 3300049593 Bacteria 1629
642 Ga0501077_0411019 3300049593 Bacteria 865
643 Ga0501077_0514216 3300049593 Unclassified 768
644 Ga0501079_0098937 3300049741 Unclassified 2261
645 Ga0501079_0467365 3300049741 Bacteria 991
646 Ga0501080_0739146 3300049742 Unclassified 866
647 Ga0501081_0113460 3300049743 Bacteria 1924
648 Ga0501081_0342041 3300049743 Unclassified 1102
649 Ga0501083_0365825 3300049744 Bacteria 938
650 Ga0501035_0271020 3300049822 Bacteria 1437
651 Ga0501045_0026948 3300049824 Bacteria 4137
652 Ga0501045_0045942 3300049824 Bacteria 3180
653 Ga0501045_0210964 3300049824 Unclassified 1447
654 Ga0501045_0581503 3300049824 Bacteria 830
655 nmdc:mga04h51_84818_c1 3300050495 Bacteria 1130
656 nmdc:mga05p37_1317228_c1 3300050507 Bacteria 735
657 nmdc:mga05p37_213080_c1 3300050507 Unclassified 2334
658 nmdc:mga05p37_300944_c1 3300050507 Bacteria 1905
659 nmdc:mga05p37_712864_c1 3300050507 Unclassified 1112
660 nmdc:mga09592_598_c1 3300050508 Bacteria 27378
661 nmdc:mga0qj67_334079_c1 3300050509 Unclassified 1226
662 nmdc:mga0qj67_60034_c1 3300050509 Bacteria 3016
663 nmdc:mga06r32_1590996_c1 3300050510 Unclassified 592
664 nmdc:mga06r32_1683387_c1 3300050510 Bacteria 572
665 nmdc:mga06r32_1771928_c1 3300050510 Bacteria 553
666 nmdc:mga06r32_2012375_c1 3300050510 Bacteria 511
667 nmdc:mga06r32_30602_c1 3300050510 Bacteria 5051
668 nmdc:mga06r32_583228_c1 3300050510 Bacteria 1090
669 nmdc:mga06r32_886635_c1 3300050510 Bacteria 849
670 nmdc:mga06r32_995614_c1 3300050510 Bacteria 791
671 nmdc:mga08y16_1047668_c1 3300050511 Unclassified 793
672 nmdc:mga08y16_1512511_c1 3300050511 Bacteria 631
673 nmdc:mga08y16_413279_c1 3300050511 Bacteria 1379
674 nmdc:mga08y16_46733_c1 3300050511 Unclassified 4532
675 nmdc:mga0n895_10047_c1 3300050512 Bacteria 8329
676 nmdc:mga0n895_1080421_c1 3300050512 Bacteria 780
677 nmdc:mga0n895_1697702_c1 3300050512 Bacteria 594
678 nmdc:mga0n895_21073_c1 3300050512 Bacteria 6091
679 nmdc:mga0n895_380881_c1 3300050512 Unclassified 1428
680 nmdc:mga0n895_680671_c1 3300050512 Bacteria 1026
681 nmdc:mga0n895_756693_c1 3300050512 Unclassified 964
682 nmdc:mga0n895_8415_c1 3300050512 Bacteria 8929
683 nmdc:mga0n895_844390_c1 3300050512 Bacteria 904
684 nmdc:mga0n895_873077_c1 3300050512 Bacteria 886
685 nmdc:mga0n895_953926_c1 3300050512 Unclassified 841
686 nmdc:mga0rr50_2019_c1 3300050513 Bacteria 11303
687 nmdc:mga0rr50_382632_c1 3300050513 Bacteria 1187
688 nmdc:mga0rr50_45616_c1 3300050513 Bacteria 3223
689 nmdc:mga0rr50_499420_c1 3300050513 Bacteria 1034
690 nmdc:mga0rr50_771695_c1 3300050513 Bacteria 820
691 nmdc:mga0rr50_79440_c1 3300050513 Bacteria 2527
692 nmdc:mga0rr50_897196_c1 3300050513 Bacteria 756
693 nmdc:mga0rr50_911278_c1 3300050513 Bacteria 749
694 nmdc:mga08x19_112051_c1 3300050514 Bacteria 1821
695 nmdc:mga08x19_150073_c1 3300050514 Bacteria 1578
696 nmdc:mga08x19_256003_c1 3300050514 Bacteria 1209
697 nmdc:mga08x19_40988_c1 3300050514 Unclassified 2949
698 nmdc:mga0a205_140348_c1 3300050515 Bacteria 2317
699 nmdc:mga0a205_166406_c1 3300050515 Bacteria 2100
700 nmdc:mga0a205_234657_c1 3300050515 Bacteria 1717
701 nmdc:mga0a205_58613_c2 3300050515 Unclassified 2745
702 nmdc:mga0a205_6284_c1 3300050515 Bacteria 10722
703 Ga0495612_0279954 3300053078 Bacteria 745
704 Ga0495655_0312885 3300053083 Unclassified 542
705 Ga0495619_0331208 3300053085 Unclassified 1054
706 Ga0501084_0139689 3300054114 Bacteria 2040
707 Ga0501084_0272490 3300054114 Unclassified 1429
708 Ga0501082_0039156 3300060353 Bacteria 4090
709 Ga0501082_0263682 3300060353 Unclassified 1499
710 Ga0501082_1224398 3300060353 Unclassified 656
711 Ga0530510_0043913 3300061734 Bacteria 3229
712 Ga0530510_0098201 3300061734 Bacteria 2141
713 Ga0530510_0371170 3300061734 Bacteria 1076
714 Ga0530510_0693638 3300061734 Unclassified 776
715 Ga0530510_0696667 3300061734 Bacteria 774
716 Ga0530510_0827290 3300061734 Bacteria 707
717 Ga0501069_0279796
718 rootL2_10301789
719 Ga0070690_100346472
720 Ga0070690_101423652
721 Ga0068869_100801970
722 Ga0070680_100021495
723 Ga0070680_100037189
724 Ga0070682_100049009
725 Ga0070682_102003697
726 Ga0068868_100588019
727 Ga0070660_101828276
728 Ga0070689_100648573
729 Ga0070691_10031861
730 Ga0070691_10587440
731 Ga0070687_100208408
732 Ga0070661_100794294
733 Ga0070675_100266215
734 Ga0070675_101599667
735 Ga0070671_100400417
736 Ga0070671_100709168
737 Ga0070674_100184560
738 Ga0070673_100231623
739 Ga0070688_100083307
740 Ga0070688_101161929
741 Ga0070659_100464585
742 Ga0070703_10000230
743 Ga0070703_10006711
744 Ga0070703_10282840
745 Ga0070703_10616936
746 Ga0070709_10807829
747 Ga0070713_100490178
748 Ga0070713_101203960
749 Ga0070701_10043208
750 Ga0070701_10988496
751 Ga0070705_100035845
752 Ga0070705_100219478
753 Ga0070705_100257360
754 Ga0070705_100913776
755 Ga0070705_101085048
756 Ga0070705_101390365
757 Ga0070700_100163385
758 Ga0070694_100011445
759 Ga0070694_100013517
760 Ga0070694_100019602
761 Ga0070694_100071888
762 Ga0070694_100910146
763 Ga0070708_100005088
764 Ga0070708_100008231
765 Ga0070708_100020929
766 Ga0070708_100045978
767 Ga0070708_100088049
768 Ga0070708_100316883
769 Ga0070708_100557261
770 Ga0070708_100657692
771 Ga0070708_101022635
772 Ga0070708_102033887
773 Ga0070678_100598486
774 Ga0070678_101964580
775 Ga0070662_100245297
776 Ga0070681_10038394
777 Ga0068867_100228489
778 Ga0070706_100003964
779 Ga0070706_100005843
780 Ga0070706_100086419
781 Ga0070706_100110911
782 Ga0070706_100166188
783 Ga0070706_100174314
784 Ga0070706_100847532
785 Ga0070706_100968346
786 Ga0070706_101015547
787 Ga0070707_100039633
788 Ga0070707_100062881
789 Ga0070707_100079243
790 Ga0070707_100109752
791 Ga0070707_100218829
792 Ga0070707_100712498
793 Ga0070707_100719969
794 Ga0070707_100851914
795 Ga0070707_101148564
796 Ga0070707_101315166
797 Ga0070707_101505653
798 Ga0070698_100000025
799 Ga0070698_100019797
800 Ga0070698_100020843
801 Ga0070698_100049839
802 Ga0070698_100159402
803 Ga0070698_100207207
804 Ga0070698_100225760
805 Ga0070698_100542199
806 Ga0070698_100738720
807 Ga0070698_101392850
808 Ga0070698_101952554
809 Ga0070699_100008464
810 Ga0070699_100019885
811 Ga0070699_100020840
812 Ga0070699_100043530
813 Ga0070699_100096038
814 Ga0070699_100281956
815 Ga0070699_100963748
816 Ga0070699_101084661
817 Ga0070699_102160615
818 Ga0070679_100004051
819 Ga0070679_100116366
820 Ga0070679_100718104
821 Ga0070679_101811335
822 Ga0070684_100000243
823 Ga0070697_100006092
824 Ga0070697_100015617
825 Ga0070697_100029743
826 Ga0070697_100061447
827 Ga0070697_100073417
828 Ga0070697_100103672
829 Ga0070697_100249529
830 Ga0070697_100264450
831 Ga0070697_100468514
832 Ga0070697_100688159
833 Ga0070686_100131230
834 Ga0070695_100017169
835 Ga0070695_100047463
836 Ga0070695_100132138
837 Ga0070695_100528074
838 Ga0070695_100960886
839 Ga0070696_100004243
840 Ga0070696_100004674
841 Ga0070696_100016063
842 Ga0070696_100077285
843 Ga0070696_100284976
844 Ga0070696_100342402
845 Ga0070693_100025481
846 Ga0070693_101016727
847 Ga0070693_101134233
848 Ga0070704_100005113
849 Ga0070704_100007606
850 Ga0070704_100019184
851 Ga0070704_100165209
852 Ga0070704_100577683
853 Ga0070704_100922143
854 Ga0068854_100262139
855 Ga0068856_100011791
856 Ga0068856_100407099
857 Ga0070702_100127794
858 Ga0070702_100199685
859 Ga0068859_100950470
860 Ga0068864_100393385
861 Ga0068861_102656397
862 Ga0068863_102354467
863 Ga0068858_101400063
864 Ga0068858_102063033
865 Ga0081455_10103667
866 Ga0081455_10457626
867 Ga0081455_10708394
868 Ga0081539_10121156
869 Ga0070717_10320257
870 Ga0070717_10836023
871 Ga0075363_100758437
872 Ga0070715_10734436
873 Ga0070716_100422808
874 Ga0070716_100473010
875 Ga0070712_100152461
876 Ga0070712_100247350
877 Ga0068871_100119122
878 Ga0075428_100013124
879 Ga0075428_100080558
880 Ga0075428_101829466
881 Ga0075428_101886126
882 Ga0075428_102467147
883 Ga0075430_100071797
884 Ga0075430_100261163
885 Ga0075431_100992218
886 Ga0075431_101111585
887 Ga0075431_101552248
888 Ga0075431_101671457
889 Ga0075433_10013586
890 Ga0075433_10024662
891 Ga0075433_10025253
892 Ga0075433_10085645
893 Ga0075433_10161375
894 Ga0075433_11817977
895 Ga0075434_100008712
896 Ga0075434_100034322
897 Ga0075434_100127360
898 Ga0075434_100128594
899 Ga0075434_100983181
900 Ga0075434_101676893
901 Ga0075429_101442844
902 Ga0075436_100035772
903 Ga0075436_100046644
904 Ga0075436_100162058
905 Ga0075436_100366140
906 Ga0097620_100950399
907 Ga0075435_100069048
908 Ga0075435_100080524
909 Ga0075435_100159717
910 Ga0075435_100700258
911 Ga0075435_100842438
912 Ga0075435_101133736
913 Ga0075435_101877306
914 Ga0099794_10000015
915 Ga0099794_10034076
916 Ga0099794_10147325
917 Ga0099794_10294923
918 Ga0099794_10328951
919 Ga0111539_10003768
920 Ga0111539_10815606
921 Ga0111539_11445465
922 Ga0111539_11930097
923 Ga0111539_12316876
924 Ga0111539_12981176
925 Ga0105245_10009810
926 Ga0105245_10071777
927 Ga0105245_10767101
928 Ga0105245_11387882
929 Ga0114129_10079878
930 Ga0114129_10283949
931 Ga0114129_10458309
932 Ga0114129_11417072
933 Ga0114129_11954517
934 Ga0114129_12095532
935 Ga0105243_10984521
936 Ga0105243_11015160
937 Ga0105243_11145917
938 Ga0105241_10084371
939 Ga0105241_10954610
940 Ga0105242_10358132
941 Ga0105242_10661461
942 Ga0105248_10472944
943 Ga0105248_12821590
944 Ga0105248_13028458
945 Ga0105237_11774577
946 Ga0105238_10766842
947 Ga0105249_10906967
948 Ga0105249_12176558
949 Ga0105239_10241240
950 Ga0105239_11966633
951 Ga0105239_12694419
952 Ga0105246_10029552
953 Ga0105246_10257883
954 Ga0105246_10594871
955 Ga0157369_10443746
956 Ga0157378_10718045
957 Ga0163162_12659019
958 Ga0157375_10105228
959 Ga0157375_10164295
960 Ga0157375_13607894
961 Ga0163163_10095181
962 Ga0163163_10600349
963 Ga0163163_11474087
964 Ga0163163_12190301
965 Ga0157380_13435598
966 Ga0157380_13494310
967 Ga0157379_11130342
968 Ga0157379_11298508
969 Ga0157379_11956218
970 Ga0157376_10160230
971 Ga0157376_11223376
972 Ga0207653_10000005
973 Ga0207653_10028555
974 Ga0207653_10102607
975 Ga0207653_10106470
976 Ga0207692_11052409
977 Ga0207688_10785303
978 Ga0207680_11248800
979 Ga0207685_10205209
980 Ga0207699_10298287
981 Ga0207643_10500119
982 Ga0207684_10006714
983 Ga0207684_10070974
984 Ga0207684_10210605
985 Ga0207684_10289954
986 Ga0207684_10296808
987 Ga0207684_10345759
988 Ga0207684_10998306
989 Ga0207684_11184141
990 Ga0207684_11699924
991 Ga0207654_10056739
992 Ga0207707_10006530
993 Ga0207707_10308722
994 Ga0207693_10022570
995 Ga0207693_10153282
996 Ga0207663_11201733
997 Ga0207663_11617675
998 Ga0207660_10006097
999 Ga0207660_10024169
1000 Ga0207662_10369265
1001 Ga0207662_10676458
1002 Ga0207657_10285498
1003 Ga0207649_10717174
1004 Ga0207652_10000845
1005 Ga0207652_10556089
1006 Ga0207646_10003801
1007 Ga0207646_10103820
1008 Ga0207646_10123499
1009 Ga0207646_10492587
1010 Ga0207646_10922219
1011 Ga0207646_10935952
1012 Ga0207694_10558789
1013 Ga0207659_11347255
1014 Ga0207659_11391714
1015 Ga0207687_10005539
1016 Ga0207687_10411648
1017 Ga0207687_10430148
1018 Ga0207700_10923450
1019 Ga0207664_10226094
1020 Ga0207664_11401594
1021 Ga0207706_10261667
1022 Ga0207686_10302311
1023 Ga0207709_10297652
1024 Ga0207709_10585861
1025 Ga0207709_10906180
1026 Ga0207670_10363001
1027 Ga0207669_10299248
1028 Ga0207704_10371066
1029 Ga0207665_10404772
1030 Ga0207665_11000300
1031 Ga0207665_11069280
1032 Ga0207711_10096448
1033 Ga0207711_11415065
1034 Ga0207711_11460219
1035 Ga0207689_10108260
1036 Ga0207661_10012284
1037 Ga0207661_11214390
1038 Ga0207679_11769482
1039 Ga0207651_10690479
1040 Ga0207640_10303552
1041 Ga0207640_10812244
1042 Ga0207658_11480613
1043 Ga0207703_11537163
1044 Ga0207678_10738929
1045 Ga0207708_10180247
1046 Ga0207708_10292668
1047 Ga0207702_10004111
1048 Ga0207702_10039417
1049 Ga0207641_11002768
1050 Ga0207648_10271930
1051 Ga0207648_12041901
1052 Ga0207676_10376496
1053 Ga0207683_10021748
1054 Ga0207683_10038254
1055 Ga0207683_10411037
1056 Ga0209969_1081550
1057 Ga0209588_1000541
1058 Ga0207428_10008584
1059 Ga0268264_12679282
1060 Ga0307409_101287572
1061 Ga0307416_100522742
1062 Ga0307416_102783925
1063 Ga0373928_0105625
1064 Ga0373943_0017137
1065 Ga0373955_0510819
1066 Ga0373961_0253442
1067 Ga0373935_0944122
1068 Ga0373937_0131903
1069 Ga0373925_0733032
1070 Ga0395899_0082996
1071 Ga0395899_0328334
1072 Ga0395900_0002502
1073 Ga0395900_0007559
1074 Ga0395900_0054551
1075 Ga0395900_0106678
1076 Ga0395900_0190094
1077 Ga0395900_0319263
1078 Ga0395900_0349974
1079 Ga0395900_0690220
1080 Ga0395900_1141513
1081 Ga0395900_1385031
1082 Ga0395900_1526688
1083 Ga0395900_1625396
1084 Ga0395898_0002628
1085 Ga0395898_0010897
1086 Ga0395898_0080159
1087 Ga0395898_0085001
1088 Ga0395898_0803160
1089 Ga0395898_1065708
1090 Ga0395905_0003689
1091 Ga0395905_0009707
1092 Ga0395905_0230212
1093 Ga0395905_0603199
1094 Ga0395905_1201863
1095 Ga0395905_1355168
1096 Ga0395905_1500074
1097 Ga0395901_0002394
1098 Ga0395901_0004101
1099 Ga0395901_0006554
1100 Ga0395901_0045980
1101 Ga0395901_0072123
1102 Ga0395901_0168446
1103 Ga0395901_0180702
1104 Ga0395901_0268214
1105 Ga0395901_0375935
1106 Ga0395901_0472974
1107 Ga0395901_0916986
1108 Ga0395901_1273188
1109 Ga0451800_0340282
1110 Ga0451807_2148327
1111 Ga0451847_0679139
1112 Ga0439434_0056352
1113 Ga0450918_118375
1114 Ga0451577_0124184
1115 Ga0453683_0126904
1116 Ga0453683_0674982
1117 Ga0466960_0055360
1118 Ga0451576_0007821
1119 Ga0451576_0021937
1120 Ga0451576_0171764
1121 Ga0451576_0254993
1122 Ga0451576_0388183
1123 Ga0451576_1185185
1124 Ga0466967_2355488
1125 Ga0495592_0148827
1126 Ga0495603_0022075
1127 Ga0495603_0023420
1128 Ga0495590_0190284
1129 Ga0495629_1026746
1130 Ga0495641_0143644
1131 Ga0495582_0006708
1132 Ga0495662_0132691
1133 Ga0495662_0258697
1134 Ga0495664_0328062
1135 Ga0495584_0154635
1136 Ga0495584_0174388
1137 Ga0495585_0045528
1138 Ga0495585_0107592
1139 Ga0495585_0269715
1140 Ga0495594_0328344
1141 Ga0495596_0045763
1142 Ga0495596_0056931
1143 Ga0495596_0320552
1144 Ga0495607_0352443
1145 Ga0495583_0433564
1146 Ga0495616_0058094
1147 Ga0495620_0328356
1148 Ga0495630_1047277
1149 Ga0495631_0198554
1150 Ga0495631_0492486
1151 Ga0495632_0459512
1152 Ga0495644_0238090
1153 Ga0495644_0252724
1154 Ga0495644_0253504
1155 Ga0495663_0199456
1156 Ga0495663_0257776
1157 Ga0495663_0318694
1158 Ga0495666_0546582
1159 Ga0495642_0168473
1160 Ga0495642_0252638
1161 Ga0495642_0310421
1162 Ga0495654_0447067
1163 Ga0495598_0240938
1164 Ga0495598_0325336
1165 Ga0495598_0399533
1166 Ga0495609_0041283
1167 Ga0495609_0088616
1168 Ga0495609_0149601
1169 Ga0495609_0411243
1170 Ga0495621_0097724
1171 Ga0495621_0267062
1172 Ga0495621_0443997
1173 Ga0495656_0018342
1174 Ga0495656_0067423
1175 Ga0495656_0421503
1176 Ga0495656_0450541
1177 Ga0495656_0713830
1178 Ga0495656_0718572
1179 Ga0495656_0747585
1180 Ga0495668_0182064
1181 Ga0495634_0031690
1182 Ga0495611_0313812
1183 Ga0495659_0011492
1184 Ga0495659_0053957
1185 Ga0495659_0183192
1186 Ga0495659_0247391
1187 Ga0495659_0406105
1188 Ga0495661_0616459
1189 Ga0495588_0461615
1190 Ga0495588_0764302
1191 Ga0495647_0012783
1192 Ga0495647_0029246
1193 Ga0495647_0040215
1194 Ga0495658_0128999
1195 Ga0495669_0269357
1196 Ga0495669_0391630
1197 Ga0495669_0488314
1198 Ga0495613_0029171
1199 Ga0495613_0979522
1200 Ga0495670_0109282
1201 Ga0495670_0262500
1202 Ga0495671_0388972
1203 Ga0495671_0442060
1204 Ga0495589_0051100
1205 Ga0495589_0195575
1206 Ga0495589_0266345
1207 Ga0495581_0031266
1208 Ga0495581_0279134
1209 Ga0495636_0124205
1210 Ga0495636_0522878
1211 Ga0495674_0104981
1212 Ga0495676_0050600
1213 Ga0495676_0854551
1214 Ga0495680_0062751
1215 Ga0495680_0549498
1216 Ga0495677_0012583
1217 Ga0495679_096074
1218 Ga0495685_045421
1219 Ga0495684_0398349
1220 Ga0495684_0795282
1221 Ga0496100_0003614
1222 Ga0496100_0690034
1223 Ga0496101_0000920
1224 Ga0496101_0059236
1225 Ga0496101_0167052
1226 Ga0496101_0244398
1227 Ga0496101_0366175
1228 Ga0496101_1180051
1229 Ga0496102_0011412
1230 Ga0496102_0029921
1231 Ga0496102_1903175
1232 Ga0496103_0002423
1233 Ga0496103_0149915
1234 Ga0496103_0200375
1235 Ga0496103_0431120
1236 Ga0496104_0000283
1237 Ga0496104_0003705
1238 Ga0496104_0005790
1239 Ga0496104_0158250
1240 Ga0496104_0469699
1241 Ga0496104_0504740
1242 Ga0496104_0966619
1243 Ga0496104_0999806
1244 Ga0496105_0000464
1245 Ga0496105_0005049
1246 Ga0496105_0007098
1247 Ga0496105_0051963
1248 Ga0496105_0113912
1249 Ga0496105_0488772
1250 Ga0496106_0867408
1251 Ga0496106_1027429
1252 Ga0496106_1313565
1253 Ga0496106_1391882
1254 Ga0496107_0205150
1255 Ga0496107_0334703
1256 Ga0496107_0352965
1257 Ga0496107_1241237
1258 Ga0496107_1382488
1259 Ga0496108_0004985
1260 Ga0496108_0019487
1261 Ga0496108_0037303
1262 Ga0496108_0165263
1263 Ga0496108_0378438
1264 Ga0496108_1561120
1265 Ga0496109_0000801
1266 Ga0496109_0001949
1267 Ga0496109_0003556
1268 Ga0496109_0251621
1269 Ga0496109_0392230
1270 Ga0496109_0396562
1271 Ga0496109_0421995
1272 Ga0496109_0584091
1273 Ga0496109_1535064
1274 Ga0496110_0000198
1275 Ga0496110_0068801
1276 Ga0496110_0351886
1277 Ga0496110_0421278
1278 Ga0496110_0490942
1279 Ga0496110_0508389
1280 Ga0496110_0616117
1281 Ga0496110_1354434
1282 Ga0496111_0003476
1283 Ga0496111_0015827
1284 Ga0496111_0040418
1285 Ga0496111_0049673
1286 Ga0496111_0062414
1287 Ga0496111_0237748
1288 Ga0496111_0367977
1289 Ga0496111_1229208
1290 Ga0496112_0018974
1291 Ga0496112_0272506
1292 Ga0496112_0363410
1293 Ga0496112_0417809
1294 Ga0496112_0529894
1295 Ga0496112_0679672
1296 Ga0496112_1223086
1297 Ga0496113_0006862
1298 Ga0496113_0017920
1299 Ga0496113_0484708
1300 Ga0496113_0502067
1301 Ga0496113_0603259
1302 Ga0496113_0982057
1303 Ga0496113_1496354
1304 Ga0496114_0001179
1305 Ga0496114_0008595
1306 Ga0496114_0068411
1307 Ga0496114_0224143
1308 Ga0496114_0836760
1309 Ga0496115_0040738
1310 Ga0496115_0198076
1311 Ga0501297_056002
1312 Ga0501032_0663898
1313 Ga0501036_0345286
1314 Ga0501036_0766286
1315 Ga0501037_0973124
1316 Ga0501039_0264919
1317 Ga0501039_0431368
1318 Ga0501039_0765511
1319 Ga0501040_0012960
1320 Ga0501040_0031609
1321 Ga0501040_0216650
1322 Ga0501040_0293529
1323 Ga0501041_0090603
1324 Ga0501041_0117460
1325 Ga0501041_0389893
1326 Ga0501042_1061640
1327 Ga0501042_1119494
1328 Ga0501043_0706351
1329 Ga0501043_0878449
1330 Ga0501043_1088843
1331 Ga0501046_1278645
1332 Ga0501048_0413276
1333 Ga0501048_1189930
1334 Ga0501067_0058709
1335 Ga0501067_0116024
1336 Ga0501067_0809148
1337 Ga0501068_0262801
1338 Ga0501069_0048677
1339 Ga0501071_0046241
1340 Ga0501071_0112547
1341 Ga0501071_0119481
1342 Ga0501071_0590057
1343 Ga0501072_0067370
1344 Ga0501072_0093538
1345 Ga0501072_0175939
1346 Ga0501075_0025202
1347 Ga0501075_0078368
1348 Ga0501075_0134240
1349 Ga0501075_0401676
1350 Ga0501075_0752057
1351 Ga0501075_0827378
1352 Ga0501075_0871027
1353 Ga0501076_0020972
1354 Ga0501076_0275097
1355 Ga0501076_0700876
1356 Ga0501076_0740357
1357 Ga0501077_0125238
1358 Ga0501077_0411019
1359 Ga0501077_0514216
1360 Ga0501079_0098937
1361 Ga0501079_0467365
1362 Ga0501080_0739146
1363 Ga0501081_0113460
1364 Ga0501081_0342041
1365 Ga0501083_0365825
1366 Ga0501035_0271020
1367 Ga0501045_0026948
1368 Ga0501045_0045942
1369 Ga0501045_0210964
1370 Ga0501045_0581503
1371 nmdc:mga04h51_84818_c1
1372 nmdc:mga05p37_1317228_c1
1373 nmdc:mga05p37_213080_c1
1374 nmdc:mga05p37_300944_c1
1375 nmdc:mga05p37_712864_c1
1376 nmdc:mga09592_598_c1
1377 nmdc:mga0qj67_334079_c1
1378 nmdc:mga0qj67_60034_c1
1379 nmdc:mga06r32_1590996_c1
1380 nmdc:mga06r32_1683387_c1
1381 nmdc:mga06r32_1771928_c1
1382 nmdc:mga06r32_2012375_c1
1383 nmdc:mga06r32_30602_c1
1384 nmdc:mga06r32_583228_c1
1385 nmdc:mga06r32_886635_c1
1386 nmdc:mga06r32_995614_c1
1387 nmdc:mga08y16_1047668_c1
1388 nmdc:mga08y16_1512511_c1
1389 nmdc:mga08y16_413279_c1
1390 nmdc:mga08y16_46733_c1
1391 nmdc:mga0n895_10047_c1
1392 nmdc:mga0n895_1080421_c1
1393 nmdc:mga0n895_1697702_c1
1394 nmdc:mga0n895_21073_c1
1395 nmdc:mga0n895_380881_c1
1396 nmdc:mga0n895_680671_c1
1397 nmdc:mga0n895_756693_c1
1398 nmdc:mga0n895_8415_c1
1399 nmdc:mga0n895_844390_c1
1400 nmdc:mga0n895_873077_c1
1401 nmdc:mga0n895_953926_c1
1402 nmdc:mga0rr50_2019_c1
1403 nmdc:mga0rr50_382632_c1
1404 nmdc:mga0rr50_45616_c1
1405 nmdc:mga0rr50_499420_c1
1406 nmdc:mga0rr50_771695_c1
1407 nmdc:mga0rr50_79440_c1
1408 nmdc:mga0rr50_897196_c1
1409 nmdc:mga0rr50_911278_c1
1410 nmdc:mga08x19_112051_c1
1411 nmdc:mga08x19_150073_c1
1412 nmdc:mga08x19_256003_c1
1413 nmdc:mga08x19_40988_c1
1414 nmdc:mga0a205_140348_c1
1415 nmdc:mga0a205_166406_c1
1416 nmdc:mga0a205_234657_c1
1417 nmdc:mga0a205_58613_c2
1418 nmdc:mga0a205_6284_c1
1419 Ga0495612_0279954
1420 Ga0495655_0312885
1421 Ga0495619_0331208
1422 Ga0501084_0139689
1423 Ga0501084_0272490
1424 Ga0501082_0039156
1425 Ga0501082_0263682
1426 Ga0501082_1224398
1427 Ga0530510_0043913
1428 Ga0530510_0098201
1429 Ga0530510_0371170
1430 Ga0530510_0693638
1431 Ga0530510_0696667
1432 Ga0530510_0827290

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qm7-assembly1.cif.gz_E leishmania tarentolae proteasome 20s subunit complexed with gsk3494245 0.5597 14 49
4mfe-assembly1.cif.gz_B structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with 3-hydroxypyruvate 0.4981 14 44
4mim-assembly1.cif.gz_D structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with 3-bromopyruvate 0.4065 7 44
4m6v-assembly1.cif.gz_D structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with pyruvate and biocytin 0.4003 14 58
3dsb-assembly1.cif.gz_B the crystal structure of a possible acetyltransferase from clostridium difficile 630 0.3756 1 43
ID Description Score Start End Superfamily
3r2xC00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Apc36109-like domain 0.6328 14 40 1.10.340.20
3c1lD01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.601 10 59 1.20.5.810
3c1lD01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.5696 10 59 1.20.5.810
af_Q84WE9_58_466_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.5607 13 55 1.10.4160.10
af_P11989_169_277_1.10.1790.10 Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD;PRD domain 0.5555 14 46 1.10.1790.10
ID Description Score Start End GO Terms
AF-A0A7W9PDE4-F1-model_v4 Putative peroxidase-related enzyme 0.6431 1 81 GO:0004601
AF-A0A538GJ28-F1-model_v4 Peroxidase 0.6406 1 81
AF-A0A7W9PDE4-F1-model_v4 Putative peroxidase-related enzyme 0.637 1 81 GO:0004601
AF-K0EMP8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.6326 1 81
AF-K0EMP8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.6267 1 81

Map