F477069

General Info

Members Datasets Scaffolds Average Seq Length
716 234 693 252

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0059038|Ga0495594_0059038_1200_1988
Length 262
Sequence VDVNVNVDKAKFAQYKFDYLLRQGDNALILSQQLSQLCGKGPALEEDMALTNVALDLLGQTRMWLGYAGELEGQGRDEDRLAFLRDSREFRNVLLVEQPNGDYAQTMVRQFFFDTWHYFLMRELLASTDRRIAEIAEKSLKEVTYHLRRSGDLVVRLGDGTDTSHAKMQAAVGELWTYAGEMFIYDEADQAMVEQGVAPAAEVLRASFLQHVAEVFAEATLAMPSPDAYMQRGGKQGRHSERLGYVLAEMQVLQRTYPGAEW

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2842711865 Duganella sp. R-73148 Isolate Unclassified
19 2857553236 Duganella sp. R-74557 Isolate Unclassified
20 2919476304 Duganella sp. 3397 Isolate Unclassified
21 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
22 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
109 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
226 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
230 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0.7
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.61
Nodule 0.28
Rhizoplane 3.07
Rhizosphere 80.31
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002002 3300002738 Bacteria 5935
2 JGI25152J39213_1000871 3300002773 Bacteria 14868
3 JGI25159J45721_1003728 3300002987 Bacteria 5280
4 JGI25159J45721_1004559 3300002987 Bacteria 4571
5 JGI25153J46596_10005411 3300003215 Bacteria 6705
6 rootL2_10080246 3300003322 Bacteria 2238
7 JGI25160J50197_1004525 3300003354 Bacteria 5996
8 JGI25161J50226_1002388 3300003374 Bacteria 4834
9 JGI25161J50226_1003008 3300003374 Bacteria 4056
10 Ga0055525_1000009 3300003759 Bacteria 596899
11 Ga0055542_1014991 3300003762 Bacteria 1256
12 Ga0055529_1000327 3300003763 Bacteria 53426
13 Ga0055526_1000033 3300003771 Bacteria 138249
14 Ga0055526_1000634 3300003771 Bacteria 27300
15 Ga0055526_1001322 3300003771 Bacteria 17731
16 Ga0055526_1009156 3300003771 Bacteria 4813
17 Ga0055537_1000868 3300003773 Bacteria 14511
18 Ga0055537_1001060 3300003773 Bacteria 12288
19 Ga0055537_1012248 3300003773 Bacteria 1684
20 Ga0055524_1000027 3300003775 Bacteria 213655
21 Ga0055524_1000594 3300003775 Bacteria 26210
22 Ga0055524_1003617 3300003775 Bacteria 7443
23 Ga0055524_1007698 3300003775 Bacteria 4550
24 Ga0055524_1009892 3300003775 Bacteria 3838
25 Ga0055534_1000072 3300003784 Bacteria 78212
26 Ga0055534_1004482 3300003784 Bacteria 4033
27 Ga0055528_1000043 3300003790 Bacteria 103664
28 Ga0055528_1005318 3300003790 Bacteria 6015
29 Ga0055528_1019076 3300003790 Bacteria 2294
30 Ga0055530_10014278 3300003791 Bacteria 2656
31 Ga0055530_10036649 3300003791 Bacteria 1233
32 Ga0055531_10017367 3300003794 Bacteria 3042
33 Ga0055543_1000797 3300004625 Bacteria 15579
34 Ga0065165_1002464 3300005262 Bacteria 15579
35 Ga0065165_1002941 3300005262 Bacteria 12986
36 Ga0070658_10098628 3300005327 Bacteria 2413
37 Ga0070658_10202229 3300005327 Bacteria 1676
38 Ga0070660_100189346 3300005339 Bacteria 1666
39 Ga0070661_100075067 3300005344 Bacteria 2491
40 Ga0070659_100028422 3300005366 Bacteria 4318
41 Ga0070659_100200327 3300005366 Bacteria 1643
42 Ga0070662_100074773 3300005457 Bacteria 2507
43 Ga0068855_100011429 3300005563 Bacteria 10724
44 Ga0068855_100266943 3300005563 Bacteria 1904
45 Ga0068855_100807560 3300005563 Bacteria 996
46 Ga0070664_100616865 3300005564 Bacteria 1007
47 Ga0068852_100305002 3300005616 Bacteria 1542
48 Ga0099826_10000003 3300006948 Bacteria 1067817
49 Ga0105244_10121553 3300009036 Bacteria 1264
50 Ga0105250_10094991 3300009092 Bacteria 1215
51 Ga0105245_10412212 3300009098 Bacteria 1352
52 Ga0105242_10018924 3300009176 Bacteria 5393
53 Ga0105242_10248958 3300009176 Bacteria 1600
54 Ga0105237_10537905 3300009545 Bacteria 1175
55 Ga0105239_10140245 3300010375 Bacteria 2693
56 Ga0157373_10049572 3300013100 Bacteria 2992
57 Ga0157371_10000001 3300013102 Bacteria 1162285
58 Ga0157374_10814495 3300013296 Bacteria 950
59 Ga0157372_10670204 3300013307 Bacteria 1208
60 Ga0182007_10000030 3300015262 Bacteria 156866
61 Ga0182007_10002705 3300015262 Bacteria 8672
62 Ga0182007_10017790 3300015262 Bacteria 2588
63 Ga0213872_10000135 3300021361 Bacteria 67262
64 Ga0213872_10000523 3300021361 Bacteria 30011
65 Ga0224712_10123766 3300022467 Bacteria 1122
66 Ga0209436_100278 3300025208 Bacteria 23513
67 Ga0209436_100364 3300025208 Bacteria 20479
68 Ga0209563_100015 3300025230 Bacteria 879901
69 Ga0209437_102788 3300025233 Bacteria 3288
70 Ga0207425_1000006 3300025245 Bacteria 808854
71 Ga0207425_1000062 3300025245 Bacteria 136118
72 Ga0209646_1000047 3300025246 Bacteria 323416
73 Ga0209677_104552 3300025253 Bacteria 3950
74 Ga0209148_1000794 3300025254 Bacteria 23325
75 Ga0209129_1000009 3300025258 Bacteria 633100
76 Ga0209129_1006168 3300025258 Bacteria 3978
77 Ga0209565_1000006 3300025263 Bacteria 897294
78 Ga0209565_1001289 3300025263 Bacteria 11619
79 Ga0209565_1001724 3300025263 Bacteria 8947
80 Ga0209565_1005512 3300025263 Bacteria 3664
81 Ga0209565_1022288 3300025263 Bacteria 1312
82 Ga0209455_1000051 3300025272 Bacteria 369818
83 Ga0209673_1000004 3300025273 Bacteria 896155
84 Ga0209673_1008943 3300025273 Bacteria 4400
85 Ga0209130_1000501 3300025284 Bacteria 39864
86 Ga0209130_1001651 3300025284 Bacteria 13643
87 Ga0209675_1000006 3300025291 Bacteria 732267
88 Ga0209675_1001178 3300025291 Bacteria 15857
89 Ga0209675_1004898 3300025291 Bacteria 5781
90 Ga0209564_1000006 3300025295 Bacteria 1100927
91 Ga0209564_1000085 3300025295 Bacteria 251509
92 Ga0209564_1000087 3300025295 Bacteria 250787
93 Ga0209564_1002792 3300025295 Bacteria 13031
94 Ga0209564_1025013 3300025295 Bacteria 2023
95 Ga0209758_1000047 3300025297 Bacteria 360971
96 Ga0209050_1000064 3300025298 Bacteria 314803
97 Ga0209050_1000171 3300025298 Bacteria 150524
98 Ga0209050_1038238 3300025298 Bacteria 1372
99 Ga0209256_1000013 3300025299 Bacteria 689442
100 Ga0209256_1000037 3300025299 Bacteria 377661
101 Ga0209256_1000376 3300025299 Bacteria 71561
102 Ga0209256_1001366 3300025299 Bacteria 25671
103 Ga0209256_1005606 3300025299 Bacteria 7130
104 Ga0207426_1002831 3300025302 Bacteria 10334
105 Ga0209051_1025651 3300025303 Bacteria 2392
106 Ga0209257_1000010 3300025304 Bacteria 1158682
107 Ga0209257_1000998 3300025304 Bacteria 38347
108 Ga0209257_1013181 3300025304 Bacteria 3712
109 Ga0207705_10000783 3300025909 Bacteria 26126
110 Ga0207705_10403111 3300025909 Bacteria 1058
111 Ga0207654_10007363 3300025911 Bacteria 5543
112 Ga0207657_10010154 3300025919 Bacteria 9409
113 Ga0207657_10038635 3300025919 Bacteria 4248
114 Ga0207657_10161020 3300025919 Bacteria 1823
115 Ga0207649_10042066 3300025920 Bacteria 2785
116 Ga0207687_10326403 3300025927 Bacteria 1244
117 Ga0207690_10468400 3300025932 Bacteria 1015
118 Ga0207686_10122803 3300025934 Bacteria 1770
119 Ga0207709_10425585 3300025935 Bacteria 1021
120 Ga0207679_10167487 3300025945 Bacteria 1805
121 Ga0207667_10004017 3300025949 Bacteria 18078
122 Ga0207667_10846237 3300025949 Bacteria 909
123 Ga0207698_10264210 3300026142 Bacteria 1583
124 Ga0209282_1000002 3300027666 Bacteria 1067825
125 Ga0307408_100000142 3300031548 Bacteria 79509
126 Ga0307408_100003439 3300031548 Bacteria 10834
127 Ga0307408_100013022 3300031548 Bacteria 5515
128 Ga0307408_100074889 3300031548 Bacteria 2513
129 Ga0265314_10019866 3300031711 Bacteria 5195
130 Ga0307518_10173803 3300031838 Bacteria 1465
131 Ga0395899_0002023 3300037312 Bacteria 16701
132 Ga0395899_0003182 3300037312 Bacteria 13021
133 Ga0395899_0005441 3300037312 Bacteria 9879
134 Ga0395899_0015570 3300037312 Bacteria 5799
135 Ga0395899_0095764 3300037312 Bacteria 2147
136 Ga0395900_0000615 3300037418 Bacteria 48234
137 Ga0395900_0001279 3300037418 Bacteria 30711
138 Ga0395900_0003488 3300037418 Bacteria 16976
139 Ga0395900_0025412 3300037418 Bacteria 6063
140 Ga0395900_0067993 3300037418 Bacteria 3660
141 Ga0395900_0110374 3300037418 Bacteria 2825
142 Ga0395900_0176851 3300037418 Bacteria 2170
143 Ga0395900_0333382 3300037418 Bacteria 1494
144 Ga0395898_0021391 3300037466 Bacteria 6559
145 Ga0395898_0072044 3300037466 Bacteria 3338
146 Ga0395898_0074957 3300037466 Bacteria 3268
147 Ga0395898_0416005 3300037466 Bacteria 1281
148 Ga0395898_0752441 3300037466 Bacteria 916
149 Ga0395905_0028738 3300037471 Bacteria 5239
150 Ga0395905_0045391 3300037471 Bacteria 4121
151 Ga0395905_0171291 3300037471 Bacteria 2039
152 Ga0395905_0514453 3300037471 Bacteria 1097
153 Ga0395905_0609623 3300037471 Bacteria 993
154 Ga0395901_0000084 3300038443 Bacteria 127737
155 Ga0395901_0003015 3300038443 Bacteria 16985
156 Ga0395901_0079127 3300038443 Bacteria 3432
157 Ga0395901_0102519 3300038443 Bacteria 3003
158 Ga0395901_0333537 3300038443 Bacteria 1567
159 Ga0395901_0387471 3300038443 Bacteria 1437
160 Ga0436361_0073582 3300039447 Bacteria 2686
161 Ga0436361_0080101 3300039447 Bacteria 16464
162 Ga0436361_0239159 3300039447 Bacteria 8484
163 Ga0436361_0266787 3300039447 Bacteria 6410
164 Ga0436361_0590398 3300039447 Bacteria 11821
165 Ga0439433_0029580 3300041999 Bacteria 1251
166 Ga0439448_0000096 3300042005 Bacteria 15749
167 Ga0439449_0036063 3300042007 Bacteria 1839
168 Ga0450911_022489 3300042115 Bacteria 821
169 Ga0450904_000071 3300042139 Bacteria 22967
170 Ga0439458_0029871 3300042157 Bacteria 1295
171 Ga0466972_0000399 3300044658 Bacteria 23015
172 Ga0466965_0025072 3300044683 Bacteria 2886
173 Ga0466965_0137857 3300044683 Bacteria 1268
174 Ga0466965_0240246 3300044683 Bacteria 969
175 Ga0466966_0050522 3300044684 Bacteria 2644
176 Ga0466966_0113197 3300044684 Bacteria 1671
177 Ga0466966_0449584 3300044684 Bacteria 774
178 Ga0466963_0088211 3300044694 Bacteria 2110
179 Ga0466964_0002921 3300044706 Bacteria 6171
180 Ga0466964_0003857 3300044706 Bacteria 5503
181 Ga0466971_0050732 3300044719 Bacteria 1867
182 Ga0466968_0001156 3300044735 Bacteria 9353
183 Ga0466970_0018780 3300044765 Bacteria 3582
184 Ga0466957_0000163 3300044842 Bacteria 29423
185 Ga0466957_0325150 3300044842 Bacteria 1038
186 Ga0466960_0086851 3300044901 Bacteria 1587
187 Ga0466959_0043994 3300045049 Bacteria 3290
188 Ga0466959_0300787 3300045049 Bacteria 1099
189 Ga0466967_0012126 3300045976 Bacteria 6574
190 Ga0466967_0049203 3300045976 Bacteria 3685
191 Ga0495617_000002 3300046452 Bacteria 710121
192 Ga0495617_000102 3300046452 Bacteria 61763
193 Ga0495617_036276 3300046452 Bacteria 1653
194 Ga0495627_000066 3300046453 Bacteria 130363
195 Ga0495627_000176 3300046453 Bacteria 72651
196 Ga0495627_010166 3300046453 Bacteria 3433
197 Ga0495627_012381 3300046453 Bacteria 3029
198 Ga0495627_018321 3300046453 Bacteria 2363
199 Ga0495603_0017180 3300046455 Bacteria 4380
200 Ga0495590_0000044 3300046457 Bacteria 119833
201 Ga0495590_0000495 3300046457 Bacteria 19326
202 Ga0495590_0001266 3300046457 Bacteria 10996
203 Ga0495590_0051195 3300046457 Bacteria 1442
204 Ga0495591_000052 3300046458 Bacteria 136101
205 Ga0495591_019129 3300046458 Bacteria 2300
206 Ga0495638_0002116 3300046460 Bacteria 16747
207 Ga0495638_0009451 3300046460 Bacteria 6842
208 Ga0495638_0047183 3300046460 Bacteria 2702
209 Ga0495638_0201796 3300046460 Bacteria 1122
210 Ga0495651_0000657 3300046462 Bacteria 26772
211 Ga0495653_0000007 3300046463 Bacteria 314281
212 Ga0495653_0010057 3300046463 Bacteria 7738
213 Ga0495653_0016788 3300046463 Bacteria 5956
214 Ga0495653_0043877 3300046463 Bacteria 3473
215 Ga0495653_0196064 3300046463 Bacteria 1374
216 Ga0495650_0001071 3300046471 Bacteria 30283
217 Ga0495650_0016641 3300046471 Bacteria 3717
218 Ga0495582_0041560 3300046473 Bacteria 2533
219 Ga0495605_0000081 3300046474 Bacteria 125302
220 Ga0495605_0000087 3300046474 Bacteria 120256
221 Ga0495605_0001493 3300046474 Bacteria 15264
222 Ga0495605_0004580 3300046474 Bacteria 8094
223 Ga0495605_0023314 3300046474 Bacteria 3257
224 Ga0495605_0045274 3300046474 Bacteria 2169
225 Ga0495605_0045641 3300046474 Bacteria 2159
226 Ga0495605_0049920 3300046474 Bacteria 2042
227 Ga0495605_0059122 3300046474 Bacteria 1841
228 Ga0495605_0070769 3300046474 Bacteria 1649
229 Ga0495639_0075784 3300046475 Bacteria 1560
230 Ga0495584_0000196 3300046491 Bacteria 42912
231 Ga0495584_0000224 3300046491 Bacteria 40823
232 Ga0495584_0001717 3300046491 Bacteria 12808
233 Ga0495584_0010327 3300046491 Bacteria 4798
234 Ga0495584_0021775 3300046491 Bacteria 3255
235 Ga0495584_0026010 3300046491 Bacteria 2965
236 Ga0495584_0033941 3300046491 Bacteria 2581
237 Ga0495584_0050314 3300046491 Bacteria 2098
238 Ga0495584_0050938 3300046491 Bacteria 2085
239 Ga0495584_0123483 3300046491 Bacteria 1311
240 Ga0495584_0211458 3300046491 Bacteria 986
241 Ga0495584_0211628 3300046491 Bacteria 985
242 Ga0495585_0000078 3300046492 Bacteria 100168
243 Ga0495585_0001087 3300046492 Bacteria 22389
244 Ga0495585_0003540 3300046492 Bacteria 10497
245 Ga0495585_0003916 3300046492 Bacteria 9858
246 Ga0495585_0010860 3300046492 Bacteria 5410
247 Ga0495585_0019263 3300046492 Bacteria 3936
248 Ga0495585_0026193 3300046492 Bacteria 3331
249 Ga0495585_0047816 3300046492 Bacteria 2380
250 Ga0495585_0104533 3300046492 Bacteria 1511
251 Ga0495594_0015085 3300046499 Bacteria 4055
252 Ga0495594_0035826 3300046499 Bacteria 2704
253 Ga0495594_0059038 3300046499 Bacteria 2120
254 Ga0495596_0000101 3300046500 Bacteria 60820
255 Ga0495596_0003471 3300046500 Bacteria 7959
256 Ga0495596_0005404 3300046500 Bacteria 6043
257 Ga0495596_0009629 3300046500 Bacteria 4246
258 Ga0495596_0028479 3300046500 Bacteria 2242
259 Ga0495596_0046983 3300046500 Bacteria 1694
260 Ga0495596_0048759 3300046500 Bacteria 1660
261 Ga0495596_0069971 3300046500 Bacteria 1363
262 Ga0495596_0100250 3300046500 Bacteria 1124
263 Ga0495596_0110688 3300046500 Bacteria 1066
264 Ga0495607_0000658 3300046501 Bacteria 33578
265 Ga0495607_0001173 3300046501 Bacteria 23719
266 Ga0495607_0001229 3300046501 Bacteria 23009
267 Ga0495607_0002192 3300046501 Bacteria 16230
268 Ga0495607_0009313 3300046501 Bacteria 6654
269 Ga0495607_0036322 3300046501 Bacteria 2969
270 Ga0495607_0072065 3300046501 Bacteria 1924
271 Ga0495607_0088917 3300046501 Bacteria 1677
272 Ga0495607_0127281 3300046501 Bacteria 1330
273 Ga0495607_0143834 3300046501 Bacteria 1227
274 Ga0495607_0152272 3300046501 Bacteria 1182
275 Ga0495583_0000004 3300046506 Bacteria 655287
276 Ga0495583_0000193 3300046506 Bacteria 101909
277 Ga0495583_0000241 3300046506 Bacteria 90735
278 Ga0495583_0003098 3300046506 Bacteria 13147
279 Ga0495583_0004796 3300046506 Bacteria 9483
280 Ga0495583_0011809 3300046506 Bacteria 4992
281 Ga0495583_0021585 3300046506 Bacteria 3308
282 Ga0495583_0033077 3300046506 Bacteria 2489
283 Ga0495583_0034831 3300046506 Bacteria 2408
284 Ga0495583_0036586 3300046506 Bacteria 2333
285 Ga0495583_0080242 3300046506 Bacteria 1418
286 Ga0495606_0002401 3300046507 Bacteria 21883
287 Ga0495606_0002849 3300046507 Bacteria 19153
288 Ga0495606_0018245 3300046507 Bacteria 5270
289 Ga0495606_0112392 3300046507 Bacteria 1641
290 Ga0495610_0000004 3300046512 Bacteria 1006135
291 Ga0495610_0000493 3300046512 Bacteria 40287
292 Ga0495610_0063409 3300046512 Bacteria 1750
293 Ga0495616_0000103 3300046513 Bacteria 73155
294 Ga0495616_0000218 3300046513 Bacteria 47146
295 Ga0495616_0001114 3300046513 Bacteria 19091
296 Ga0495616_0006706 3300046513 Bacteria 6948
297 Ga0495616_0010324 3300046513 Bacteria 5411
298 Ga0495616_0023366 3300046513 Bacteria 3325
299 Ga0495616_0028097 3300046513 Bacteria 2980
300 Ga0495616_0086920 3300046513 Bacteria 1486
301 Ga0495616_0114000 3300046513 Bacteria 1253
302 Ga0495616_0130064 3300046513 Bacteria 1154
303 Ga0495616_0135292 3300046513 Bacteria 1126
304 Ga0495618_0210065 3300046514 Bacteria 1230
305 Ga0495620_0000960 3300046515 Bacteria 17763
306 Ga0495628_0000037 3300046516 Bacteria 109854
307 Ga0495630_0063260 3300046517 Bacteria 2779
308 Ga0495631_0000236 3300046518 Bacteria 37997
309 Ga0495631_0000447 3300046518 Bacteria 28226
310 Ga0495631_0002702 3300046518 Bacteria 9854
311 Ga0495631_0008443 3300046518 Bacteria 5190
312 Ga0495631_0011996 3300046518 Bacteria 4247
313 Ga0495631_0016753 3300046518 Bacteria 3483
314 Ga0495631_0028389 3300046518 Bacteria 2552
315 Ga0495631_0047850 3300046518 Bacteria 1876
316 Ga0495631_0063138 3300046518 Bacteria 1604
317 Ga0495631_0081633 3300046518 Bacteria 1394
318 Ga0495631_0121249 3300046518 Bacteria 1124
319 Ga0495631_0138736 3300046518 Bacteria 1044
320 Ga0495632_0000040 3300046519 Bacteria 149644
321 Ga0495632_0000114 3300046519 Bacteria 82098
322 Ga0495632_0000224 3300046519 Bacteria 57424
323 Ga0495632_0007996 3300046519 Bacteria 6564
324 Ga0495632_0022043 3300046519 Bacteria 3421
325 Ga0495632_0027170 3300046519 Bacteria 3000
326 Ga0495632_0028357 3300046519 Bacteria 2922
327 Ga0495632_0031460 3300046519 Bacteria 2743
328 Ga0495632_0044022 3300046519 Bacteria 2229
329 Ga0495632_0053805 3300046519 Bacteria 1975
330 Ga0495632_0225539 3300046519 Bacteria 846
331 Ga0495637_0000006 3300046520 Bacteria 435763
332 Ga0495637_0010364 3300046520 Bacteria 4512
333 Ga0495637_0035425 3300046520 Bacteria 2179
334 Ga0495643_0000192 3300046522 Bacteria 96511
335 Ga0495643_0001383 3300046522 Bacteria 22675
336 Ga0495643_0002571 3300046522 Bacteria 14177
337 Ga0495643_0014722 3300046522 Bacteria 4647
338 Ga0495643_0067066 3300046522 Bacteria 1891
339 Ga0495643_0143869 3300046522 Bacteria 1186
340 Ga0495644_0001907 3300046523 Bacteria 8376
341 Ga0495644_0003124 3300046523 Bacteria 6552
342 Ga0495644_0006126 3300046523 Bacteria 4675
343 Ga0495644_0007910 3300046523 Bacteria 4093
344 Ga0495644_0016476 3300046523 Bacteria 2829
345 Ga0495644_0042438 3300046523 Bacteria 1712
346 Ga0495644_0046334 3300046523 Bacteria 1634
347 Ga0495644_0048996 3300046523 Bacteria 1586
348 Ga0495644_0062398 3300046523 Bacteria 1400
349 Ga0495648_0000801 3300046524 Bacteria 33290
350 Ga0495648_0001877 3300046524 Bacteria 20080
351 Ga0495648_0003322 3300046524 Bacteria 14189
352 Ga0495648_0008158 3300046524 Bacteria 8265
353 Ga0495648_0019440 3300046524 Bacteria 4775
354 Ga0495648_0054579 3300046524 Bacteria 2413
355 Ga0495648_0069422 3300046524 Bacteria 2050
356 Ga0495648_0069909 3300046524 Bacteria 2041
357 Ga0495663_0003912 3300046525 Bacteria 4244
358 Ga0495663_0018728 3300046525 Bacteria 1974
359 Ga0495663_0035740 3300046525 Bacteria 1493
360 Ga0495642_0000057 3300046528 Bacteria 66980
361 Ga0495642_0000968 3300046528 Bacteria 13401
362 Ga0495642_0001380 3300046528 Bacteria 10879
363 Ga0495642_0008410 3300046528 Bacteria 3949
364 Ga0495642_0008649 3300046528 Bacteria 3891
365 Ga0495642_0029744 3300046528 Bacteria 2182
366 Ga0495642_0040368 3300046528 Bacteria 1895
367 Ga0495642_0042462 3300046528 Bacteria 1852
368 Ga0495642_0053037 3300046528 Bacteria 1670
369 Ga0495642_0064847 3300046528 Bacteria 1520
370 Ga0495642_0212268 3300046528 Bacteria 844
371 Ga0495652_0005170 3300046529 Bacteria 12339
372 Ga0495652_0035033 3300046529 Bacteria 4370
373 Ga0495654_0007243 3300046530 Bacteria 6217
374 Ga0495654_0022994 3300046530 Bacteria 3230
375 Ga0495654_0024010 3300046530 Bacteria 3154
376 Ga0495654_0042119 3300046530 Bacteria 2268
377 Ga0495654_0089817 3300046530 Bacteria 1427
378 Ga0495654_0142146 3300046530 Bacteria 1068
379 Ga0495665_0041842 3300046531 Bacteria 2439
380 Ga0495640_0139458 3300046533 Bacteria 1564
381 Ga0495586_0006176 3300046535 Bacteria 6405
382 Ga0495587_0053076 3300046536 Bacteria 2390
383 Ga0495587_0162234 3300046536 Bacteria 1271
384 Ga0495609_0000096 3300046538 Bacteria 104135
385 Ga0495609_0000299 3300046538 Bacteria 45808
386 Ga0495609_0000634 3300046538 Bacteria 27340
387 Ga0495609_0000831 3300046538 Bacteria 22919
388 Ga0495609_0000915 3300046538 Bacteria 21373
389 Ga0495609_0002900 3300046538 Bacteria 10224
390 Ga0495609_0024334 3300046538 Bacteria 2778
391 Ga0495609_0053091 3300046538 Bacteria 1802
392 Ga0495609_0117050 3300046538 Bacteria 1147
393 Ga0495609_0140923 3300046538 Bacteria 1029
394 Ga0495597_0000146 3300046542 Bacteria 62336
395 Ga0495597_0000586 3300046542 Bacteria 30141
396 Ga0495597_0000671 3300046542 Bacteria 27819
397 Ga0495597_0000787 3300046542 Bacteria 25038
398 Ga0495597_0002670 3300046542 Bacteria 11035
399 Ga0495597_0026258 3300046542 Bacteria 2676
400 Ga0495597_0048000 3300046542 Bacteria 1889
401 Ga0495597_0052062 3300046542 Bacteria 1803
402 Ga0495597_0084331 3300046542 Bacteria 1355
403 Ga0495597_0085064 3300046542 Bacteria 1348
404 Ga0495597_0088972 3300046542 Bacteria 1312
405 Ga0495645_0010488 3300046543 Bacteria 6499
406 Ga0495622_0000032 3300046557 Bacteria 125538
407 Ga0495622_0034704 3300046557 Bacteria 2353
408 Ga0495633_0000425 3300046558 Bacteria 43892
409 Ga0495633_0006471 3300046558 Bacteria 6933
410 Ga0495633_0006790 3300046558 Bacteria 6712
411 Ga0495633_0011819 3300046558 Bacteria 4681
412 Ga0495633_0014689 3300046558 Bacteria 4083
413 Ga0495633_0032333 3300046558 Bacteria 2529
414 Ga0495633_0040066 3300046558 Bacteria 2233
415 Ga0495633_0044625 3300046558 Bacteria 2100
416 Ga0495633_0050018 3300046558 Bacteria 1971
417 Ga0495633_0053487 3300046558 Bacteria 1900
418 Ga0495633_0081916 3300046558 Bacteria 1501
419 Ga0495633_0129328 3300046558 Bacteria 1168
420 Ga0495633_0188175 3300046558 Bacteria 949
421 Ga0495633_0191962 3300046558 Bacteria 939
422 Ga0495633_0207042 3300046558 Bacteria 900
423 Ga0495656_0009953 3300046615 Bacteria 3440
424 Ga0495656_0011513 3300046615 Bacteria 3248
425 Ga0495656_0035961 3300046615 Bacteria 2038
426 Ga0495656_0093925 3300046615 Bacteria 1376
427 Ga0495656_0140969 3300046615 Bacteria 1156
428 Ga0495656_0236303 3300046615 Bacteria 919
429 Ga0495668_0000435 3300046616 Bacteria 53680
430 Ga0495668_0001006 3300046616 Bacteria 30332
431 Ga0495668_0002251 3300046616 Bacteria 16247
432 Ga0495668_0007261 3300046616 Bacteria 7109
433 Ga0495668_0020958 3300046616 Bacteria 3754
434 Ga0495668_0023528 3300046616 Bacteria 3511
435 Ga0495668_0033216 3300046616 Bacteria 2899
436 Ga0495668_0046999 3300046616 Bacteria 2396
437 Ga0495668_0062675 3300046616 Bacteria 2048
438 Ga0495668_0095333 3300046616 Bacteria 1628
439 Ga0495634_0054055 3300046642 Bacteria 2688
440 Ga0495611_0001617 3300046648 Bacteria 10970
441 Ga0495611_0001734 3300046648 Bacteria 10557
442 Ga0495611_0005111 3300046648 Bacteria 5624
443 Ga0495611_0017487 3300046648 Bacteria 3067
444 Ga0495611_0018346 3300046648 Bacteria 3000
445 Ga0495611_0027469 3300046648 Bacteria 2487
446 Ga0495611_0154432 3300046648 Bacteria 1071
447 Ga0495625_0010194 3300046660 Bacteria 7801
448 Ga0495625_0017371 3300046660 Bacteria 5634
449 Ga0495625_0032642 3300046660 Bacteria 3858
450 Ga0495625_0037091 3300046660 Bacteria 3578
451 Ga0495625_0040611 3300046660 Bacteria 3390
452 Ga0495625_0049302 3300046660 Bacteria 3028
453 Ga0495625_0068656 3300046660 Bacteria 2491
454 Ga0495625_0077379 3300046660 Bacteria 2324
455 Ga0495625_0114575 3300046660 Bacteria 1840
456 Ga0495635_0006068 3300046663 Bacteria 8431
457 Ga0495659_0000029 3300046664 Bacteria 66600
458 Ga0495659_0000428 3300046664 Bacteria 15993
459 Ga0495659_0090340 3300046664 Bacteria 1175
460 Ga0495661_0000164 3300046665 Bacteria 78742
461 Ga0495661_0000439 3300046665 Bacteria 43999
462 Ga0495661_0000834 3300046665 Bacteria 28856
463 Ga0495661_0005789 3300046665 Bacteria 8738
464 Ga0495661_0007153 3300046665 Bacteria 7787
465 Ga0495661_0010121 3300046665 Bacteria 6447
466 Ga0495661_0030023 3300046665 Bacteria 3463
467 Ga0495661_0033458 3300046665 Bacteria 3242
468 Ga0495661_0044752 3300046665 Bacteria 2711
469 Ga0495661_0052231 3300046665 Bacteria 2463
470 Ga0495661_0061385 3300046665 Bacteria 2231
471 Ga0495661_0069022 3300046665 Bacteria 2072
472 Ga0495661_0125707 3300046665 Bacteria 1411
473 Ga0495661_0132929 3300046665 Bacteria 1361
474 Ga0495661_0166822 3300046665 Bacteria 1177
475 Ga0495588_0000070 3300046674 Bacteria 227611
476 Ga0495588_0064747 3300046674 Bacteria 1896
477 Ga0495623_0013434 3300046679 Bacteria 5308
478 Ga0495623_0060728 3300046679 Bacteria 2372
479 Ga0495669_0000122 3300046684 Bacteria 50338
480 Ga0495669_0002183 3300046684 Bacteria 8028
481 Ga0495669_0010601 3300046684 Bacteria 3896
482 Ga0495669_0028146 3300046684 Bacteria 2460
483 Ga0495669_0044371 3300046684 Bacteria 1980
484 Ga0495669_0079382 3300046684 Bacteria 1504
485 Ga0495613_0036874 3300046689 Bacteria 3625
486 Ga0495670_0010477 3300046691 Bacteria 4553
487 Ga0495670_0018007 3300046691 Bacteria 3479
488 Ga0495670_0028814 3300046691 Bacteria 2753
489 Ga0495670_0031327 3300046691 Bacteria 2642
490 Ga0495670_0032945 3300046691 Bacteria 2577
491 Ga0495670_0047137 3300046691 Bacteria 2153
492 Ga0495670_0059279 3300046691 Bacteria 1921
493 Ga0495670_0071526 3300046691 Bacteria 1756
494 Ga0495670_0238236 3300046691 Bacteria 968
495 Ga0495671_0000074 3300046692 Bacteria 96288
496 Ga0495671_0000132 3300046692 Bacteria 67269
497 Ga0495671_0000531 3300046692 Bacteria 28765
498 Ga0495671_0020910 3300046692 Bacteria 3443
499 Ga0495671_0039690 3300046692 Bacteria 2376
500 Ga0495671_0055031 3300046692 Bacteria 1971
501 Ga0495671_0058138 3300046692 Bacteria 1913
502 Ga0495671_0186745 3300046692 Bacteria 1006
503 Ga0495671_0186747 3300046692 Bacteria 1006
504 Ga0495671_0214199 3300046692 Bacteria 933
505 Ga0495649_0001595 3300046694 Bacteria 16945
506 Ga0495649_0005128 3300046694 Bacteria 8404
507 Ga0495649_0008716 3300046694 Bacteria 6084
508 Ga0495649_0022582 3300046694 Bacteria 3520
509 Ga0495649_0050171 3300046694 Bacteria 2265
510 Ga0495649_0059068 3300046694 Bacteria 2065
511 Ga0495649_0102599 3300046694 Bacteria 1519
512 Ga0495649_0148858 3300046694 Bacteria 1230
513 Ga0495649_0184616 3300046694 Bacteria 1087
514 Ga0495589_0000036 3300046794 Bacteria 153299
515 Ga0495589_0000092 3300046794 Bacteria 85372
516 Ga0495589_0000210 3300046794 Bacteria 49536
517 Ga0495589_0004418 3300046794 Bacteria 7490
518 Ga0495589_0004698 3300046794 Bacteria 7249
519 Ga0495589_0010102 3300046794 Bacteria 4904
520 Ga0495589_0016488 3300046794 Bacteria 3798
521 Ga0495589_0041547 3300046794 Bacteria 2294
522 Ga0495589_0052416 3300046794 Bacteria 2016
523 Ga0495660_0000117 3300046810 Bacteria 85237
524 Ga0495660_0001695 3300046810 Bacteria 14742
525 Ga0495660_0004682 3300046810 Bacteria 8254
526 Ga0495660_0005961 3300046810 Bacteria 7255
527 Ga0495660_0007134 3300046810 Bacteria 6582
528 Ga0495660_0011912 3300046810 Bacteria 5045
529 Ga0495660_0012522 3300046810 Bacteria 4924
530 Ga0495660_0032443 3300046810 Bacteria 2932
531 Ga0495660_0034539 3300046810 Bacteria 2829
532 Ga0495660_0077271 3300046810 Bacteria 1752
533 Ga0495660_0103065 3300046810 Bacteria 1466
534 Ga0495660_0129821 3300046810 Bacteria 1265
535 Ga0495660_0235193 3300046810 Bacteria 856
536 Ga0495604_0032868 3300047317 Bacteria 4109
537 Ga0495604_0038278 3300047317 Bacteria 3773
538 Ga0495636_0038460 3300047318 Bacteria 1980
539 Ga0495636_0067274 3300047318 Bacteria 1524
540 Ga0495636_0130278 3300047318 Bacteria 1118
541 Ga0495636_0198589 3300047318 Bacteria 915
542 Ga0495672_0000086 3300047320 Bacteria 155010
543 Ga0495672_0000337 3300047320 Bacteria 60563
544 Ga0495672_0000576 3300047320 Bacteria 41488
545 Ga0495672_0001769 3300047320 Bacteria 20766
546 Ga0495672_0006333 3300047320 Bacteria 9197
547 Ga0495672_0007292 3300047320 Bacteria 8341
548 Ga0495672_0061770 3300047320 Bacteria 2158
549 Ga0495672_0123680 3300047320 Bacteria 1371
550 Ga0495676_0000035 3300047321 Bacteria 120519
551 Ga0495680_0012466 3300047322 Bacteria 7481
552 Ga0495680_0336080 3300047322 Bacteria 1054
553 Ga0495683_0000080 3300047323 Bacteria 95388
554 Ga0495683_0004092 3300047323 Bacteria 8352
555 Ga0495683_0020130 3300047323 Bacteria 3443
556 Ga0495683_0043958 3300047323 Bacteria 2247
557 Ga0495683_0047547 3300047323 Bacteria 2153
558 Ga0495683_0049548 3300047323 Bacteria 2103
559 Ga0495683_0100458 3300047323 Bacteria 1391
560 Ga0495683_0101661 3300047323 Bacteria 1381
561 Ga0495683_0115557 3300047323 Bacteria 1277
562 Ga0495687_000074 3300047443 Bacteria 153464
563 Ga0495687_000154 3300047443 Bacteria 104740
564 Ga0495687_000311 3300047443 Bacteria 63605
565 Ga0495687_000403 3300047443 Bacteria 53439
566 Ga0495687_000416 3300047443 Bacteria 52656
567 Ga0495687_001235 3300047443 Bacteria 24397
568 Ga0495687_002089 3300047443 Bacteria 16789
569 Ga0495687_036806 3300047443 Bacteria 2186
570 Ga0495675_0005625 3300047444 Bacteria 7652
571 Ga0495675_0007502 3300047444 Bacteria 6719
572 Ga0495675_0114982 3300047444 Bacteria 1678
573 Ga0495677_0000037 3300047445 Bacteria 78595
574 Ga0495677_0000402 3300047445 Bacteria 18539
575 Ga0495677_0003529 3300047445 Bacteria 6068
576 Ga0495677_0004015 3300047445 Bacteria 5682
577 Ga0495677_0008198 3300047445 Bacteria 3881
578 Ga0495677_0015052 3300047445 Bacteria 2811
579 Ga0495677_0037952 3300047445 Bacteria 1760
580 Ga0495677_0055726 3300047445 Bacteria 1459
581 Ga0495679_005095 3300047446 Bacteria 5895
582 Ga0495679_027886 3300047446 Bacteria 1857
583 Ga0495679_045353 3300047446 Bacteria 1343
584 Ga0495679_047483 3300047446 Bacteria 1302
585 Ga0495679_047484 3300047446 Bacteria 1302
586 Ga0495679_048106 3300047446 Bacteria 1290
587 Ga0495679_090123 3300047446 Bacteria 861
588 Ga0495685_017666 3300047447 Bacteria 2444
589 Ga0495673_0000135 3300047469 Bacteria 135338
590 Ga0495673_0000252 3300047469 Bacteria 74793
591 Ga0495681_0000413 3300047470 Bacteria 33005
592 Ga0495681_0001633 3300047470 Bacteria 16642
593 Ga0495681_0001651 3300047470 Bacteria 16556
594 Ga0495681_0007860 3300047470 Bacteria 6745
595 Ga0495681_0011842 3300047470 Bacteria 5161
596 Ga0495681_0043437 3300047470 Bacteria 2167
597 Ga0495681_0046550 3300047470 Bacteria 2067
598 Ga0495681_0049445 3300047470 Bacteria 1987
599 Ga0495681_0064303 3300047470 Bacteria 1681
600 Ga0495681_0075152 3300047470 Bacteria 1521
601 Ga0495681_0086564 3300047470 Bacteria 1390
602 Ga0495681_0159819 3300047470 Bacteria 939
603 Ga0495686_0001380 3300047472 Bacteria 27031
604 Ga0495686_0011603 3300047472 Bacteria 6203
605 Ga0495686_0046824 3300047472 Bacteria 2732
606 Ga0495686_0069116 3300047472 Bacteria 2178
607 Ga0495686_0081647 3300047472 Bacteria 1973
608 Ga0495593_0002046 3300047673 Bacteria 12034
609 Ga0495602_0000889 3300048088 Bacteria 28860
610 Ga0495602_0004236 3300048088 Bacteria 14924
611 Ga0495602_0151919 3300048088 Bacteria 1819
612 Ga0495614_0006138 3300048089 Bacteria 5400
613 Ga0495614_0037843 3300048089 Bacteria 2070
614 Ga0495615_0015042 3300048090 Bacteria 1646
615 Ga0495626_0000006 3300048091 Bacteria 284977
616 Ga0495626_0000454 3300048091 Bacteria 41810
617 Ga0495626_0000663 3300048091 Bacteria 33119
618 Ga0495626_0004189 3300048091 Bacteria 8938
619 Ga0495626_0004944 3300048091 Bacteria 7998
620 Ga0495626_0016560 3300048091 Bacteria 3741
621 Ga0495626_0017647 3300048091 Bacteria 3598
622 Ga0495626_0024611 3300048091 Bacteria 2950
623 Ga0495626_0027695 3300048091 Bacteria 2753
624 Ga0495626_0035170 3300048091 Bacteria 2391
625 Ga0495626_0059466 3300048091 Bacteria 1743
626 Ga0495626_0063083 3300048091 Bacteria 1681
627 Ga0495626_0128038 3300048091 Bacteria 1086
628 Ga0496100_0131785 3300048903 Bacteria 1761
629 Ga0496101_0063748 3300048904 Bacteria 2683
630 Ga0496102_0000253 3300048905 Bacteria 69634
631 Ga0496102_0064768 3300048905 Bacteria 3348
632 Ga0496102_0149345 3300048905 Bacteria 2195
633 Ga0496102_0658510 3300048905 Bacteria 970
634 Ga0496103_0007074 3300048906 Bacteria 6698
635 Ga0496103_0038645 3300048906 Bacteria 2929
636 Ga0496103_0412232 3300048906 Bacteria 867
637 Ga0496105_0356255 3300048908 Bacteria 1168
638 Ga0496106_0002199 3300048909 Bacteria 14567
639 Ga0496107_0251577 3300048910 Bacteria 1315
640 Ga0496107_0356043 3300048910 Bacteria 1089
641 Ga0496109_0026349 3300048912 Bacteria 5184
642 Ga0496110_0001360 3300048913 Bacteria 17629
643 Ga0496111_0028579 3300048914 Bacteria 3953
644 Ga0496111_0205054 3300048914 Bacteria 1465
645 Ga0496112_0091218 3300048915 Bacteria 3016
646 Ga0496113_0023479 3300048916 Bacteria 4373
647 Ga0496113_0097956 3300048916 Bacteria 2269
648 Ga0496115_0065401 3300048918 Bacteria 2937
649 Ga0496121_0076173 3300048924 Bacteria 2676
650 Ga0496122_0000942 3300048925 Bacteria 52834
651 Ga0496122_0004618 3300048925 Bacteria 16944
652 Ga0496122_0018052 3300048925 Bacteria 6542
653 Ga0496122_0113861 3300048925 Bacteria 1766
654 Ga0496122_0127562 3300048925 Bacteria 1624
655 Ga0496123_0000819 3300048926 Bacteria 50058
656 Ga0496123_0005379 3300048926 Bacteria 12908
657 Ga0496123_0018038 3300048926 Bacteria 5645
658 Ga0496124_0016323 3300048927 Bacteria 7068
659 Ga0496124_0048037 3300048927 Bacteria 3649
660 Ga0496124_0056035 3300048927 Bacteria 3327
661 Ga0496124_0062793 3300048927 Bacteria 3107
662 Ga0496124_0084546 3300048927 Bacteria 2601
663 Ga0496124_0178580 3300048927 Bacteria 1636
664 Ga0496125_0009738 3300048928 Bacteria 9808
665 Ga0496125_0085688 3300048928 Bacteria 2386
666 Ga0496125_0293296 3300048928 Bacteria 1000
667 Ga0496125_0367940 3300048928 Bacteria 852
668 Ga0501308_007616 3300049128 Bacteria 1139
669 Ga0495678_000001 3300049459 Bacteria 1060340
670 Ga0495678_000064 3300049459 Bacteria 138380
671 Ga0495678_001466 3300049459 Bacteria 18494
672 Ga0495678_001530 3300049459 Bacteria 17861
673 Ga0495678_003355 3300049459 Bacteria 9967
674 Ga0495678_006682 3300049459 Bacteria 6096
675 Ga0495678_010498 3300049459 Bacteria 4500
676 Ga0495678_014094 3300049459 Bacteria 3728
677 Ga0495678_017367 3300049459 Bacteria 3263
678 Ga0495682_0000189 3300049460 Bacteria 50648
679 Ga0495682_0000568 3300049460 Bacteria 25125
680 Ga0495682_0000615 3300049460 Bacteria 23980
681 Ga0495682_0003132 3300049460 Bacteria 7476
682 Ga0495682_0010053 3300049460 Bacteria 3676
683 Ga0495682_0037429 3300049460 Bacteria 1785
684 Ga0501034_0092029 3300049571 Bacteria 3030
685 Ga0501227_041104 3300049665 Bacteria 1143
686 Ga0501279_005178 3300049775 Bacteria 1711
687 Ga0501035_0001175 3300049822 Bacteria 27278
688 Ga0501044_0459298 3300049823 Bacteria 1179
689 Ga0500586_051961 3300053145 Bacteria 1414
690 Ga0587077_021362 3300059493 Bacteria 1148
691 Ga0587080_014497 3300059503 Bacteria 1220
692 Ga0587068_013855 3300059641 Bacteria 1249
693 Ga0466962_0079510 3300061719 Bacteria 1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0139458 Ga0495640_0139458_125_793 222
2 3300047445 Ga0495677_0004015 Ga0495677_0004015_21_701 226
3 3300047446 Ga0495679_090123 Ga0495679_090123_20_700 226
4 3300046513 Ga0495616_0006706 Ga0495616_0006706_5012_5701 228
5 3300047318 Ga0495636_0198589 Ga0495636_0198589_10_717 235
6 3300042157 Ga0439458_0029871 Ga0439458_0029871_546_1274 242
7 3300044684 Ga0466966_0449584 Ga0466966_0449584_34_762 242
8 3300046522 Ga0495643_0014722 Ga0495643_0014722_670_1404 244
9 iso_pu_bacteria 2600255292 2601670435 246
10 iso_pu_bacteria 2643221554 2643788779 246
11 iso_pu_bacteria 2643221638 2644213203 246
12 iso_pu_bacteria 2738541280 2738740960 246
13 iso_pu_bacteria 2738541297 2738825609 246
14 iso_pu_bacteria 2738541300 2738845282 246
15 iso_pu_bacteria 2738541357 2739149406 246
16 iso_pu_bacteria 2738543003 2739191325 246
17 iso_pu_bacteria 2738543018 2739274877 246
18 iso_pu_bacteria 2738543026 2739317802 246
19 iso_pu_bacteria 2738543029 2739336043 246
20 iso_pu_bacteria 2738543030 2739343921 246
21 iso_pu_bacteria 2842711865 2842712051 246
22 iso_pu_bacteria 2857553236 2857554805 246
23 iso_pu_bacteria 2919476304 2919479109 246
24 iso_pu_bacteria 2932410948 2932412819 246
25 iso_pu_bacteria 2932416698 2932420334 246
26 3300046513 Ga0495616_0130064 Ga0495616_0130064_187_972 247
27 3300046519 Ga0495632_0007996 Ga0495632_0007996_328_1113 247
28 3300047323 Ga0495683_0043958 Ga0495683_0043958_794_1540 247
29 iso_pu_bacteria 2643221556 2643797697 247
30 iso_pu_bacteria 2643221684 2644470521 247
31 iso_pu_bacteria 2808606418 2809144203 247
32 iso_pu_bacteria 8047673197 8047679000 247
33 3300013307 Ga0157372_10670204 Ga0157372_106702042 248
34 3300047318 Ga0495636_0130278 Ga0495636_0130278_310_1068 248
35 3300047470 Ga0495681_0075152 Ga0495681_0075152_605_1360 248
36 3300021361 Ga0213872_10000523 Ga0213872_100005233 249
37 3300039447 Ga0436361_0590398 Ga0436361_0590398_3033_3782 249
38 3300042139 Ga0450904_000071 Ga0450904_000071_16112_16873 249
39 3300046453 Ga0495627_018321 Ga0495627_018321_726_1481 249
40 3300046455 Ga0495603_0017180 Ga0495603_0017180_658_1425 249
41 3300046458 Ga0495591_019129 Ga0495591_019129_455_1216 249
42 3300046463 Ga0495653_0010057 Ga0495653_0010057_2768_3523 249
43 3300046473 Ga0495582_0041560 Ga0495582_0041560_15_782 249
44 3300046474 Ga0495605_0023314 Ga0495605_0023314_1542_2309 249
45 3300046474 Ga0495605_0045641 Ga0495605_0045641_853_1620 249
46 3300046474 Ga0495605_0049920 Ga0495605_0049920_553_1320 249
47 3300046491 Ga0495584_0021775 Ga0495584_0021775_1338_2099 249
48 3300046491 Ga0495584_0033941 Ga0495584_0033941_823_1590 249
49 3300046491 Ga0495584_0211458 Ga0495584_0211458_50_808 249
50 3300046491 Ga0495584_0211628 Ga0495584_0211628_83_844 249
51 3300046492 Ga0495585_0003540 Ga0495585_0003540_130_885 249
52 3300046492 Ga0495585_0026193 Ga0495585_0026193_1720_2475 249
53 3300046499 Ga0495594_0015085 Ga0495594_0015085_1008_1763 249
54 3300046499 Ga0495594_0035826 Ga0495594_0035826_1026_1793 249
55 3300046499 Ga0495594_0059038 Ga0495594_0059038_1200_1988 249
56 3300046500 Ga0495596_0009629 Ga0495596_0009629_2840_3595 249
57 3300046500 Ga0495596_0110688 Ga0495596_0110688_273_1034 249
58 3300046501 Ga0495607_0036322 Ga0495607_0036322_44_811 249
59 3300046506 Ga0495583_0000193 Ga0495583_0000193_54286_55050 249
60 3300046506 Ga0495583_0011809 Ga0495583_0011809_1439_2218 249
61 3300046513 Ga0495616_0000103 Ga0495616_0000103_47000_47752 249
62 3300046513 Ga0495616_0000218 Ga0495616_0000218_43552_44319 249
63 3300046513 Ga0495616_0023366 Ga0495616_0023366_922_1689 249
64 3300046518 Ga0495631_0002702 Ga0495631_0002702_812_1567 249
65 3300046518 Ga0495631_0028389 Ga0495631_0028389_762_1529 249
66 3300046518 Ga0495631_0063138 Ga0495631_0063138_109_864 249
67 3300046518 Ga0495631_0121249 Ga0495631_0121249_129_890 249
68 3300046519 Ga0495632_0000040 Ga0495632_0000040_78252_79013 249
69 3300046519 Ga0495632_0000224 Ga0495632_0000224_28096_28863 249
70 3300046519 Ga0495632_0053805 Ga0495632_0053805_550_1311 249
71 3300046520 Ga0495637_0010364 Ga0495637_0010364_348_1115 249
72 3300046522 Ga0495643_0000192 Ga0495643_0000192_58588_59367 249
73 3300046522 Ga0495643_0001383 Ga0495643_0001383_9064_9825 249
74 3300046523 Ga0495644_0042438 Ga0495644_0042438_732_1493 249
75 3300046523 Ga0495644_0048996 Ga0495644_0048996_132_887 249
76 3300046524 Ga0495648_0054579 Ga0495648_0054579_366_1124 249
77 3300046525 Ga0495663_0003912 Ga0495663_0003912_1835_2593 249
78 3300046528 Ga0495642_0001380 Ga0495642_0001380_750_1517 249
79 3300046528 Ga0495642_0040368 Ga0495642_0040368_126_881 249
80 3300046528 Ga0495642_0064847 Ga0495642_0064847_335_1090 249
81 3300046528 Ga0495642_0212268 Ga0495642_0212268_53_811 249
82 3300046531 Ga0495665_0041842 Ga0495665_0041842_1216_1977 249
83 3300046535 Ga0495586_0006176 Ga0495586_0006176_553_1308 249
84 3300046538 Ga0495609_0053091 Ga0495609_0053091_117_884 249
85 3300046542 Ga0495597_0048000 Ga0495597_0048000_799_1560 249
86 3300046542 Ga0495597_0052062 Ga0495597_0052062_989_1741 249
87 3300046542 Ga0495597_0085064 Ga0495597_0085064_264_1031 249
88 3300046557 Ga0495622_0034704 Ga0495622_0034704_537_1319 249
89 3300046558 Ga0495633_0011819 Ga0495633_0011819_2986_3741 249
90 3300046558 Ga0495633_0044625 Ga0495633_0044625_415_1182 249
91 3300046558 Ga0495633_0207042 Ga0495633_0207042_52_810 249
92 3300046616 Ga0495668_0001006 Ga0495668_0001006_26983_27753 249
93 3300046616 Ga0495668_0020958 Ga0495668_0020958_1994_2761 249
94 3300046616 Ga0495668_0046999 Ga0495668_0046999_1535_2296 249
95 3300046648 Ga0495611_0017487 Ga0495611_0017487_1124_1879 249
96 3300046648 Ga0495611_0154432 Ga0495611_0154432_125_892 249
97 3300046660 Ga0495625_0049302 Ga0495625_0049302_387_1154 249
98 3300046660 Ga0495625_0114575 Ga0495625_0114575_458_1219 249
99 3300046663 Ga0495635_0006068 Ga0495635_0006068_6914_7669 249
100 3300046665 Ga0495661_0000834 Ga0495661_0000834_22791_23546 249
101 3300046665 Ga0495661_0044752 Ga0495661_0044752_1276_2028 249
102 3300046665 Ga0495661_0132929 Ga0495661_0132929_402_1157 249
103 3300046674 Ga0495588_0064747 Ga0495588_0064747_1048_1803 249
104 3300046684 Ga0495669_0000122 Ga0495669_0000122_42064_42819 249
105 3300046684 Ga0495669_0002183 Ga0495669_0002183_7141_7896 249
106 3300046684 Ga0495669_0010601 Ga0495669_0010601_2997_3764 249
107 3300046689 Ga0495613_0036874 Ga0495613_0036874_57_812 249
108 3300046691 Ga0495670_0028814 Ga0495670_0028814_1549_2304 249
109 3300046691 Ga0495670_0032945 Ga0495670_0032945_895_1647 249
110 3300046691 Ga0495670_0059279 Ga0495670_0059279_244_1011 249
111 3300046694 Ga0495649_0008716 Ga0495649_0008716_4983_5750 249
112 3300046694 Ga0495649_0148858 Ga0495649_0148858_141_896 249
113 3300047317 Ga0495604_0032868 Ga0495604_0032868_84_839 249
114 3300047320 Ga0495672_0000576 Ga0495672_0000576_15674_16441 249
115 3300047320 Ga0495672_0123680 Ga0495672_0123680_587_1339 249
116 3300047321 Ga0495676_0000035 Ga0495676_0000035_69720_70502 249
117 3300047322 Ga0495680_0012466 Ga0495680_0012466_5348_6103 249
118 3300047323 Ga0495683_0115557 Ga0495683_0115557_439_1200 249
119 3300047444 Ga0495675_0005625 Ga0495675_0005625_5979_6734 249
120 3300047444 Ga0495675_0114982 Ga0495675_0114982_617_1378 249
121 3300047445 Ga0495677_0015052 Ga0495677_0015052_1142_1909 249
122 3300047445 Ga0495677_0037952 Ga0495677_0037952_60_815 249
123 3300047446 Ga0495679_045353 Ga0495679_045353_368_1135 249
124 3300047470 Ga0495681_0001651 Ga0495681_0001651_173_928 249
125 3300047470 Ga0495681_0159819 Ga0495681_0159819_32_787 249
126 3300047673 Ga0495593_0002046 Ga0495593_0002046_432_1187 249
127 3300048088 Ga0495602_0151919 Ga0495602_0151919_870_1631 249
128 3300048089 Ga0495614_0006138 Ga0495614_0006138_1322_2077 249
129 3300048089 Ga0495614_0037843 Ga0495614_0037843_889_1656 249
130 3300048090 Ga0495615_0015042 Ga0495615_0015042_669_1427 249
131 3300048091 Ga0495626_0000663 Ga0495626_0000663_30908_31684 249
132 3300048091 Ga0495626_0016560 Ga0495626_0016560_1918_2673 249
133 3300048091 Ga0495626_0027695 Ga0495626_0027695_588_1349 249
134 3300048091 Ga0495626_0059466 Ga0495626_0059466_19_780 249
135 3300048091 Ga0495626_0063083 Ga0495626_0063083_287_1042 249
136 3300048905 Ga0496102_0000253 Ga0496102_0000253_19526_20284 249
137 3300048906 Ga0496103_0412232 Ga0496103_0412232_66_824 249
138 3300048927 Ga0496124_0178580 Ga0496124_0178580_558_1319 249
139 3300049459 Ga0495678_006682 Ga0495678_006682_5288_6040 249
140 3300049459 Ga0495678_010498 Ga0495678_010498_688_1443 249
141 3300049460 Ga0495682_0037429 Ga0495682_0037429_215_976 249
142 3300002738 JGI25154J39366_1002002 JGI25154J39366_10020025 250
143 3300002773 JGI25152J39213_1000871 JGI25152J39213_10008712 250
144 3300002987 JGI25159J45721_1003728 JGI25159J45721_10037282 250
145 3300002987 JGI25159J45721_1004559 JGI25159J45721_10045595 250
146 3300003215 JGI25153J46596_10005411 JGI25153J46596_100054117 250
147 3300003322 rootL2_10080246 rootL2_100802463 250
148 3300003354 JGI25160J50197_1004525 JGI25160J50197_10045254 250
149 3300003374 JGI25161J50226_1002388 JGI25161J50226_10023885 250
150 3300003374 JGI25161J50226_1003008 JGI25161J50226_10030083 250
151 3300003759 Ga0055525_1000009 Ga0055525_1000009409 250
152 3300003762 Ga0055542_1014991 Ga0055542_10149912 250
153 3300003763 Ga0055529_1000327 Ga0055529_10003276 250
154 3300003771 Ga0055526_1000033 Ga0055526_100003371 250
155 3300003771 Ga0055526_1000634 Ga0055526_100063413 250
156 3300003771 Ga0055526_1001322 Ga0055526_100132217 250
157 3300003771 Ga0055526_1009156 Ga0055526_10091565 250
158 3300003773 Ga0055537_1000868 Ga0055537_100086812 250
159 3300003773 Ga0055537_1001060 Ga0055537_10010603 250
160 3300003773 Ga0055537_1012248 Ga0055537_10122482 250
161 3300003775 Ga0055524_1000027 Ga0055524_1000027155 250
162 3300003775 Ga0055524_1000594 Ga0055524_10005941 250
163 3300003775 Ga0055524_1003617 Ga0055524_10036179 250
164 3300003775 Ga0055524_1007698 Ga0055524_10076982 250
165 3300003775 Ga0055524_1009892 Ga0055524_10098923 250
166 3300003784 Ga0055534_1000072 Ga0055534_100007262 250
167 3300003784 Ga0055534_1004482 Ga0055534_10044823 250
168 3300003790 Ga0055528_1000043 Ga0055528_100004384 250
169 3300003790 Ga0055528_1005318 Ga0055528_10053187 250
170 3300003790 Ga0055528_1019076 Ga0055528_10190763 250
171 3300003791 Ga0055530_10014278 Ga0055530_100142783 250
172 3300003791 Ga0055530_10036649 Ga0055530_100366492 250
173 3300003794 Ga0055531_10017367 Ga0055531_100173674 250
174 3300004625 Ga0055543_1000797 Ga0055543_10007973 250
175 3300005262 Ga0065165_1002464 Ga0065165_10024643 250
176 3300005262 Ga0065165_1002941 Ga0065165_10029412 250
177 3300005327 Ga0070658_10098628 Ga0070658_100986283 250
178 3300005327 Ga0070658_10202229 Ga0070658_102022291 250
179 3300005339 Ga0070660_100189346 Ga0070660_1001893463 250
180 3300005344 Ga0070661_100075067 Ga0070661_1000750673 250
181 3300005366 Ga0070659_100028422 Ga0070659_1000284223 250
182 3300005366 Ga0070659_100200327 Ga0070659_1002003273 250
183 3300005457 Ga0070662_100074773 Ga0070662_1000747732 250
184 3300005563 Ga0068855_100011429 Ga0068855_10001142910 250
185 3300005563 Ga0068855_100266943 Ga0068855_1002669432 250
186 3300005563 Ga0068855_100807560 Ga0068855_1008075602 250
187 3300005564 Ga0070664_100616865 Ga0070664_1006168652 250
188 3300005616 Ga0068852_100305002 Ga0068852_1003050022 250
189 3300006948 Ga0099826_10000003 Ga0099826_10000003644 250
190 3300009036 Ga0105244_10121553 Ga0105244_101215532 250
191 3300009092 Ga0105250_10094991 Ga0105250_100949912 250
192 3300009098 Ga0105245_10412212 Ga0105245_104122122 250
193 3300009176 Ga0105242_10018924 Ga0105242_100189245 250
194 3300009176 Ga0105242_10248958 Ga0105242_102489583 250
195 3300009545 Ga0105237_10537905 Ga0105237_105379053 250
196 3300010375 Ga0105239_10140245 Ga0105239_101402451 250
197 3300013100 Ga0157373_10049572 Ga0157373_100495723 250
198 3300013102 Ga0157371_10000001 Ga0157371_10000001958 250
199 3300013296 Ga0157374_10814495 Ga0157374_108144951 250
200 3300015262 Ga0182007_10000030 Ga0182007_1000003033 250
201 3300015262 Ga0182007_10002705 Ga0182007_100027054 250
202 3300015262 Ga0182007_10017790 Ga0182007_100177903 250
203 3300021361 Ga0213872_10000135 Ga0213872_1000013519 250
204 3300022467 Ga0224712_10123766 Ga0224712_101237662 250
205 3300025208 Ga0209436_100278 Ga0209436_10027823 250
206 3300025208 Ga0209436_100364 Ga0209436_10036410 250
207 3300025230 Ga0209563_100015 Ga0209563_100015524 250
208 3300025233 Ga0209437_102788 Ga0209437_1027882 250
209 3300025245 Ga0207425_1000006 Ga0207425_1000006317 250
210 3300025245 Ga0207425_1000062 Ga0207425_100006281 250
211 3300025246 Ga0209646_1000047 Ga0209646_1000047198 250
212 3300025253 Ga0209677_104552 Ga0209677_1045524 250
213 3300025254 Ga0209148_1000794 Ga0209148_10007946 250
214 3300025258 Ga0209129_1000009 Ga0209129_1000009146 250
215 3300025258 Ga0209129_1006168 Ga0209129_10061685 250
216 3300025263 Ga0209565_1000006 Ga0209565_1000006399 250
217 3300025263 Ga0209565_1001289 Ga0209565_100128915 250
218 3300025263 Ga0209565_1001724 Ga0209565_10017242 250
219 3300025263 Ga0209565_1005512 Ga0209565_10055123 250
220 3300025263 Ga0209565_1022288 Ga0209565_10222882 250
221 3300025272 Ga0209455_1000051 Ga0209455_100005161 250
222 3300025273 Ga0209673_1000004 Ga0209673_1000004430 250
223 3300025273 Ga0209673_1008943 Ga0209673_10089435 250
224 3300025284 Ga0209130_1000501 Ga0209130_10005013 250
225 3300025284 Ga0209130_1001651 Ga0209130_100165112 250
226 3300025291 Ga0209675_1000006 Ga0209675_1000006398 250
227 3300025291 Ga0209675_1001178 Ga0209675_100117815 250
228 3300025291 Ga0209675_1004898 Ga0209675_10048986 250
229 3300025295 Ga0209564_1000006 Ga0209564_1000006600 250
230 3300025295 Ga0209564_1000085 Ga0209564_1000085123 250
231 3300025295 Ga0209564_1000087 Ga0209564_1000087241 250
232 3300025295 Ga0209564_1002792 Ga0209564_100279215 250
233 3300025295 Ga0209564_1025013 Ga0209564_10250132 250
234 3300025297 Ga0209758_1000047 Ga0209758_100004723 250
235 3300025298 Ga0209050_1000064 Ga0209050_1000064133 250
236 3300025298 Ga0209050_1000171 Ga0209050_100017180 250
237 3300025298 Ga0209050_1038238 Ga0209050_10382382 250
238 3300025299 Ga0209256_1000013 Ga0209256_1000013259 250
239 3300025299 Ga0209256_1000037 Ga0209256_1000037274 250
240 3300025299 Ga0209256_1000376 Ga0209256_100037625 250
241 3300025299 Ga0209256_1001366 Ga0209256_100136615 250
242 3300025299 Ga0209256_1005606 Ga0209256_10056064 250
243 3300025302 Ga0207426_1002831 Ga0207426_100283111 250
244 3300025303 Ga0209051_1025651 Ga0209051_10256512 250
245 3300025304 Ga0209257_1000010 Ga0209257_1000010493 250
246 3300025304 Ga0209257_1000998 Ga0209257_100099833 250
247 3300025304 Ga0209257_1013181 Ga0209257_10131811 250
248 3300025909 Ga0207705_10000783 Ga0207705_1000078310 250
249 3300025909 Ga0207705_10403111 Ga0207705_104031112 250
250 3300025911 Ga0207654_10007363 Ga0207654_100073634 250
251 3300025919 Ga0207657_10010154 Ga0207657_100101547 250
252 3300025919 Ga0207657_10038635 Ga0207657_100386355 250
253 3300025919 Ga0207657_10161020 Ga0207657_101610202 250
254 3300025920 Ga0207649_10042066 Ga0207649_100420662 250
255 3300025927 Ga0207687_10326403 Ga0207687_103264032 250
256 3300025932 Ga0207690_10468400 Ga0207690_104684002 250
257 3300025934 Ga0207686_10122803 Ga0207686_101228032 250
258 3300025935 Ga0207709_10425585 Ga0207709_104255852 250
259 3300025945 Ga0207679_10167487 Ga0207679_101674873 250
260 3300025949 Ga0207667_10004017 Ga0207667_1000401710 250
261 3300025949 Ga0207667_10846237 Ga0207667_108462371 250
262 3300026142 Ga0207698_10264210 Ga0207698_102642102 250
263 3300027666 Ga0209282_1000002 Ga0209282_1000002354 250
264 3300031548 Ga0307408_100000142 Ga0307408_10000014219 250
265 3300031548 Ga0307408_100003439 Ga0307408_1000034398 250
266 3300031548 Ga0307408_100013022 Ga0307408_1000130226 250
267 3300031548 Ga0307408_100074889 Ga0307408_1000748892 250
268 3300031711 Ga0265314_10019866 Ga0265314_100198668 250
269 3300031838 Ga0307518_10173803 Ga0307518_101738032 250
270 3300037312 Ga0395899_0002023 Ga0395899_0002023_9812_10582 250
271 3300037312 Ga0395899_0003182 Ga0395899_0003182_10864_11619 250
272 3300037312 Ga0395899_0005441 Ga0395899_0005441_14_769 250
273 3300037312 Ga0395899_0015570 Ga0395899_0015570_4843_5595 250
274 3300037312 Ga0395899_0095764 Ga0395899_0095764_436_1188 250
275 3300037418 Ga0395900_0000615 Ga0395900_0000615_43321_44076 250
276 3300037418 Ga0395900_0001279 Ga0395900_0001279_18170_18922 250
277 3300037418 Ga0395900_0003488 Ga0395900_0003488_1613_2383 250
278 3300037418 Ga0395900_0025412 Ga0395900_0025412_2355_3107 250
279 3300037418 Ga0395900_0067993 Ga0395900_0067993_1622_2377 250
280 3300037418 Ga0395900_0110374 Ga0395900_0110374_1161_1913 250
281 3300037418 Ga0395900_0176851 Ga0395900_0176851_876_1628 250
282 3300037418 Ga0395900_0333382 Ga0395900_0333382_509_1264 250
283 3300037466 Ga0395898_0021391 Ga0395898_0021391_1444_2196 250
284 3300037466 Ga0395898_0072044 Ga0395898_0072044_1003_1755 250
285 3300037466 Ga0395898_0074957 Ga0395898_0074957_861_1616 250
286 3300037466 Ga0395898_0416005 Ga0395898_0416005_362_1117 250
287 3300037466 Ga0395898_0752441 Ga0395898_0752441_73_825 250
288 3300037471 Ga0395905_0028738 Ga0395905_0028738_3168_3920 250
289 3300037471 Ga0395905_0045391 Ga0395905_0045391_1840_2592 250
290 3300037471 Ga0395905_0171291 Ga0395905_0171291_933_1688 250
291 3300037471 Ga0395905_0514453 Ga0395905_0514453_312_1067 250
292 3300037471 Ga0395905_0609623 Ga0395905_0609623_179_934 250
293 3300038443 Ga0395901_0000084 Ga0395901_0000084_62735_63490 250
294 3300038443 Ga0395901_0003015 Ga0395901_0003015_4456_5208 250
295 3300038443 Ga0395901_0079127 Ga0395901_0079127_2654_3409 250
296 3300038443 Ga0395901_0102519 Ga0395901_0102519_887_1639 250
297 3300038443 Ga0395901_0333537 Ga0395901_0333537_230_985 250
298 3300038443 Ga0395901_0387471 Ga0395901_0387471_471_1223 250
299 3300039447 Ga0436361_0073582 Ga0436361_0073582_1805_2557 250
300 3300039447 Ga0436361_0080101 Ga0436361_0080101_12772_13524 250
301 3300039447 Ga0436361_0239159 Ga0436361_0239159_2502_3254 250
302 3300039447 Ga0436361_0266787 Ga0436361_0266787_1970_2722 250
303 3300041999 Ga0439433_0029580 Ga0439433_0029580_472_1224 250
304 3300042005 Ga0439448_0000096 Ga0439448_0000096_11265_12017 250
305 3300042007 Ga0439449_0036063 Ga0439449_0036063_549_1301 250
306 3300042115 Ga0450911_022489 Ga0450911_022489_44_796 250
307 3300044658 Ga0466972_0000399 Ga0466972_0000399_21930_22685 250
308 3300044683 Ga0466965_0025072 Ga0466965_0025072_1724_2476 250
309 3300044683 Ga0466965_0137857 Ga0466965_0137857_15_782 250
310 3300044683 Ga0466965_0240246 Ga0466965_0240246_159_926 250
311 3300044684 Ga0466966_0050522 Ga0466966_0050522_1060_1827 250
312 3300044684 Ga0466966_0113197 Ga0466966_0113197_749_1501 250
313 3300044694 Ga0466963_0088211 Ga0466963_0088211_798_1550 250
314 3300044706 Ga0466964_0002921 Ga0466964_0002921_5235_5990 250
315 3300044706 Ga0466964_0003857 Ga0466964_0003857_3376_4128 250
316 3300044719 Ga0466971_0050732 Ga0466971_0050732_759_1526 250
317 3300044735 Ga0466968_0001156 Ga0466968_0001156_2303_3058 250
318 3300044765 Ga0466970_0018780 Ga0466970_0018780_1503_2255 250
319 3300044842 Ga0466957_0000163 Ga0466957_0000163_6466_7233 250
320 3300044842 Ga0466957_0325150 Ga0466957_0325150_46_801 250
321 3300044901 Ga0466960_0086851 Ga0466960_0086851_225_980 250
322 3300045049 Ga0466959_0043994 Ga0466959_0043994_181_948 250
323 3300045049 Ga0466959_0300787 Ga0466959_0300787_236_991 250
324 3300045976 Ga0466967_0012126 Ga0466967_0012126_341_1093 250
325 3300045976 Ga0466967_0049203 Ga0466967_0049203_1708_2463 250
326 3300046452 Ga0495617_000002 Ga0495617_000002_141436_142191 250
327 3300046452 Ga0495617_000102 Ga0495617_000102_17013_17765 250
328 3300046452 Ga0495617_036276 Ga0495617_036276_224_985 250
329 3300046453 Ga0495627_000066 Ga0495627_000066_74238_74990 250
330 3300046453 Ga0495627_000176 Ga0495627_000176_44455_45210 250
331 3300046453 Ga0495627_010166 Ga0495627_010166_874_1635 250
332 3300046453 Ga0495627_012381 Ga0495627_012381_1610_2362 250
333 3300046457 Ga0495590_0000044 Ga0495590_0000044_89570_90331 250
334 3300046457 Ga0495590_0000495 Ga0495590_0000495_508_1260 250
335 3300046457 Ga0495590_0001266 Ga0495590_0001266_530_1306 250
336 3300046457 Ga0495590_0051195 Ga0495590_0051195_588_1343 250
337 3300046458 Ga0495591_000052 Ga0495591_000052_68442_69203 250
338 3300046460 Ga0495638_0002116 Ga0495638_0002116_10733_11485 250
339 3300046460 Ga0495638_0009451 Ga0495638_0009451_4333_5085 250
340 3300046460 Ga0495638_0047183 Ga0495638_0047183_1534_2310 250
341 3300046460 Ga0495638_0201796 Ga0495638_0201796_246_998 250
342 3300046462 Ga0495651_0000657 Ga0495651_0000657_10514_11269 250
343 3300046463 Ga0495653_0000007 Ga0495653_0000007_196461_197213 250
344 3300046463 Ga0495653_0016788 Ga0495653_0016788_4284_5036 250
345 3300046463 Ga0495653_0043877 Ga0495653_0043877_1455_2216 250
346 3300046463 Ga0495653_0196064 Ga0495653_0196064_557_1309 250
347 3300046471 Ga0495650_0001071 Ga0495650_0001071_3713_4465 250
348 3300046471 Ga0495650_0016641 Ga0495650_0016641_1140_1892 250
349 3300046474 Ga0495605_0000081 Ga0495605_0000081_75113_75868 250
350 3300046474 Ga0495605_0000087 Ga0495605_0000087_65251_66006 250
351 3300046474 Ga0495605_0001493 Ga0495605_0001493_10527_11279 250
352 3300046474 Ga0495605_0004580 Ga0495605_0004580_122_883 250
353 3300046474 Ga0495605_0045274 Ga0495605_0045274_494_1246 250
354 3300046474 Ga0495605_0059122 Ga0495605_0059122_959_1720 250
355 3300046474 Ga0495605_0070769 Ga0495605_0070769_599_1360 250
356 3300046475 Ga0495639_0075784 Ga0495639_0075784_591_1343 250
357 3300046491 Ga0495584_0000196 Ga0495584_0000196_19000_19752 250
358 3300046491 Ga0495584_0000224 Ga0495584_0000224_12111_12872 250
359 3300046491 Ga0495584_0001717 Ga0495584_0001717_11017_11769 250
360 3300046491 Ga0495584_0010327 Ga0495584_0010327_1359_2126 250
361 3300046491 Ga0495584_0026010 Ga0495584_0026010_864_1616 250
362 3300046491 Ga0495584_0050314 Ga0495584_0050314_1179_1940 250
363 3300046491 Ga0495584_0050938 Ga0495584_0050938_112_879 250
364 3300046491 Ga0495584_0123483 Ga0495584_0123483_411_1163 250
365 3300046492 Ga0495585_0000078 Ga0495585_0000078_49356_50108 250
366 3300046492 Ga0495585_0001087 Ga0495585_0001087_20776_21528 250
367 3300046492 Ga0495585_0003916 Ga0495585_0003916_8328_9080 250
368 3300046492 Ga0495585_0010860 Ga0495585_0010860_882_1634 250
369 3300046492 Ga0495585_0019263 Ga0495585_0019263_923_1684 250
370 3300046492 Ga0495585_0047816 Ga0495585_0047816_1353_2114 250
371 3300046492 Ga0495585_0104533 Ga0495585_0104533_54_815 250
372 3300046500 Ga0495596_0000101 Ga0495596_0000101_48853_49605 250
373 3300046500 Ga0495596_0003471 Ga0495596_0003471_1055_1810 250
374 3300046500 Ga0495596_0005404 Ga0495596_0005404_3552_4313 250
375 3300046500 Ga0495596_0028479 Ga0495596_0028479_816_1577 250
376 3300046500 Ga0495596_0046983 Ga0495596_0046983_639_1406 250
377 3300046500 Ga0495596_0048759 Ga0495596_0048759_272_1057 250
378 3300046500 Ga0495596_0069971 Ga0495596_0069971_272_1057 250
379 3300046500 Ga0495596_0100250 Ga0495596_0100250_18_803 250
380 3300046501 Ga0495607_0000658 Ga0495607_0000658_27749_28519 250
381 3300046501 Ga0495607_0001173 Ga0495607_0001173_602_1354 250
382 3300046501 Ga0495607_0001229 Ga0495607_0001229_14652_15407 250
383 3300046501 Ga0495607_0002192 Ga0495607_0002192_7566_8321 250
384 3300046501 Ga0495607_0009313 Ga0495607_0009313_4986_5741 250
385 3300046501 Ga0495607_0072065 Ga0495607_0072065_185_937 250
386 3300046501 Ga0495607_0088917 Ga0495607_0088917_341_1102 250
387 3300046501 Ga0495607_0127281 Ga0495607_0127281_567_1319 250
388 3300046501 Ga0495607_0143834 Ga0495607_0143834_102_878 250
389 3300046501 Ga0495607_0152272 Ga0495607_0152272_417_1169 250
390 3300046506 Ga0495583_0000004 Ga0495583_0000004_218011_218763 250
391 3300046506 Ga0495583_0000241 Ga0495583_0000241_45502_46263 250
392 3300046506 Ga0495583_0003098 Ga0495583_0003098_4058_4819 250
393 3300046506 Ga0495583_0004796 Ga0495583_0004796_1468_2229 250
394 3300046506 Ga0495583_0021585 Ga0495583_0021585_2353_3129 250
395 3300046506 Ga0495583_0033077 Ga0495583_0033077_816_1577 250
396 3300046506 Ga0495583_0034831 Ga0495583_0034831_376_1128 250
397 3300046506 Ga0495583_0036586 Ga0495583_0036586_228_995 250
398 3300046506 Ga0495583_0080242 Ga0495583_0080242_591_1343 250
399 3300046507 Ga0495606_0002401 Ga0495606_0002401_3190_3957 250
400 3300046507 Ga0495606_0002849 Ga0495606_0002849_147_899 250
401 3300046507 Ga0495606_0018245 Ga0495606_0018245_894_1646 250
402 3300046507 Ga0495606_0112392 Ga0495606_0112392_585_1340 250
403 3300046512 Ga0495610_0000004 Ga0495610_0000004_910196_910948 250
404 3300046512 Ga0495610_0000493 Ga0495610_0000493_20998_21759 250
405 3300046512 Ga0495610_0063409 Ga0495610_0063409_68_820 250
406 3300046513 Ga0495616_0001114 Ga0495616_0001114_495_1247 250
407 3300046513 Ga0495616_0010324 Ga0495616_0010324_1172_1933 250
408 3300046513 Ga0495616_0028097 Ga0495616_0028097_2024_2791 250
409 3300046513 Ga0495616_0086920 Ga0495616_0086920_110_871 250
410 3300046513 Ga0495616_0114000 Ga0495616_0114000_91_843 250
411 3300046513 Ga0495616_0135292 Ga0495616_0135292_131_907 250
412 3300046514 Ga0495618_0210065 Ga0495618_0210065_198_953 250
413 3300046515 Ga0495620_0000960 Ga0495620_0000960_13630_14382 250
414 3300046516 Ga0495628_0000037 Ga0495628_0000037_42579_43334 250
415 3300046517 Ga0495630_0063260 Ga0495630_0063260_1487_2239 250
416 3300046518 Ga0495631_0000236 Ga0495631_0000236_29080_29841 250
417 3300046518 Ga0495631_0000447 Ga0495631_0000447_806_1582 250
418 3300046518 Ga0495631_0008443 Ga0495631_0008443_1053_1808 250
419 3300046518 Ga0495631_0011996 Ga0495631_0011996_2148_2909 250
420 3300046518 Ga0495631_0016753 Ga0495631_0016753_305_1057 250
421 3300046518 Ga0495631_0047850 Ga0495631_0047850_316_1077 250
422 3300046518 Ga0495631_0081633 Ga0495631_0081633_595_1362 250
423 3300046518 Ga0495631_0138736 Ga0495631_0138736_121_891 250
424 3300046519 Ga0495632_0000114 Ga0495632_0000114_50722_51483 250
425 3300046519 Ga0495632_0022043 Ga0495632_0022043_2649_3410 250
426 3300046519 Ga0495632_0027170 Ga0495632_0027170_982_1758 250
427 3300046519 Ga0495632_0028357 Ga0495632_0028357_1495_2256 250
428 3300046519 Ga0495632_0031460 Ga0495632_0031460_507_1259 250
429 3300046519 Ga0495632_0044022 Ga0495632_0044022_364_1119 250
430 3300046519 Ga0495632_0225539 Ga0495632_0225539_68_823 250
431 3300046520 Ga0495637_0000006 Ga0495637_0000006_151360_152121 250
432 3300046520 Ga0495637_0035425 Ga0495637_0035425_892_1653 250
433 3300046522 Ga0495643_0002571 Ga0495643_0002571_7603_8358 250
434 3300046522 Ga0495643_0067066 Ga0495643_0067066_358_1119 250
435 3300046522 Ga0495643_0143869 Ga0495643_0143869_211_972 250
436 3300046523 Ga0495644_0001907 Ga0495644_0001907_2153_2905 250
437 3300046523 Ga0495644_0003124 Ga0495644_0003124_4993_5745 250
438 3300046523 Ga0495644_0006126 Ga0495644_0006126_3061_3822 250
439 3300046523 Ga0495644_0007910 Ga0495644_0007910_1543_2295 250
440 3300046523 Ga0495644_0016476 Ga0495644_0016476_1105_1857 250
441 3300046523 Ga0495644_0046334 Ga0495644_0046334_48_815 250
442 3300046523 Ga0495644_0062398 Ga0495644_0062398_114_875 250
443 3300046524 Ga0495648_0000801 Ga0495648_0000801_12685_13437 250
444 3300046524 Ga0495648_0001877 Ga0495648_0001877_846_1631 250
445 3300046524 Ga0495648_0003322 Ga0495648_0003322_921_1676 250
446 3300046524 Ga0495648_0008158 Ga0495648_0008158_7188_7940 250
447 3300046524 Ga0495648_0019440 Ga0495648_0019440_1019_1774 250
448 3300046524 Ga0495648_0069422 Ga0495648_0069422_1110_1871 250
449 3300046524 Ga0495648_0069909 Ga0495648_0069909_43_798 250
450 3300046525 Ga0495663_0018728 Ga0495663_0018728_1186_1938 250
451 3300046525 Ga0495663_0035740 Ga0495663_0035740_324_1085 250
452 3300046528 Ga0495642_0000057 Ga0495642_0000057_51485_52240 250
453 3300046528 Ga0495642_0000968 Ga0495642_0000968_1685_2440 250
454 3300046528 Ga0495642_0008410 Ga0495642_0008410_2896_3648 250
455 3300046528 Ga0495642_0008649 Ga0495642_0008649_927_1694 250
456 3300046528 Ga0495642_0029744 Ga0495642_0029744_1315_2076 250
457 3300046528 Ga0495642_0042462 Ga0495642_0042462_626_1378 250
458 3300046528 Ga0495642_0053037 Ga0495642_0053037_248_1000 250
459 3300046529 Ga0495652_0005170 Ga0495652_0005170_2137_2892 250
460 3300046529 Ga0495652_0035033 Ga0495652_0035033_3143_3895 250
461 3300046530 Ga0495654_0007243 Ga0495654_0007243_1240_2007 250
462 3300046530 Ga0495654_0022994 Ga0495654_0022994_348_1103 250
463 3300046530 Ga0495654_0024010 Ga0495654_0024010_1570_2337 250
464 3300046530 Ga0495654_0042119 Ga0495654_0042119_94_846 250
465 3300046530 Ga0495654_0089817 Ga0495654_0089817_396_1148 250
466 3300046530 Ga0495654_0142146 Ga0495654_0142146_240_1016 250
467 3300046536 Ga0495587_0053076 Ga0495587_0053076_114_869 250
468 3300046536 Ga0495587_0162234 Ga0495587_0162234_386_1138 250
469 3300046538 Ga0495609_0000096 Ga0495609_0000096_49734_50486 250
470 3300046538 Ga0495609_0000299 Ga0495609_0000299_44994_45746 250
471 3300046538 Ga0495609_0000634 Ga0495609_0000634_6371_7156 250
472 3300046538 Ga0495609_0000831 Ga0495609_0000831_16457_17227 250
473 3300046538 Ga0495609_0000915 Ga0495609_0000915_3513_4265 250
474 3300046538 Ga0495609_0002900 Ga0495609_0002900_1107_1859 250
475 3300046538 Ga0495609_0024334 Ga0495609_0024334_966_1733 250
476 3300046538 Ga0495609_0117050 Ga0495609_0117050_316_1077 250
477 3300046538 Ga0495609_0140923 Ga0495609_0140923_120_872 250
478 3300046542 Ga0495597_0000146 Ga0495597_0000146_14275_15030 250
479 3300046542 Ga0495597_0000586 Ga0495597_0000586_9801_10562 250
480 3300046542 Ga0495597_0000671 Ga0495597_0000671_9551_10303 250
481 3300046542 Ga0495597_0000787 Ga0495597_0000787_8561_9328 250
482 3300046542 Ga0495597_0002670 Ga0495597_0002670_9413_10165 250
483 3300046542 Ga0495597_0026258 Ga0495597_0026258_857_1609 250
484 3300046542 Ga0495597_0084331 Ga0495597_0084331_384_1157 250
485 3300046542 Ga0495597_0088972 Ga0495597_0088972_313_1065 250
486 3300046543 Ga0495645_0010488 Ga0495645_0010488_843_1598 250
487 3300046557 Ga0495622_0000032 Ga0495622_0000032_59215_59967 250
488 3300046558 Ga0495633_0000425 Ga0495633_0000425_35806_36573 250
489 3300046558 Ga0495633_0006471 Ga0495633_0006471_5229_5981 250
490 3300046558 Ga0495633_0006790 Ga0495633_0006790_4430_5191 250
491 3300046558 Ga0495633_0014689 Ga0495633_0014689_1507_2268 250
492 3300046558 Ga0495633_0032333 Ga0495633_0032333_1651_2418 250
493 3300046558 Ga0495633_0040066 Ga0495633_0040066_141_893 250
494 3300046558 Ga0495633_0050018 Ga0495633_0050018_679_1431 250
495 3300046558 Ga0495633_0053487 Ga0495633_0053487_391_1143 250
496 3300046558 Ga0495633_0081916 Ga0495633_0081916_510_1271 250
497 3300046558 Ga0495633_0129328 Ga0495633_0129328_186_950 250
498 3300046558 Ga0495633_0188175 Ga0495633_0188175_133_900 250
499 3300046558 Ga0495633_0191962 Ga0495633_0191962_124_876 250
500 3300046615 Ga0495656_0009953 Ga0495656_0009953_1166_1921 250
501 3300046615 Ga0495656_0011513 Ga0495656_0011513_1240_1992 250
502 3300046615 Ga0495656_0035961 Ga0495656_0035961_543_1295 250
503 3300046615 Ga0495656_0093925 Ga0495656_0093925_355_1131 250
504 3300046615 Ga0495656_0140969 Ga0495656_0140969_261_1016 250
505 3300046615 Ga0495656_0236303 Ga0495656_0236303_157_909 250
506 3300046616 Ga0495668_0000435 Ga0495668_0000435_26324_27100 250
507 3300046616 Ga0495668_0002251 Ga0495668_0002251_960_1715 250
508 3300046616 Ga0495668_0007261 Ga0495668_0007261_5503_6255 250
509 3300046616 Ga0495668_0023528 Ga0495668_0023528_1124_1891 250
510 3300046616 Ga0495668_0033216 Ga0495668_0033216_755_1516 250
511 3300046616 Ga0495668_0062675 Ga0495668_0062675_595_1356 250
512 3300046616 Ga0495668_0095333 Ga0495668_0095333_157_924 250
513 3300046642 Ga0495634_0054055 Ga0495634_0054055_1649_2401 250
514 3300046648 Ga0495611_0001617 Ga0495611_0001617_1113_1874 250
515 3300046648 Ga0495611_0001734 Ga0495611_0001734_5816_6568 250
516 3300046648 Ga0495611_0005111 Ga0495611_0005111_1803_2564 250
517 3300046648 Ga0495611_0018346 Ga0495611_0018346_1579_2331 250
518 3300046648 Ga0495611_0027469 Ga0495611_0027469_854_1606 250
519 3300046660 Ga0495625_0010194 Ga0495625_0010194_791_1543 250
520 3300046660 Ga0495625_0017371 Ga0495625_0017371_4013_4774 250
521 3300046660 Ga0495625_0032642 Ga0495625_0032642_2745_3497 250
522 3300046660 Ga0495625_0037091 Ga0495625_0037091_922_1683 250
523 3300046660 Ga0495625_0040611 Ga0495625_0040611_1689_2441 250
524 3300046660 Ga0495625_0068656 Ga0495625_0068656_776_1555 250
525 3300046660 Ga0495625_0077379 Ga0495625_0077379_988_1764 250
526 3300046664 Ga0495659_0000029 Ga0495659_0000029_60280_61032 250
527 3300046664 Ga0495659_0000428 Ga0495659_0000428_14711_15463 250
528 3300046664 Ga0495659_0090340 Ga0495659_0090340_109_861 250
529 3300046665 Ga0495661_0000164 Ga0495661_0000164_26752_27504 250
530 3300046665 Ga0495661_0000439 Ga0495661_0000439_36174_36935 250
531 3300046665 Ga0495661_0005789 Ga0495661_0005789_3343_4113 250
532 3300046665 Ga0495661_0007153 Ga0495661_0007153_1201_1956 250
533 3300046665 Ga0495661_0010121 Ga0495661_0010121_3974_4729 250
534 3300046665 Ga0495661_0030023 Ga0495661_0030023_431_1192 250
535 3300046665 Ga0495661_0033458 Ga0495661_0033458_1247_2023 250
536 3300046665 Ga0495661_0052231 Ga0495661_0052231_456_1217 250
537 3300046665 Ga0495661_0061385 Ga0495661_0061385_808_1560 250
538 3300046665 Ga0495661_0069022 Ga0495661_0069022_809_1570 250
539 3300046665 Ga0495661_0125707 Ga0495661_0125707_593_1363 250
540 3300046665 Ga0495661_0166822 Ga0495661_0166822_292_1044 250
541 3300046674 Ga0495588_0000070 Ga0495588_0000070_68199_68951 250
542 3300046679 Ga0495623_0013434 Ga0495623_0013434_3985_4740 250
543 3300046679 Ga0495623_0060728 Ga0495623_0060728_618_1370 250
544 3300046684 Ga0495669_0028146 Ga0495669_0028146_1556_2308 250
545 3300046684 Ga0495669_0044371 Ga0495669_0044371_1018_1779 250
546 3300046684 Ga0495669_0079382 Ga0495669_0079382_48_803 250
547 3300046691 Ga0495670_0010477 Ga0495670_0010477_2507_3259 250
548 3300046691 Ga0495670_0018007 Ga0495670_0018007_1287_2051 250
549 3300046691 Ga0495670_0031327 Ga0495670_0031327_1691_2443 250
550 3300046691 Ga0495670_0047137 Ga0495670_0047137_1071_1823 250
551 3300046691 Ga0495670_0071526 Ga0495670_0071526_393_1154 250
552 3300046691 Ga0495670_0238236 Ga0495670_0238236_132_887 250
553 3300046692 Ga0495671_0000074 Ga0495671_0000074_40087_40839 250
554 3300046692 Ga0495671_0000132 Ga0495671_0000132_15472_16227 250
555 3300046692 Ga0495671_0000531 Ga0495671_0000531_853_1605 250
556 3300046692 Ga0495671_0020910 Ga0495671_0020910_2227_2988 250
557 3300046692 Ga0495671_0039690 Ga0495671_0039690_906_1658 250
558 3300046692 Ga0495671_0055031 Ga0495671_0055031_127_879 250
559 3300046692 Ga0495671_0058138 Ga0495671_0058138_589_1365 250
560 3300046692 Ga0495671_0186745 Ga0495671_0186745_177_929 250
561 3300046692 Ga0495671_0186747 Ga0495671_0186747_78_830 250
562 3300046692 Ga0495671_0214199 Ga0495671_0214199_131_892 250
563 3300046694 Ga0495649_0001595 Ga0495649_0001595_12744_13520 250
564 3300046694 Ga0495649_0005128 Ga0495649_0005128_1117_1878 250
565 3300046694 Ga0495649_0022582 Ga0495649_0022582_615_1367 250
566 3300046694 Ga0495649_0050171 Ga0495649_0050171_1208_1963 250
567 3300046694 Ga0495649_0059068 Ga0495649_0059068_714_1466 250
568 3300046694 Ga0495649_0102599 Ga0495649_0102599_97_858 250
569 3300046694 Ga0495649_0184616 Ga0495649_0184616_112_864 250
570 3300046794 Ga0495589_0000036 Ga0495589_0000036_51149_51901 250
571 3300046794 Ga0495589_0000092 Ga0495589_0000092_14098_14853 250
572 3300046794 Ga0495589_0000210 Ga0495589_0000210_22192_22947 250
573 3300046794 Ga0495589_0004418 Ga0495589_0004418_5987_6748 250
574 3300046794 Ga0495589_0004698 Ga0495589_0004698_4430_5191 250
575 3300046794 Ga0495589_0010102 Ga0495589_0010102_3050_3805 250
576 3300046794 Ga0495589_0016488 Ga0495589_0016488_2958_3725 250
577 3300046794 Ga0495589_0041547 Ga0495589_0041547_316_1080 250
578 3300046794 Ga0495589_0052416 Ga0495589_0052416_956_1708 250
579 3300046810 Ga0495660_0000117 Ga0495660_0000117_56453_57208 250
580 3300046810 Ga0495660_0001695 Ga0495660_0001695_7672_8424 250
581 3300046810 Ga0495660_0004682 Ga0495660_0004682_187_948 250
582 3300046810 Ga0495660_0005961 Ga0495660_0005961_1363_2115 250
583 3300046810 Ga0495660_0007134 Ga0495660_0007134_5222_5974 250
584 3300046810 Ga0495660_0011912 Ga0495660_0011912_177_938 250
585 3300046810 Ga0495660_0012522 Ga0495660_0012522_2030_2791 250
586 3300046810 Ga0495660_0032443 Ga0495660_0032443_134_895 250
587 3300046810 Ga0495660_0034539 Ga0495660_0034539_1182_1937 250
588 3300046810 Ga0495660_0077271 Ga0495660_0077271_684_1451 250
589 3300046810 Ga0495660_0103065 Ga0495660_0103065_470_1222 250
590 3300046810 Ga0495660_0129821 Ga0495660_0129821_313_1068 250
591 3300046810 Ga0495660_0235193 Ga0495660_0235193_64_819 250
592 3300047317 Ga0495604_0038278 Ga0495604_0038278_2796_3548 250
593 3300047318 Ga0495636_0038460 Ga0495636_0038460_709_1461 250
594 3300047318 Ga0495636_0067274 Ga0495636_0067274_740_1513 250
595 3300047320 Ga0495672_0000086 Ga0495672_0000086_65287_66048 250
596 3300047320 Ga0495672_0000337 Ga0495672_0000337_1750_2535 250
597 3300047320 Ga0495672_0001769 Ga0495672_0001769_8153_8905 250
598 3300047320 Ga0495672_0006333 Ga0495672_0006333_3806_4573 250
599 3300047320 Ga0495672_0007292 Ga0495672_0007292_7238_7993 250
600 3300047320 Ga0495672_0061770 Ga0495672_0061770_1263_2024 250
601 3300047322 Ga0495680_0336080 Ga0495680_0336080_35_796 250
602 3300047323 Ga0495683_0000080 Ga0495683_0000080_7179_7940 250
603 3300047323 Ga0495683_0004092 Ga0495683_0004092_1179_1940 250
604 3300047323 Ga0495683_0020130 Ga0495683_0020130_2615_3400 250
605 3300047323 Ga0495683_0047547 Ga0495683_0047547_1159_1911 250
606 3300047323 Ga0495683_0049548 Ga0495683_0049548_1220_1987 250
607 3300047323 Ga0495683_0100458 Ga0495683_0100458_230_982 250
608 3300047323 Ga0495683_0101661 Ga0495683_0101661_344_1099 250
609 3300047443 Ga0495687_000074 Ga0495687_000074_51288_52040 250
610 3300047443 Ga0495687_000154 Ga0495687_000154_49099_49866 250
611 3300047443 Ga0495687_000311 Ga0495687_000311_7265_8017 250
612 3300047443 Ga0495687_000403 Ga0495687_000403_39904_40656 250
613 3300047443 Ga0495687_000416 Ga0495687_000416_33694_34455 250
614 3300047443 Ga0495687_001235 Ga0495687_001235_15760_16527 250
615 3300047443 Ga0495687_002089 Ga0495687_002089_10801_11556 250
616 3300047443 Ga0495687_036806 Ga0495687_036806_129_893 250
617 3300047444 Ga0495675_0007502 Ga0495675_0007502_257_1009 250
618 3300047445 Ga0495677_0000037 Ga0495677_0000037_26799_27551 250
619 3300047445 Ga0495677_0000402 Ga0495677_0000402_17683_18444 250
620 3300047445 Ga0495677_0003529 Ga0495677_0003529_231_992 250
621 3300047445 Ga0495677_0008198 Ga0495677_0008198_2796_3551 250
622 3300047445 Ga0495677_0055726 Ga0495677_0055726_197_958 250
623 3300047446 Ga0495679_005095 Ga0495679_005095_4123_4884 250
624 3300047446 Ga0495679_027886 Ga0495679_027886_163_924 250
625 3300047446 Ga0495679_047483 Ga0495679_047483_327_1079 250
626 3300047446 Ga0495679_047484 Ga0495679_047484_327_1079 250
627 3300047446 Ga0495679_048106 Ga0495679_048106_361_1122 250
628 3300047447 Ga0495685_017666 Ga0495685_017666_362_1114 250
629 3300047469 Ga0495673_0000135 Ga0495673_0000135_52551_53303 250
630 3300047469 Ga0495673_0000252 Ga0495673_0000252_16964_17716 250
631 3300047470 Ga0495681_0000413 Ga0495681_0000413_31985_32746 250
632 3300047470 Ga0495681_0001633 Ga0495681_0001633_9515_10282 250
633 3300047470 Ga0495681_0007860 Ga0495681_0007860_5094_5855 250
634 3300047470 Ga0495681_0011842 Ga0495681_0011842_159_911 250
635 3300047470 Ga0495681_0043437 Ga0495681_0043437_1266_2018 250
636 3300047470 Ga0495681_0046550 Ga0495681_0046550_386_1138 250
637 3300047470 Ga0495681_0049445 Ga0495681_0049445_1161_1922 250
638 3300047470 Ga0495681_0064303 Ga0495681_0064303_847_1599 250
639 3300047470 Ga0495681_0086564 Ga0495681_0086564_437_1189 250
640 3300047472 Ga0495686_0001380 Ga0495686_0001380_20685_21440 250
641 3300047472 Ga0495686_0011603 Ga0495686_0011603_4451_5212 250
642 3300047472 Ga0495686_0046824 Ga0495686_0046824_351_1106 250
643 3300047472 Ga0495686_0069116 Ga0495686_0069116_895_1647 250
644 3300047472 Ga0495686_0081647 Ga0495686_0081647_94_849 250
645 3300048088 Ga0495602_0000889 Ga0495602_0000889_8030_8782 250
646 3300048088 Ga0495602_0004236 Ga0495602_0004236_9725_10480 250
647 3300048091 Ga0495626_0000006 Ga0495626_0000006_91929_92684 250
648 3300048091 Ga0495626_0000454 Ga0495626_0000454_21665_22417 250
649 3300048091 Ga0495626_0004189 Ga0495626_0004189_134_889 250
650 3300048091 Ga0495626_0004944 Ga0495626_0004944_1120_1881 250
651 3300048091 Ga0495626_0017647 Ga0495626_0017647_543_1295 250
652 3300048091 Ga0495626_0024611 Ga0495626_0024611_1462_2223 250
653 3300048091 Ga0495626_0035170 Ga0495626_0035170_984_1745 250
654 3300048091 Ga0495626_0128038 Ga0495626_0128038_183_938 250
655 3300048903 Ga0496100_0131785 Ga0496100_0131785_463_1224 250
656 3300048904 Ga0496101_0063748 Ga0496101_0063748_497_1258 250
657 3300048905 Ga0496102_0064768 Ga0496102_0064768_688_1443 250
658 3300048905 Ga0496102_0149345 Ga0496102_0149345_492_1247 250
659 3300048905 Ga0496102_0658510 Ga0496102_0658510_167_934 250
660 3300048906 Ga0496103_0007074 Ga0496103_0007074_5622_6377 250
661 3300048906 Ga0496103_0038645 Ga0496103_0038645_186_953 250
662 3300048908 Ga0496105_0356255 Ga0496105_0356255_115_882 250
663 3300048909 Ga0496106_0002199 Ga0496106_0002199_13448_14200 250
664 3300048910 Ga0496107_0251577 Ga0496107_0251577_396_1160 250
665 3300048910 Ga0496107_0356043 Ga0496107_0356043_55_816 250
666 3300048912 Ga0496109_0026349 Ga0496109_0026349_1410_2171 250
667 3300048913 Ga0496110_0001360 Ga0496110_0001360_9346_10107 250
668 3300048914 Ga0496111_0028579 Ga0496111_0028579_2363_3130 250
669 3300048914 Ga0496111_0205054 Ga0496111_0205054_139_900 250
670 3300048915 Ga0496112_0091218 Ga0496112_0091218_1824_2585 250
671 3300048916 Ga0496113_0023479 Ga0496113_0023479_3422_4177 250
672 3300048916 Ga0496113_0097956 Ga0496113_0097956_1279_2040 250
673 3300048918 Ga0496115_0065401 Ga0496115_0065401_145_924 250
674 3300048924 Ga0496121_0076173 Ga0496121_0076173_1062_1817 250
675 3300048925 Ga0496122_0000942 Ga0496122_0000942_9958_10719 250
676 3300048925 Ga0496122_0004618 Ga0496122_0004618_4259_5014 250
677 3300048925 Ga0496122_0018052 Ga0496122_0018052_3603_4358 250
678 3300048925 Ga0496122_0113861 Ga0496122_0113861_391_1143 250
679 3300048925 Ga0496122_0127562 Ga0496122_0127562_774_1526 250
680 3300048926 Ga0496123_0000819 Ga0496123_0000819_26703_27464 250
681 3300048926 Ga0496123_0005379 Ga0496123_0005379_3187_3942 250
682 3300048926 Ga0496123_0018038 Ga0496123_0018038_4123_4875 250
683 3300048927 Ga0496124_0016323 Ga0496124_0016323_4836_5591 250
684 3300048927 Ga0496124_0048037 Ga0496124_0048037_1843_2595 250
685 3300048927 Ga0496124_0056035 Ga0496124_0056035_545_1300 250
686 3300048927 Ga0496124_0062793 Ga0496124_0062793_1491_2243 250
687 3300048927 Ga0496124_0084546 Ga0496124_0084546_920_1696 250
688 3300048928 Ga0496125_0009738 Ga0496125_0009738_2823_3584 250
689 3300048928 Ga0496125_0085688 Ga0496125_0085688_1024_1779 250
690 3300048928 Ga0496125_0293296 Ga0496125_0293296_167_922 250
691 3300048928 Ga0496125_0367940 Ga0496125_0367940_56_811 250
692 3300049128 Ga0501308_007616 Ga0501308_007616_103_858 250
693 3300049459 Ga0495678_000001 Ga0495678_000001_809493_810245 250
694 3300049459 Ga0495678_000064 Ga0495678_000064_89356_90117 250
695 3300049459 Ga0495678_001466 Ga0495678_001466_16876_17637 250
696 3300049459 Ga0495678_001530 Ga0495678_001530_10418_11185 250
697 3300049459 Ga0495678_003355 Ga0495678_003355_7127_7888 250
698 3300049459 Ga0495678_014094 Ga0495678_014094_973_1725 250
699 3300049459 Ga0495678_017367 Ga0495678_017367_1854_2615 250
700 3300049460 Ga0495682_0000189 Ga0495682_0000189_33792_34559 250
701 3300049460 Ga0495682_0000568 Ga0495682_0000568_17729_18481 250
702 3300049460 Ga0495682_0000615 Ga0495682_0000615_16341_17093 250
703 3300049460 Ga0495682_0003132 Ga0495682_0003132_800_1555 250
704 3300049460 Ga0495682_0010053 Ga0495682_0010053_1666_2433 250
705 3300049571 Ga0501034_0092029 Ga0501034_0092029_1592_2347 250
706 3300049665 Ga0501227_041104 Ga0501227_041104_214_966 250
707 3300049775 Ga0501279_005178 Ga0501279_005178_774_1526 250
708 3300049822 Ga0501035_0001175 Ga0501035_0001175_19429_20184 250
709 3300049823 Ga0501044_0459298 Ga0501044_0459298_298_1053 250
710 3300053145 Ga0500586_051961 Ga0500586_051961_598_1350 250
711 3300059493 Ga0587077_021362 Ga0587077_021362_248_1003 250
712 3300059503 Ga0587080_014497 Ga0587080_014497_204_959 250
713 3300059641 Ga0587068_013855 Ga0587068_013855_284_1039 250
714 3300061719 Ga0466962_0079510 Ga0466962_0079510_587_1354 250
715 iso_pu_bacteria 2643221645 2644249550 250
716 iso_pu_bacteria 2643221664 2644359662 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

5

262

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pvr-assembly1.cif.gz_A the phenylacetyl-coa monooxygenase paaac subcomplex with benzoyl-coa 0.8926 2 215
3pwq-assembly2.cif.gz_H the phenylacetyl-coa monooxygenase paaac subcomplex 0.8919 2 215
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.891 6 239
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.8799 6 239
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8555 1 250
ID Description Score Start End Superfamily
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8919 2 215 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8541 1 250 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8508 1 250 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8162 2 213 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7677 2 213 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7C7H5P9-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9906 4 73 GO:0005829
GO:0010124
AF-A0A520YU98-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9901 5 117 GO:0005829
GO:0010124
AF-A0A519PAS0-F1-model_v4 deleted 0.9889 2 104
AF-A0A0U3AH92-F1-model_v4 Phenylacetic acid catabolic protein 0.9876 4 67 GO:0005829
GO:0010124
AF-A0A348Y2Q4-F1-model_v4 deleted 0.9871 5 153

Feature Viewer

pLDDT pTM Quality
88.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map