F477058

General Info

Members Datasets Scaffolds Average Seq Length
716 293 1432 75

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11159758|Ga0307410_111597582
Length 93
Sequence MLTESNASGSVAAATLSAMPSTDELRQRIEAAIPGSTADVQDLTGGGDHFRATVVAPSFADMSRIEQHRQVYAVFGTDIGGPIHALSLETRAE

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
236 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
290 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.98
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_11159758 3300031852 Bacteria 672
2 JGI24739J22299_10124072 3300001989 Bacteria 770
3 JGI24737J22298_10068227 3300001990 Bacteria 1063
4 JGI24743J22301_10017486 3300001991 Bacteria 1347
5 JGI24750J21931_1045965 3300002070 Bacteria 672
6 JGI24745J21846_1028374 3300002073 Bacteria 671
7 JGI24745J21846_1028780 3300002073 Bacteria 667
8 JGI24738J21930_10037587 3300002075 Bacteria 984
9 JGI24738J21930_10041951 3300002075 Bacteria 930
10 JGI24749J21850_1028033 3300002076 Bacteria 804
11 JGI24744J21845_10029640 3300002077 Bacteria 1051
12 JGI24744J21845_10092046 3300002077 Bacteria 557
13 JGI24033J26618_1017819 3300002155 Bacteria 890
14 JGI24034J26672_10060738 3300002239 Bacteria 663
15 JGI25406J46586_10082233 3300003203 Bacteria 986
16 Ga0070658_10352087 3300005327 Bacteria 1260
17 Ga0070676_10141493 3300005328 Bacteria 1532
18 Ga0070676_10465577 3300005328 Bacteria 891
19 Ga0070683_100077833 3300005329 Bacteria 3102
20 Ga0070683_100106873 3300005329 Bacteria 2638
21 Ga0070683_100456346 3300005329 Bacteria 1219
22 Ga0070683_100593886 3300005329 Bacteria 1059
23 Ga0070690_100131001 3300005330 Bacteria 1694
24 Ga0070690_100277253 3300005330 Bacteria 1195
25 Ga0070670_100808067 3300005331 Bacteria 847
26 Ga0070670_101040083 3300005331 Bacteria 745
27 Ga0068869_100061392 3300005334 Bacteria 2757
28 Ga0068869_100100054 3300005334 Bacteria 2192
29 Ga0068869_100222217 3300005334 Bacteria 1497
30 Ga0068869_101988511 3300005334 Bacteria 521
31 Ga0070666_10169233 3300005335 Bacteria 1530
32 Ga0070666_10791242 3300005335 Bacteria 698
33 Ga0070666_11429485 3300005335 Bacteria 517
34 Ga0070680_100268016 3300005336 Bacteria 1446
35 Ga0070680_100723021 3300005336 Bacteria 857
36 Ga0070680_101059075 3300005336 Bacteria 701
37 Ga0070682_100038178 3300005337 Bacteria 2944
38 Ga0070682_100187896 3300005337 Bacteria 1448
39 Ga0070682_100744148 3300005337 Bacteria 791
40 Ga0070682_101306338 3300005337 Bacteria 616
41 Ga0068868_100010686 3300005338 Bacteria 6652
42 Ga0068868_100043556 3300005338 Bacteria 3506
43 Ga0068868_100929999 3300005338 Bacteria 792
44 Ga0068868_101730324 3300005338 Bacteria 590
45 Ga0070660_100165154 3300005339 Bacteria 1786
46 Ga0070660_100239756 3300005339 Bacteria 1477
47 Ga0070660_100726105 3300005339 Bacteria 834
48 Ga0070660_101213899 3300005339 Unclassified 639
49 Ga0070660_101532336 3300005339 Bacteria 567
50 Ga0070689_100090960 3300005340 Bacteria 2405
51 Ga0070689_100281898 3300005340 Bacteria 1379
52 Ga0070691_10031075 3300005341 Bacteria 2504
53 Ga0070691_10437095 3300005341 Bacteria 744
54 Ga0070687_100103212 3300005343 Bacteria 1600
55 Ga0070661_100280682 3300005344 Bacteria 1292
56 Ga0070661_100313568 3300005344 Bacteria 1223
57 Ga0070661_100347793 3300005344 Bacteria 1162
58 Ga0070692_10125512 3300005345 Bacteria 1437
59 Ga0070692_10319599 3300005345 Bacteria 954
60 Ga0070692_10342219 3300005345 Bacteria 927
61 Ga0070692_10386433 3300005345 Bacteria 880
62 Ga0070668_100360872 3300005347 Bacteria 1232
63 Ga0070668_100600668 3300005347 Bacteria 963
64 Ga0070668_100659969 3300005347 Bacteria 920
65 Ga0070668_101478556 3300005347 Bacteria 621
66 Ga0070669_100308773 3300005353 Bacteria 1274
67 Ga0070669_100426891 3300005353 Bacteria 1089
68 Ga0070669_100738107 3300005353 Bacteria 834
69 Ga0070675_100105671 3300005354 Bacteria 2376
70 Ga0070675_100817867 3300005354 Bacteria 852
71 Ga0070675_101548193 3300005354 Bacteria 612
72 Ga0070671_100083927 3300005355 Bacteria 2664
73 Ga0070671_100732332 3300005355 Bacteria 859
74 Ga0070674_100108418 3300005356 Bacteria 2035
75 Ga0070674_100116438 3300005356 Bacteria 1972
76 Ga0070674_100247881 3300005356 Bacteria 1397
77 Ga0070674_100300414 3300005356 Bacteria 1280
78 Ga0070674_100510642 3300005356 Bacteria 1002
79 Ga0070674_100816120 3300005356 Bacteria 807
80 Ga0070673_100022213 3300005364 Bacteria 4615
81 Ga0070673_100547505 3300005364 Bacteria 1051
82 Ga0070688_100105216 3300005365 Bacteria 1867
83 Ga0070688_101657717 3300005365 Bacteria 523
84 Ga0070659_100018869 3300005366 Bacteria 5210
85 Ga0070659_100031805 3300005366 Bacteria 4089
86 Ga0070659_100100963 3300005366 Bacteria 2322
87 Ga0070659_100246594 3300005366 Bacteria 1479
88 Ga0070659_101623222 3300005366 Bacteria 577
89 Ga0070667_100250695 3300005367 Bacteria 1582
90 Ga0070667_100491918 3300005367 Bacteria 1124
91 Ga0070703_10096966 3300005406 Bacteria 1033
92 Ga0070703_10563329 3300005406 Bacteria 521
93 Ga0070710_10416150 3300005437 Bacteria 904
94 Ga0070710_10634403 3300005437 Unclassified 747
95 Ga0070701_10142043 3300005438 Bacteria 1374
96 Ga0070701_10178104 3300005438 Bacteria 1242
97 Ga0070701_10291821 3300005438 Bacteria 1000
98 Ga0070701_10830310 3300005438 Bacteria 633
99 Ga0070711_100008684 3300005439 Bacteria 6232
100 Ga0070711_101435824 3300005439 Bacteria 601
101 Ga0070705_101109398 3300005440 Bacteria 648
102 Ga0070700_100000725 3300005441 Bacteria 16282
103 Ga0070700_100098252 3300005441 Bacteria 1924
104 Ga0070700_100163554 3300005441 Bacteria 1534
105 Ga0070700_101109889 3300005441 Bacteria 656
106 Ga0070700_102016204 3300005441 Bacteria 501
107 Ga0070694_100202565 3300005444 Bacteria 1480
108 Ga0070694_100292993 3300005444 Bacteria 1244
109 Ga0070663_100085433 3300005455 Bacteria 2328
110 Ga0070663_100276889 3300005455 Bacteria 1336
111 Ga0070663_100320219 3300005455 Bacteria 1247
112 Ga0070663_100421699 3300005455 Bacteria 1094
113 Ga0070678_100320842 3300005456 Bacteria 1323
114 Ga0070678_100390334 3300005456 Bacteria 1207
115 Ga0070678_101587350 3300005456 Bacteria 614
116 Ga0070662_100069299 3300005457 Bacteria 2595
117 Ga0070662_101319162 3300005457 Bacteria 621
118 Ga0070681_10438021 3300005458 Bacteria 1219
119 Ga0068867_100068029 3300005459 Bacteria 2657
120 Ga0068867_100705653 3300005459 Bacteria 891
121 Ga0070685_10006088 3300005466 Bacteria 6149
122 Ga0070685_10113573 3300005466 Bacteria 1672
123 Ga0070685_10339527 3300005466 Bacteria 1024
124 Ga0070679_100389881 3300005530 Bacteria 1339
125 Ga0070679_101080621 3300005530 Bacteria 747
126 Ga0070684_100003571 3300005535 Bacteria 11700
127 Ga0070684_100052085 3300005535 Bacteria 3558
128 Ga0070684_100962225 3300005535 Bacteria 801
129 Ga0070684_101299167 3300005535 Bacteria 685
130 Ga0070697_101850976 3300005536 Bacteria 540
131 Ga0068853_100159303 3300005539 Bacteria 2035
132 Ga0068853_100194903 3300005539 Bacteria 1842
133 Ga0070672_100156869 3300005543 Bacteria 1885
134 Ga0070672_100431708 3300005543 Bacteria 1133
135 Ga0070686_100046411 3300005544 Bacteria 2741
136 Ga0070686_100232084 3300005544 Bacteria 1339
137 Ga0070686_100770951 3300005544 Bacteria 773
138 Ga0070686_101632672 3300005544 Unclassified 546
139 Ga0070695_101530314 3300005545 Bacteria 556
140 Ga0070696_100236583 3300005546 Bacteria 1376
141 Ga0070696_100382047 3300005546 Bacteria 1098
142 Ga0070693_100026623 3300005547 Bacteria 3124
143 Ga0070693_100487726 3300005547 Bacteria 872
144 Ga0070693_101585450 3300005547 Unclassified 514
145 Ga0070665_100228911 3300005548 Bacteria 1859
146 Ga0070665_100308869 3300005548 Bacteria 1585
147 Ga0070665_100525417 3300005548 Bacteria 1195
148 Ga0070704_100040276 3300005549 Bacteria 3215
149 Ga0070704_100888220 3300005549 Bacteria 801
150 Ga0068855_100493939 3300005563 Bacteria 1331
151 Ga0068855_101345602 3300005563 Unclassified 738
152 Ga0070664_100100172 3300005564 Bacteria 2518
153 Ga0070664_100169731 3300005564 Bacteria 1935
154 Ga0070664_100213379 3300005564 Bacteria 1725
155 Ga0070664_100310504 3300005564 Bacteria 1427
156 Ga0070664_100497257 3300005564 Bacteria 1124
157 Ga0070664_101871570 3300005564 Unclassified 569
158 Ga0068857_100017114 3300005577 Bacteria 6350
159 Ga0068857_100094318 3300005577 Bacteria 2680
160 Ga0068857_101342463 3300005577 Bacteria 695
161 Ga0068854_100129556 3300005578 Bacteria 1925
162 Ga0068854_100648216 3300005578 Bacteria 906
163 Ga0068854_100934140 3300005578 Unclassified 764
164 Ga0068854_101281963 3300005578 Bacteria 659
165 Ga0068856_100015589 3300005614 Bacteria 7348
166 Ga0068856_100707390 3300005614 Bacteria 1028
167 Ga0068856_101453122 3300005614 Bacteria 700
168 Ga0070702_100077036 3300005615 Bacteria 1986
169 Ga0070702_100523017 3300005615 Bacteria 875
170 Ga0070702_100950480 3300005615 Bacteria 677
171 Ga0070702_101609473 3300005615 Bacteria 537
172 Ga0068852_100025125 3300005616 Bacteria 4823
173 Ga0068852_100527363 3300005616 Bacteria 1179
174 Ga0068852_101111486 3300005616 Bacteria 811
175 Ga0068859_100030757 3300005617 Bacteria 5388
176 Ga0068859_100155684 3300005617 Bacteria 2362
177 Ga0068864_100031292 3300005618 Bacteria 4514
178 Ga0068864_100059441 3300005618 Bacteria 3307
179 Ga0068864_100301381 3300005618 Bacteria 1500
180 Ga0068864_101058622 3300005618 Bacteria 806
181 Ga0068866_10132881 3300005718 Bacteria 1418
182 Ga0068866_10196748 3300005718 Bacteria 1202
183 Ga0068866_10566581 3300005718 Bacteria 762
184 Ga0068866_10756556 3300005718 Bacteria 671
185 Ga0068866_11184880 3300005718 Bacteria 551
186 Ga0068861_100047515 3300005719 Bacteria 3240
187 Ga0068861_100063380 3300005719 Bacteria 2841
188 Ga0068861_100183009 3300005719 Bacteria 1746
189 Ga0068861_100518462 3300005719 Bacteria 1081
190 Ga0068861_100843148 3300005719 Bacteria 863
191 Ga0068861_102061886 3300005719 Bacteria 570
192 Ga0068851_10147709 3300005834 Bacteria 1283
193 Ga0068870_10134365 3300005840 Bacteria 1440
194 Ga0068870_10180516 3300005840 Bacteria 1267
195 Ga0068870_10249219 3300005840 Bacteria 1100
196 Ga0068863_101504819 3300005841 Bacteria 682
197 Ga0068863_101680237 3300005841 Unclassified 644
198 Ga0068863_101824960 3300005841 Bacteria 618
199 Ga0068863_102012617 3300005841 Bacteria 588
200 Ga0068858_100337681 3300005842 Bacteria 1441
201 Ga0068860_100115361 3300005843 Bacteria 2569
202 Ga0068860_100238987 3300005843 Bacteria 1766
203 Ga0068862_100102309 3300005844 Bacteria 2508
204 Ga0068862_100280866 3300005844 Bacteria 1526
205 Ga0068862_100673703 3300005844 Bacteria 1000
206 Ga0081455_10343233 3300005937 Bacteria 1056
207 Ga0081455_10839590 3300005937 Bacteria 574
208 Ga0081539_10002554 3300005985 Bacteria 25258
209 Ga0081539_10083546 3300005985 Bacteria 1671
210 Ga0075432_10020707 3300006058 Bacteria 2249
211 Ga0075432_10064852 3300006058 Bacteria 1305
212 Ga0070715_10156208 3300006163 Bacteria 1123
213 Ga0070712_100029651 3300006175 Bacteria 3670
214 Ga0070712_100033233 3300006175 Bacteria 3489
215 Ga0097621_100673382 3300006237 Bacteria 951
216 Ga0068871_100379279 3300006358 Bacteria 1256
217 Ga0075428_100208255 3300006844 Bacteria 2113
218 Ga0075428_100326364 3300006844 Bacteria 1649
219 Ga0075428_100351634 3300006844 Bacteria 1582
220 Ga0075428_101299934 3300006844 Bacteria 765
221 Ga0075430_100576787 3300006846 Bacteria 928
222 Ga0075431_100083428 3300006847 Bacteria 3299
223 Ga0075431_100992539 3300006847 Bacteria 807
224 Ga0075433_11570898 3300006852 Bacteria 568
225 Ga0075434_100253034 3300006871 Bacteria 1780
226 Ga0075434_100451353 3300006871 Bacteria 1307
227 Ga0075434_100464036 3300006871 Bacteria 1287
228 Ga0075434_101275656 3300006871 Bacteria 746
229 Ga0068865_100096148 3300006881 Bacteria 2159
230 Ga0068865_100147523 3300006881 Bacteria 1781
231 Ga0068865_100178640 3300006881 Bacteria 1633
232 Ga0068865_100399365 3300006881 Bacteria 1126
233 Ga0068865_100887209 3300006881 Bacteria 775
234 Ga0068865_101737426 3300006881 Bacteria 563
235 Ga0075436_100327534 3300006914 Unclassified 1101
236 Ga0075436_100627530 3300006914 Bacteria 793
237 Ga0097620_100030757 3300006931 Bacteria 5388
238 Ga0097620_100155679 3300006931 Bacteria 2362
239 Ga0075435_100027268 3300007076 Bacteria 4466
240 Ga0075435_100493719 3300007076 Bacteria 1058
241 Ga0075435_100727381 3300007076 Bacteria 863
242 Ga0105251_10142608 3300009011 Bacteria 1084
243 Ga0105244_10275597 3300009036 Bacteria 781
244 Ga0105244_10541218 3300009036 Unclassified 536
245 Ga0105240_10163894 3300009093 Bacteria 2638
246 Ga0111539_10307802 3300009094 Bacteria 1844
247 Ga0111539_10504509 3300009094 Bacteria 1409
248 Ga0111539_10635990 3300009094 Bacteria 1242
249 Ga0111539_11885727 3300009094 Bacteria 693
250 Ga0111539_12113658 3300009094 Bacteria 653
251 Ga0105245_10009618 3300009098 Bacteria 8432
252 Ga0105245_11550054 3300009098 Bacteria 714
253 Ga0105245_11589243 3300009098 Bacteria 706
254 Ga0105245_13211620 3300009098 Bacteria 507
255 Ga0105247_10072458 3300009101 Bacteria 2156
256 Ga0114129_10205162 3300009147 Bacteria 2667
257 Ga0114129_12505460 3300009147 Bacteria 617
258 Ga0114129_12773041 3300009147 Bacteria 583
259 Ga0105243_10292331 3300009148 Bacteria 1473
260 Ga0105243_10391483 3300009148 Bacteria 1288
261 Ga0105243_10412051 3300009148 Bacteria 1258
262 Ga0105243_10702828 3300009148 Bacteria 986
263 Ga0105243_10728609 3300009148 Bacteria 970
264 Ga0105241_10444222 3300009174 Bacteria 1146
265 Ga0105242_10060063 3300009176 Bacteria 3121
266 Ga0105242_10633705 3300009176 Bacteria 1037
267 Ga0105242_10747820 3300009176 Bacteria 962
268 Ga0105242_11414268 3300009176 Bacteria 723
269 Ga0105242_11438758 3300009176 Bacteria 718
270 Ga0105242_12588243 3300009176 Bacteria 556
271 Ga0105248_10082551 3300009177 Bacteria 3614
272 Ga0105248_10642841 3300009177 Bacteria 1197
273 Ga0105248_11948423 3300009177 Bacteria 667
274 Ga0105248_12298232 3300009177 Bacteria 614
275 Ga0105237_10226190 3300009545 Bacteria 1871
276 Ga0105237_10330770 3300009545 Bacteria 1528
277 Ga0105238_10474039 3300009551 Bacteria 1250
278 Ga0105249_10147650 3300009553 Bacteria 2260
279 Ga0105249_10469690 3300009553 Bacteria 1299
280 Ga0105249_12552473 3300009553 Bacteria 583
281 Ga0105239_10102299 3300010375 Bacteria 3171
282 Ga0105239_10111887 3300010375 Bacteria 3027
283 Ga0105239_10783040 3300010375 Bacteria 1092
284 Ga0105246_10067651 3300011119 Bacteria 2503
285 Ga0105246_10081252 3300011119 Bacteria 2309
286 Ga0105246_11539238 3300011119 Bacteria 626
287 Ga0157336_1008234 3300012477 Bacteria 753
288 Ga0157373_10564249 3300013100 Bacteria 826
289 Ga0157369_10614422 3300013105 Bacteria 1122
290 Ga0157369_10788285 3300013105 Bacteria 977
291 Ga0157374_10007186 3300013296 Bacteria 9486
292 Ga0157374_10407641 3300013296 Bacteria 1357
293 Ga0157374_11804295 3300013296 Bacteria 637
294 Ga0157378_11344070 3300013297 Bacteria 756
295 Ga0157378_12773474 3300013297 Bacteria 542
296 Ga0163162_10083571 3300013306 Bacteria 3267
297 Ga0163162_10331812 3300013306 Bacteria 1653
298 Ga0163162_11126916 3300013306 Bacteria 889
299 Ga0157372_10134573 3300013307 Bacteria 2845
300 Ga0157372_11420318 3300013307 Bacteria 800
301 Ga0157372_12092047 3300013307 Bacteria 650
302 Ga0157372_12131363 3300013307 Bacteria 644
303 Ga0157372_12274759 3300013307 Bacteria 623
304 Ga0157375_10036831 3300013308 Bacteria 4684
305 Ga0157375_10165443 3300013308 Bacteria 2356
306 Ga0157375_11157728 3300013308 Bacteria 906
307 Ga0157375_11232281 3300013308 Bacteria 878
308 Ga0163163_10029164 3300014325 Bacteria 5307
309 Ga0163163_10039560 3300014325 Bacteria 4602
310 Ga0163163_11668011 3300014325 Bacteria 698
311 Ga0163163_13265906 3300014325 Bacteria 506
312 Ga0157380_10137982 3300014326 Bacteria 2090
313 Ga0157380_10161156 3300014326 Bacteria 1950
314 Ga0157380_10190666 3300014326 Bacteria 1809
315 Ga0157380_10440349 3300014326 Bacteria 1248
316 Ga0182008_10182944 3300014497 Bacteria 1061
317 Ga0182008_10200344 3300014497 Bacteria 1016
318 Ga0157377_10000578 3300014745 Bacteria 15317
319 Ga0157377_10066698 3300014745 Bacteria 2070
320 Ga0157377_10136980 3300014745 Bacteria 1501
321 Ga0157377_10491890 3300014745 Bacteria 855
322 Ga0157377_10586093 3300014745 Bacteria 793
323 Ga0157379_10237693 3300014968 Bacteria 1652
324 Ga0157379_10618957 3300014968 Bacteria 1012
325 Ga0157376_10215793 3300014969 Bacteria 1774
326 Ga0163161_10498321 3300017792 Bacteria 991
327 Ga0163161_10556445 3300017792 Bacteria 941
328 Ga0206356_10706088 3300020070 Bacteria 712
329 Ga0206356_11603949 3300020070 Bacteria 999
330 Ga0206353_11776154 3300020082 Bacteria 606
331 Ga0206353_11994587 3300020082 Bacteria 731
332 Ga0207697_10297990 3300025315 Bacteria 715
333 Ga0207656_10303560 3300025321 Bacteria 790
334 Ga0207653_10058415 3300025885 Bacteria 1296
335 Ga0207692_10197786 3300025898 Bacteria 1180
336 Ga0207692_10680037 3300025898 Unclassified 667
337 Ga0207642_10019023 3300025899 Bacteria 2650
338 Ga0207642_10476782 3300025899 Bacteria 760
339 Ga0207642_10526213 3300025899 Bacteria 727
340 Ga0207642_11047791 3300025899 Bacteria 526
341 Ga0207710_10150791 3300025900 Bacteria 1128
342 Ga0207688_10007975 3300025901 Bacteria 5760
343 Ga0207688_10017025 3300025901 Bacteria 3950
344 Ga0207688_10283242 3300025901 Bacteria 1010
345 Ga0207688_10386743 3300025901 Bacteria 866
346 Ga0207688_10684808 3300025901 Bacteria 648
347 Ga0207688_11071530 3300025901 Bacteria 509
348 Ga0207680_10478645 3300025903 Bacteria 885
349 Ga0207680_10541318 3300025903 Unclassified 831
350 Ga0207647_10107377 3300025904 Bacteria 1652
351 Ga0207685_10034741 3300025905 Bacteria 1834
352 Ga0207645_10058085 3300025907 Bacteria 2470
353 Ga0207645_10427792 3300025907 Bacteria 892
354 Ga0207645_11059589 3300025907 Unclassified 548
355 Ga0207643_10006369 3300025908 Bacteria 6323
356 Ga0207643_10235051 3300025908 Bacteria 1125
357 Ga0207643_10952542 3300025908 Bacteria 556
358 Ga0207705_10317741 3300025909 Bacteria 1196
359 Ga0207695_10020864 3300025913 Bacteria 7486
360 Ga0207695_10712211 3300025913 Bacteria 884
361 Ga0207671_10144381 3300025914 Bacteria 1835
362 Ga0207671_10252828 3300025914 Bacteria 1385
363 Ga0207693_10005634 3300025915 Bacteria 10413
364 Ga0207693_10300167 3300025915 Bacteria 1258
365 Ga0207663_10019930 3300025916 Bacteria 3789
366 Ga0207663_10084346 3300025916 Bacteria 2089
367 Ga0207660_10084813 3300025917 Bacteria 2335
368 Ga0207662_10503254 3300025918 Bacteria 834
369 Ga0207657_10124408 3300025919 Bacteria 2119
370 Ga0207657_10218934 3300025919 Bacteria 1526
371 Ga0207657_10782627 3300025919 Bacteria 738
372 Ga0207649_10073427 3300025920 Bacteria 2191
373 Ga0207649_10253274 3300025920 Bacteria 1269
374 Ga0207681_10204137 3300025923 Bacteria 1519
375 Ga0207681_10710688 3300025923 Bacteria 836
376 Ga0207694_11107222 3300025924 Bacteria 670
377 Ga0207650_11318542 3300025925 Bacteria 614
378 Ga0207650_11331314 3300025925 Bacteria 611
379 Ga0207659_10247783 3300025926 Bacteria 1444
380 Ga0207659_10457442 3300025926 Bacteria 1076
381 Ga0207687_10050505 3300025927 Bacteria 2895
382 Ga0207687_10076939 3300025927 Bacteria 2398
383 Ga0207687_10093689 3300025927 Bacteria 2197
384 Ga0207687_11217605 3300025927 Bacteria 647
385 Ga0207700_10230740 3300025928 Bacteria 1574
386 Ga0207664_11880645 3300025929 Bacteria 521
387 Ga0207644_10966667 3300025931 Bacteria 714
388 Ga0207644_11076291 3300025931 Bacteria 675
389 Ga0207690_10024539 3300025932 Bacteria 3777
390 Ga0207690_10194394 3300025932 Bacteria 1536
391 Ga0207690_10687625 3300025932 Bacteria 840
392 Ga0207690_11264351 3300025932 Bacteria 617
393 Ga0207690_11406683 3300025932 Bacteria 583
394 Ga0207706_10026790 3300025933 Bacteria 5159
395 Ga0207706_10139244 3300025933 Bacteria 2135
396 Ga0207706_10186869 3300025933 Bacteria 1819
397 Ga0207686_10299375 3300025934 Bacteria 1194
398 Ga0207686_10709347 3300025934 Bacteria 800
399 Ga0207686_11374664 3300025934 Bacteria 581
400 Ga0207709_10026039 3300025935 Bacteria 3355
401 Ga0207709_10144498 3300025935 Bacteria 1639
402 Ga0207709_11042130 3300025935 Bacteria 670
403 Ga0207709_11130641 3300025935 Bacteria 644
404 Ga0207709_11590485 3300025935 Bacteria 543
405 Ga0207670_10113821 3300025936 Bacteria 1954
406 Ga0207670_10202422 3300025936 Bacteria 1509
407 Ga0207670_11577994 3300025936 Unclassified 558
408 Ga0207669_10131199 3300025937 Bacteria 1722
409 Ga0207669_10141168 3300025937 Bacteria 1672
410 Ga0207669_10143114 3300025937 Bacteria 1663
411 Ga0207669_10517522 3300025937 Bacteria 957
412 Ga0207669_10583297 3300025937 Bacteria 906
413 Ga0207669_11840826 3300025937 Bacteria 517
414 Ga0207704_10095144 3300025938 Bacteria 1969
415 Ga0207704_10171911 3300025938 Bacteria 1555
416 Ga0207704_10258070 3300025938 Bacteria 1312
417 Ga0207704_10599004 3300025938 Bacteria 902
418 Ga0207691_10070998 3300025940 Bacteria 3144
419 Ga0207691_10102250 3300025940 Bacteria 2556
420 Ga0207711_10059686 3300025941 Bacteria 3285
421 Ga0207711_10393255 3300025941 Bacteria 1287
422 Ga0207689_10090441 3300025942 Bacteria 2515
423 Ga0207689_10128523 3300025942 Bacteria 2084
424 Ga0207689_10268882 3300025942 Bacteria 1411
425 Ga0207689_11264981 3300025942 Bacteria 620
426 Ga0207661_10039166 3300025944 Bacteria 3719
427 Ga0207661_10108611 3300025944 Bacteria 2343
428 Ga0207661_10720916 3300025944 Bacteria 918
429 Ga0207661_10749663 3300025944 Bacteria 899
430 Ga0207661_10907195 3300025944 Bacteria 811
431 Ga0207679_10162872 3300025945 Bacteria 1828
432 Ga0207679_10167064 3300025945 Bacteria 1807
433 Ga0207679_10359539 3300025945 Bacteria 1271
434 Ga0207667_11723435 3300025949 Bacteria 592
435 Ga0207651_10016886 3300025960 Bacteria 4294
436 Ga0207651_10519490 3300025960 Bacteria 1032
437 Ga0207651_10791527 3300025960 Bacteria 840
438 Ga0207712_10092026 3300025961 Bacteria 2235
439 Ga0207712_10580554 3300025961 Bacteria 967
440 Ga0207668_10408229 3300025972 Bacteria 1150
441 Ga0207668_10551717 3300025972 Bacteria 998
442 Ga0207668_10622380 3300025972 Bacteria 942
443 Ga0207668_10886377 3300025972 Bacteria 793
444 Ga0207640_10399040 3300025981 Bacteria 1119
445 Ga0207640_10974442 3300025981 Unclassified 744
446 Ga0207640_11270694 3300025981 Bacteria 656
447 Ga0207640_11558466 3300025981 Bacteria 595
448 Ga0207658_10347370 3300025986 Bacteria 1291
449 Ga0207677_10001873 3300026023 Bacteria 11116
450 Ga0207677_10007277 3300026023 Bacteria 6107
451 Ga0207677_10373004 3300026023 Bacteria 1202
452 Ga0207639_10124164 3300026041 Bacteria 2126
453 Ga0207639_10164470 3300026041 Bacteria 1873
454 Ga0207678_10069534 3300026067 Bacteria 3019
455 Ga0207678_10089685 3300026067 Bacteria 2628
456 Ga0207678_10107395 3300026067 Bacteria 2381
457 Ga0207678_10307973 3300026067 Bacteria 1362
458 Ga0207678_11691192 3300026067 Bacteria 556
459 Ga0207708_10000223 3300026075 Bacteria 45098
460 Ga0207708_10026985 3300026075 Bacteria 4348
461 Ga0207708_10314841 3300026075 Bacteria 1276
462 Ga0207702_10200761 3300026078 Bacteria 1848
463 Ga0207702_10364336 3300026078 Bacteria 1386
464 Ga0207702_11502806 3300026078 Bacteria 667
465 Ga0207702_12165281 3300026078 Bacteria 545
466 Ga0207641_10495662 3300026088 Bacteria 1186
467 Ga0207641_11698338 3300026088 Unclassified 633
468 Ga0207648_10088896 3300026089 Bacteria 2698
469 Ga0207648_10226852 3300026089 Bacteria 1661
470 Ga0207676_10052530 3300026095 Bacteria 3186
471 Ga0207676_10157285 3300026095 Bacteria 1965
472 Ga0207676_10159585 3300026095 Bacteria 1952
473 Ga0207676_10327525 3300026095 Bacteria 1408
474 Ga0207674_10028587 3300026116 Bacteria 5882
475 Ga0207674_10042372 3300026116 Bacteria 4702
476 Ga0207674_10670549 3300026116 Bacteria 1001
477 Ga0207675_100116129 3300026118 Bacteria 2529
478 Ga0207675_100307003 3300026118 Bacteria 1546
479 Ga0207675_100445190 3300026118 Bacteria 1283
480 Ga0207675_100737007 3300026118 Bacteria 996
481 Ga0207675_102305539 3300026118 Bacteria 552
482 Ga0207683_10012859 3300026121 Bacteria 7143
483 Ga0207683_10037149 3300026121 Bacteria 4241
484 Ga0207683_10091966 3300026121 Bacteria 2703
485 Ga0207683_10697422 3300026121 Bacteria 941
486 Ga0207698_10228448 3300026142 Bacteria 1687
487 Ga0207698_10908715 3300026142 Bacteria 888
488 Ga0207428_10238235 3300027907 Bacteria 1360
489 Ga0207428_10241562 3300027907 Bacteria 1349
490 Ga0207428_11052388 3300027907 Unclassified 570
491 Ga0268266_10540961 3300028379 Bacteria 1115
492 Ga0268266_10624106 3300028379 Bacteria 1036
493 Ga0268266_10671983 3300028379 Bacteria 997
494 Ga0268265_10710546 3300028380 Bacteria 972
495 Ga0268265_12408632 3300028380 Unclassified 533
496 Ga0268264_10092840 3300028381 Bacteria 2606
497 Ga0268264_10166099 3300028381 Bacteria 1992
498 Ga0265319_1001081 3300028563 Bacteria 16941
499 Ga0265318_10000919 3300028577 Bacteria 19143
500 Ga0265322_10039602 3300028654 Bacteria 1341
501 Ga0265338_10057286 3300028800 Bacteria 3448
502 Ga0265320_10101138 3300031240 Bacteria 1327
503 Ga0265320_10204852 3300031240 Bacteria 880
504 Ga0265325_10280154 3300031241 Bacteria 748
505 Ga0265316_10084983 3300031344 Bacteria 2422
506 Ga0265314_10059017 3300031711 Bacteria 2627
507 Ga0307405_11926244 3300031731 Bacteria 528
508 Ga0307405_12031375 3300031731 Bacteria 515
509 Ga0307413_10384809 3300031824 Bacteria 1094
510 Ga0307413_11211760 3300031824 Bacteria 657
511 Ga0307410_11268123 3300031852 Bacteria 644
512 Ga0307410_11844703 3300031852 Bacteria 538
513 Ga0307406_10154454 3300031901 Bacteria 1642
514 Ga0307406_10388871 3300031901 Bacteria 1102
515 Ga0307406_10488611 3300031901 Bacteria 996
516 Ga0307406_11284815 3300031901 Unclassified 638
517 Ga0307406_11971895 3300031901 Bacteria 521
518 Ga0307407_10599476 3300031903 Bacteria 820
519 Ga0307407_11242068 3300031903 Bacteria 583
520 Ga0307407_11699956 3300031903 Bacteria 502
521 Ga0307412_11463136 3300031911 Bacteria 620
522 Ga0307412_11495712 3300031911 Bacteria 614
523 Ga0307409_100778199 3300031995 Bacteria 963
524 Ga0307409_100911435 3300031995 Bacteria 893
525 Ga0307409_100952768 3300031995 Bacteria 874
526 Ga0307409_102196052 3300031995 Bacteria 581
527 Ga0307409_102340652 3300031995 Bacteria 563
528 Ga0307409_102381785 3300031995 Bacteria 558
529 Ga0307409_102690477 3300031995 Bacteria 526
530 Ga0307416_100106163 3300032002 Bacteria 2461
531 Ga0307416_100182425 3300032002 Bacteria 1969
532 Ga0307416_101036336 3300032002 Bacteria 924
533 Ga0307416_101189171 3300032002 Bacteria 868
534 Ga0307416_101763568 3300032002 Bacteria 723
535 Ga0307416_102297162 3300032002 Unclassified 640
536 Ga0307416_102552500 3300032002 Bacteria 609
537 Ga0307416_102736076 3300032002 Bacteria 590
538 Ga0307416_103459671 3300032002 Unclassified 528
539 Ga0307414_10629867 3300032004 Bacteria 965
540 Ga0307414_11170800 3300032004 Bacteria 711
541 Ga0307414_11975068 3300032004 Bacteria 545
542 Ga0307411_10898667 3300032005 Bacteria 787
543 Ga0307411_11026099 3300032005 Bacteria 740
544 Ga0307411_11029076 3300032005 Bacteria 739
545 Ga0307411_11444466 3300032005 Bacteria 631
546 Ga0307415_100402626 3300032126 Bacteria 1169
547 Ga0307415_101403539 3300032126 Bacteria 665
548 Ga0373938_0242228 3300034957 Bacteria 513
549 Ga0373949_0109805 3300035090 Bacteria 764
550 Ga0373951_0071481 3300035091 Bacteria 885
551 Ga0373932_0170076 3300035112 Bacteria 759
552 Ga0373941_0230715 3300035115 Bacteria 715
553 Ga0373961_0122487 3300035241 Bacteria 863
554 Ga0373962_0058439 3300035242 Bacteria 1128
555 Ga0373931_0225995 3300035691 Bacteria 1129
556 Ga0395899_0266747 3300037312 Bacteria 1169
557 Ga0395899_0827438 3300037312 Bacteria 570
558 Ga0395899_0876877 3300037312 Archaea 549
559 Ga0395900_0131127 3300037418 Bacteria 2569
560 Ga0395900_0153966 3300037418 Bacteria 2349
561 Ga0395900_0238575 3300037418 Bacteria 1825
562 Ga0395900_1216285 3300037418 Bacteria 669
563 Ga0395900_1310258 3300037418 Bacteria 638
564 Ga0395898_0082011 3300037466 Bacteria 3109
565 Ga0395898_0479142 3300037466 Bacteria 1184
566 Ga0395898_1118957 3300037466 Bacteria 720
567 Ga0395898_1414456 3300037466 Archaea 623
568 Ga0395905_0233006 3300037471 Bacteria 1722
569 Ga0395905_0528885 3300037471 Bacteria 1080
570 Ga0395901_0007408 3300038443 Bacteria 11071
571 Ga0395901_0057056 3300038443 Bacteria 4062
572 Ga0395901_0201106 3300038443 Bacteria 2088
573 Ga0395901_0201904 3300038443 Bacteria 2084
574 Ga0436362_0582956 3300039453 Bacteria 1109
575 Ga0451793_0153898 3300041452 Bacteria 794
576 Ga0451797_0288226 3300041453 Bacteria 646
577 Ga0451800_0401211 3300041459 Unclassified 649
578 Ga0451847_0114656 3300041503 Bacteria 521
579 Ga0451853_0409858 3300041512 Bacteria 796
580 Ga0451853_1022236 3300041512 Bacteria 556
581 Ga0439450_048756 3300042008 Bacteria 1001
582 Ga0439463_090489 3300042016 Bacteria 787
583 Ga0439463_172456 3300042016 Bacteria 561
584 Ga0450917_006756 3300042120 Bacteria 869
585 Ga0450888_012734 3300042126 Bacteria 1000
586 Ga0450902_011919 3300042137 Bacteria 1387
587 Ga0439459_0009596 3300042438 Bacteria 1675
588 Ga0439459_0219484 3300042438 Bacteria 526
589 Ga0439464_0089051 3300042439 Bacteria 929
590 Ga0450916_070949 3300042530 Bacteria 581
591 Ga0439440_0008123 3300042993 Bacteria 2149
592 Ga0466972_0566222 3300044658 Bacteria 536
593 Ga0466965_0092004 3300044683 Bacteria 1544
594 Ga0466965_0517557 3300044683 Bacteria 671
595 Ga0466965_0818912 3300044683 Unclassified 540
596 Ga0466961_0467297 3300044693 Bacteria 763
597 Ga0466963_0179475 3300044694 Bacteria 1478
598 Ga0466964_0190131 3300044706 Bacteria 979
599 Ga0466964_0198165 3300044706 Bacteria 962
600 Ga0466971_0223739 3300044719 Bacteria 892
601 Ga0466968_0039042 3300044735 Bacteria 1997
602 Ga0466970_0262051 3300044765 Bacteria 970
603 Ga0466957_0863148 3300044842 Bacteria 645
604 Ga0466957_1337025 3300044842 Bacteria 521
605 Ga0466960_0019837 3300044901 Bacteria 2968
606 Ga0466960_0071371 3300044901 Bacteria 1729
607 Ga0466960_0099349 3300044901 Bacteria 1496
608 Ga0466960_0111414 3300044901 Bacteria 1422
609 Ga0466960_0119542 3300044901 Bacteria 1379
610 Ga0466960_0203989 3300044901 Bacteria 1081
611 Ga0466960_0247255 3300044901 Bacteria 990
612 Ga0466960_0452585 3300044901 Bacteria 746
613 Ga0466960_0514732 3300044901 Unclassified 702
614 Ga0466960_0713345 3300044901 Bacteria 602
615 Ga0466960_1005138 3300044901 Bacteria 512
616 Ga0466960_1056772 3300044901 Bacteria 500
617 Ga0466959_0152088 3300045049 Bacteria 1631
618 Ga0466958_0335740 3300045836 Bacteria 972
619 Ga0466958_0822598 3300045836 Bacteria 606
620 Ga0466967_0051036 3300045976 Bacteria 3623
621 Ga0466967_0315742 3300045976 Bacteria 1506
622 Ga0466967_0458268 3300045976 Bacteria 1247
623 Ga0466967_0713723 3300045976 Bacteria 993
624 Ga0466967_0807421 3300045976 Bacteria 932
625 Ga0466967_1009353 3300045976 Bacteria 828
626 Ga0466967_1093705 3300045976 Bacteria 794
627 Ga0466967_1106420 3300045976 Bacteria 789
628 Ga0466967_1899435 3300045976 Bacteria 592
629 Ga0495641_0147896 3300046461 Bacteria 1050
630 Ga0495650_0000566 3300046471 Bacteria 51980
631 Ga0495596_0244269 3300046500 Bacteria 697
632 Ga0495631_0261610 3300046518 Bacteria 737
633 Ga0495644_0146900 3300046523 Bacteria 902
634 Ga0495609_0412528 3300046538 Bacteria 540
635 Ga0495597_0187653 3300046542 Bacteria 833
636 Ga0495676_0844508 3300047321 Bacteria 588
637 Ga0495686_0447993 3300047472 Bacteria 686
638 Ga0496100_0195928 3300048903 Bacteria 1469
639 Ga0496100_0350863 3300048903 Bacteria 1114
640 Ga0496100_1100539 3300048903 Bacteria 626
641 Ga0496101_0074799 3300048904 Bacteria 2492
642 Ga0496101_0313282 3300048904 Bacteria 1230
643 Ga0496101_1040639 3300048904 Bacteria 643
644 Ga0496101_1549055 3300048904 Unclassified 515
645 Ga0496102_0032868 3300048905 Bacteria 4662
646 Ga0496102_0037097 3300048905 Bacteria 4395
647 Ga0496102_1301928 3300048905 Bacteria 646
648 Ga0496103_0337789 3300048906 Bacteria 968
649 Ga0496104_0012111 3300048907 Bacteria 7743
650 Ga0496104_0015132 3300048907 Bacteria 6984
651 Ga0496104_0117932 3300048907 Bacteria 2547
652 Ga0496104_1415516 3300048907 Bacteria 598
653 Ga0496105_0005432 3300048908 Bacteria 9672
654 Ga0496105_0153586 3300048908 Bacteria 1891
655 Ga0496105_0590949 3300048908 Bacteria 862
656 Ga0496106_0358996 3300048909 Bacteria 1170
657 Ga0496107_0035393 3300048910 Bacteria 3580
658 Ga0496107_0483682 3300048910 Bacteria 918
659 Ga0496107_0594501 3300048910 Bacteria 818
660 Ga0496108_0004602 3300048911 Bacteria 11107
661 Ga0496108_0014671 3300048911 Bacteria 6396
662 Ga0496108_0730725 3300048911 Bacteria 857
663 Ga0496108_1167154 3300048911 Bacteria 652
664 Ga0496109_0040902 3300048912 Bacteria 4199
665 Ga0496109_0044251 3300048912 Bacteria 4038
666 Ga0496109_0368243 3300048912 Bacteria 1357
667 Ga0496109_1446504 3300048912 Bacteria 623
668 Ga0496110_0026369 3300048913 Bacteria 4972
669 Ga0496110_1224792 3300048913 Bacteria 659
670 Ga0496111_0077189 3300048914 Bacteria 2428
671 Ga0496111_0093415 3300048914 Bacteria 2205
672 Ga0496111_0469320 3300048914 Bacteria 928
673 Ga0496111_0564387 3300048914 Bacteria 835
674 Ga0496112_0014014 3300048915 Bacteria 7418
675 Ga0496112_0305405 3300048915 Bacteria 1536
676 Ga0496112_0368233 3300048915 Bacteria 1378
677 Ga0496112_1689225 3300048915 Bacteria 546
678 Ga0496113_0029259 3300048916 Bacteria 3975
679 Ga0496113_0049709 3300048916 Bacteria 3123
680 Ga0496113_0655954 3300048916 Bacteria 839
681 Ga0496114_0091721 3300048917 Bacteria 2580
682 Ga0496114_0765324 3300048917 Bacteria 843
683 Ga0496115_0335960 3300048918 Bacteria 1233
684 Ga0496115_0455850 3300048918 Bacteria 1032
685 Ga0496121_0170550 3300048924 Bacteria 1581
686 Ga0501034_0054286 3300049571 Bacteria 4034
687 Ga0501067_0297704 3300049583 Bacteria 898
688 Ga0501067_0507186 3300049583 Bacteria 675
689 Ga0501068_0411670 3300049584 Bacteria 872
690 Ga0501212_099130 3300049851 Bacteria 546
691 nmdc:mga05p37_300519_c1 3300050507 Bacteria 1907
692 nmdc:mga0qj67_655663_c1 3300050509 Bacteria 837
693 nmdc:mga06r32_73896_c1 3300050510 Bacteria 3304
694 nmdc:mga08y16_1273453_c1 3300050511 Bacteria 703
695 nmdc:mga08y16_1489191_c1 3300050511 Bacteria 638
696 nmdc:mga08y16_325295_c1 3300050511 Bacteria 1582
697 nmdc:mga08y16_338924_c1 3300050511 Bacteria 1546
698 nmdc:mga08y16_775624_c1 3300050511 Bacteria 953
699 nmdc:mga0n895_1481807_c1 3300050512 Bacteria 645
700 nmdc:mga0n895_349941_c1 3300050512 Bacteria 1496
701 nmdc:mga0n895_567487_c1 3300050512 Bacteria 1140
702 nmdc:mga0n895_95487_c1 3300050512 Bacteria 2978
703 nmdc:mga0rr50_273256_c1 3300050513 Bacteria 1409
704 nmdc:mga0rr50_420634_c1 3300050513 Bacteria 1130
705 nmdc:mga0rr50_70675_c1 3300050513 Bacteria 2660
706 nmdc:mga08x19_118323_c1 3300050514 Bacteria 1773
707 nmdc:mga08x19_138517_c1 3300050514 Unclassified 1642
708 nmdc:mga08x19_572986_c1 3300050514 Bacteria 799
709 nmdc:mga0a205_543013_c1 3300050515 Bacteria 1018
710 nmdc:mga0a205_660360_c1 3300050515 Bacteria 897
711 Ga0495612_0367657 3300053078 Bacteria 651
712 Ga0495655_0282930 3300053083 Bacteria 566
713 Ga0587066_012193 3300059490 Bacteria 1277
714 Ga0587119_033840 3300059658 Bacteria 709
715 Ga0466962_0064156 3300061719 Bacteria 1754
716 Ga0530510_1255065 3300061734 Bacteria 568
717 Ga0307410_11159758
718 JGI24739J22299_10124072
719 JGI24737J22298_10068227
720 JGI24743J22301_10017486
721 JGI24750J21931_1045965
722 JGI24745J21846_1028374
723 JGI24745J21846_1028780
724 JGI24738J21930_10037587
725 JGI24738J21930_10041951
726 JGI24749J21850_1028033
727 JGI24744J21845_10029640
728 JGI24744J21845_10092046
729 JGI24033J26618_1017819
730 JGI24034J26672_10060738
731 JGI25406J46586_10082233
732 Ga0070658_10352087
733 Ga0070676_10141493
734 Ga0070676_10465577
735 Ga0070683_100077833
736 Ga0070683_100106873
737 Ga0070683_100456346
738 Ga0070683_100593886
739 Ga0070690_100131001
740 Ga0070690_100277253
741 Ga0070670_100808067
742 Ga0070670_101040083
743 Ga0068869_100061392
744 Ga0068869_100100054
745 Ga0068869_100222217
746 Ga0068869_101988511
747 Ga0070666_10169233
748 Ga0070666_10791242
749 Ga0070666_11429485
750 Ga0070680_100268016
751 Ga0070680_100723021
752 Ga0070680_101059075
753 Ga0070682_100038178
754 Ga0070682_100187896
755 Ga0070682_100744148
756 Ga0070682_101306338
757 Ga0068868_100010686
758 Ga0068868_100043556
759 Ga0068868_100929999
760 Ga0068868_101730324
761 Ga0070660_100165154
762 Ga0070660_100239756
763 Ga0070660_100726105
764 Ga0070660_101213899
765 Ga0070660_101532336
766 Ga0070689_100090960
767 Ga0070689_100281898
768 Ga0070691_10031075
769 Ga0070691_10437095
770 Ga0070687_100103212
771 Ga0070661_100280682
772 Ga0070661_100313568
773 Ga0070661_100347793
774 Ga0070692_10125512
775 Ga0070692_10319599
776 Ga0070692_10342219
777 Ga0070692_10386433
778 Ga0070668_100360872
779 Ga0070668_100600668
780 Ga0070668_100659969
781 Ga0070668_101478556
782 Ga0070669_100308773
783 Ga0070669_100426891
784 Ga0070669_100738107
785 Ga0070675_100105671
786 Ga0070675_100817867
787 Ga0070675_101548193
788 Ga0070671_100083927
789 Ga0070671_100732332
790 Ga0070674_100108418
791 Ga0070674_100116438
792 Ga0070674_100247881
793 Ga0070674_100300414
794 Ga0070674_100510642
795 Ga0070674_100816120
796 Ga0070673_100022213
797 Ga0070673_100547505
798 Ga0070688_100105216
799 Ga0070688_101657717
800 Ga0070659_100018869
801 Ga0070659_100031805
802 Ga0070659_100100963
803 Ga0070659_100246594
804 Ga0070659_101623222
805 Ga0070667_100250695
806 Ga0070667_100491918
807 Ga0070703_10096966
808 Ga0070703_10563329
809 Ga0070710_10416150
810 Ga0070710_10634403
811 Ga0070701_10142043
812 Ga0070701_10178104
813 Ga0070701_10291821
814 Ga0070701_10830310
815 Ga0070711_100008684
816 Ga0070711_101435824
817 Ga0070705_101109398
818 Ga0070700_100000725
819 Ga0070700_100098252
820 Ga0070700_100163554
821 Ga0070700_101109889
822 Ga0070700_102016204
823 Ga0070694_100202565
824 Ga0070694_100292993
825 Ga0070663_100085433
826 Ga0070663_100276889
827 Ga0070663_100320219
828 Ga0070663_100421699
829 Ga0070678_100320842
830 Ga0070678_100390334
831 Ga0070678_101587350
832 Ga0070662_100069299
833 Ga0070662_101319162
834 Ga0070681_10438021
835 Ga0068867_100068029
836 Ga0068867_100705653
837 Ga0070685_10006088
838 Ga0070685_10113573
839 Ga0070685_10339527
840 Ga0070679_100389881
841 Ga0070679_101080621
842 Ga0070684_100003571
843 Ga0070684_100052085
844 Ga0070684_100962225
845 Ga0070684_101299167
846 Ga0070697_101850976
847 Ga0068853_100159303
848 Ga0068853_100194903
849 Ga0070672_100156869
850 Ga0070672_100431708
851 Ga0070686_100046411
852 Ga0070686_100232084
853 Ga0070686_100770951
854 Ga0070686_101632672
855 Ga0070695_101530314
856 Ga0070696_100236583
857 Ga0070696_100382047
858 Ga0070693_100026623
859 Ga0070693_100487726
860 Ga0070693_101585450
861 Ga0070665_100228911
862 Ga0070665_100308869
863 Ga0070665_100525417
864 Ga0070704_100040276
865 Ga0070704_100888220
866 Ga0068855_100493939
867 Ga0068855_101345602
868 Ga0070664_100100172
869 Ga0070664_100169731
870 Ga0070664_100213379
871 Ga0070664_100310504
872 Ga0070664_100497257
873 Ga0070664_101871570
874 Ga0068857_100017114
875 Ga0068857_100094318
876 Ga0068857_101342463
877 Ga0068854_100129556
878 Ga0068854_100648216
879 Ga0068854_100934140
880 Ga0068854_101281963
881 Ga0068856_100015589
882 Ga0068856_100707390
883 Ga0068856_101453122
884 Ga0070702_100077036
885 Ga0070702_100523017
886 Ga0070702_100950480
887 Ga0070702_101609473
888 Ga0068852_100025125
889 Ga0068852_100527363
890 Ga0068852_101111486
891 Ga0068859_100030757
892 Ga0068859_100155684
893 Ga0068864_100031292
894 Ga0068864_100059441
895 Ga0068864_100301381
896 Ga0068864_101058622
897 Ga0068866_10132881
898 Ga0068866_10196748
899 Ga0068866_10566581
900 Ga0068866_10756556
901 Ga0068866_11184880
902 Ga0068861_100047515
903 Ga0068861_100063380
904 Ga0068861_100183009
905 Ga0068861_100518462
906 Ga0068861_100843148
907 Ga0068861_102061886
908 Ga0068851_10147709
909 Ga0068870_10134365
910 Ga0068870_10180516
911 Ga0068870_10249219
912 Ga0068863_101504819
913 Ga0068863_101680237
914 Ga0068863_101824960
915 Ga0068863_102012617
916 Ga0068858_100337681
917 Ga0068860_100115361
918 Ga0068860_100238987
919 Ga0068862_100102309
920 Ga0068862_100280866
921 Ga0068862_100673703
922 Ga0081455_10343233
923 Ga0081455_10839590
924 Ga0081539_10002554
925 Ga0081539_10083546
926 Ga0075432_10020707
927 Ga0075432_10064852
928 Ga0070715_10156208
929 Ga0070712_100029651
930 Ga0070712_100033233
931 Ga0097621_100673382
932 Ga0068871_100379279
933 Ga0075428_100208255
934 Ga0075428_100326364
935 Ga0075428_100351634
936 Ga0075428_101299934
937 Ga0075430_100576787
938 Ga0075431_100083428
939 Ga0075431_100992539
940 Ga0075433_11570898
941 Ga0075434_100253034
942 Ga0075434_100451353
943 Ga0075434_100464036
944 Ga0075434_101275656
945 Ga0068865_100096148
946 Ga0068865_100147523
947 Ga0068865_100178640
948 Ga0068865_100399365
949 Ga0068865_100887209
950 Ga0068865_101737426
951 Ga0075436_100327534
952 Ga0075436_100627530
953 Ga0097620_100030757
954 Ga0097620_100155679
955 Ga0075435_100027268
956 Ga0075435_100493719
957 Ga0075435_100727381
958 Ga0105251_10142608
959 Ga0105244_10275597
960 Ga0105244_10541218
961 Ga0105240_10163894
962 Ga0111539_10307802
963 Ga0111539_10504509
964 Ga0111539_10635990
965 Ga0111539_11885727
966 Ga0111539_12113658
967 Ga0105245_10009618
968 Ga0105245_11550054
969 Ga0105245_11589243
970 Ga0105245_13211620
971 Ga0105247_10072458
972 Ga0114129_10205162
973 Ga0114129_12505460
974 Ga0114129_12773041
975 Ga0105243_10292331
976 Ga0105243_10391483
977 Ga0105243_10412051
978 Ga0105243_10702828
979 Ga0105243_10728609
980 Ga0105241_10444222
981 Ga0105242_10060063
982 Ga0105242_10633705
983 Ga0105242_10747820
984 Ga0105242_11414268
985 Ga0105242_11438758
986 Ga0105242_12588243
987 Ga0105248_10082551
988 Ga0105248_10642841
989 Ga0105248_11948423
990 Ga0105248_12298232
991 Ga0105237_10226190
992 Ga0105237_10330770
993 Ga0105238_10474039
994 Ga0105249_10147650
995 Ga0105249_10469690
996 Ga0105249_12552473
997 Ga0105239_10102299
998 Ga0105239_10111887
999 Ga0105239_10783040
1000 Ga0105246_10067651
1001 Ga0105246_10081252
1002 Ga0105246_11539238
1003 Ga0157336_1008234
1004 Ga0157373_10564249
1005 Ga0157369_10614422
1006 Ga0157369_10788285
1007 Ga0157374_10007186
1008 Ga0157374_10407641
1009 Ga0157374_11804295
1010 Ga0157378_11344070
1011 Ga0157378_12773474
1012 Ga0163162_10083571
1013 Ga0163162_10331812
1014 Ga0163162_11126916
1015 Ga0157372_10134573
1016 Ga0157372_11420318
1017 Ga0157372_12092047
1018 Ga0157372_12131363
1019 Ga0157372_12274759
1020 Ga0157375_10036831
1021 Ga0157375_10165443
1022 Ga0157375_11157728
1023 Ga0157375_11232281
1024 Ga0163163_10029164
1025 Ga0163163_10039560
1026 Ga0163163_11668011
1027 Ga0163163_13265906
1028 Ga0157380_10137982
1029 Ga0157380_10161156
1030 Ga0157380_10190666
1031 Ga0157380_10440349
1032 Ga0182008_10182944
1033 Ga0182008_10200344
1034 Ga0157377_10000578
1035 Ga0157377_10066698
1036 Ga0157377_10136980
1037 Ga0157377_10491890
1038 Ga0157377_10586093
1039 Ga0157379_10237693
1040 Ga0157379_10618957
1041 Ga0157376_10215793
1042 Ga0163161_10498321
1043 Ga0163161_10556445
1044 Ga0206356_10706088
1045 Ga0206356_11603949
1046 Ga0206353_11776154
1047 Ga0206353_11994587
1048 Ga0207697_10297990
1049 Ga0207656_10303560
1050 Ga0207653_10058415
1051 Ga0207692_10197786
1052 Ga0207692_10680037
1053 Ga0207642_10019023
1054 Ga0207642_10476782
1055 Ga0207642_10526213
1056 Ga0207642_11047791
1057 Ga0207710_10150791
1058 Ga0207688_10007975
1059 Ga0207688_10017025
1060 Ga0207688_10283242
1061 Ga0207688_10386743
1062 Ga0207688_10684808
1063 Ga0207688_11071530
1064 Ga0207680_10478645
1065 Ga0207680_10541318
1066 Ga0207647_10107377
1067 Ga0207685_10034741
1068 Ga0207645_10058085
1069 Ga0207645_10427792
1070 Ga0207645_11059589
1071 Ga0207643_10006369
1072 Ga0207643_10235051
1073 Ga0207643_10952542
1074 Ga0207705_10317741
1075 Ga0207695_10020864
1076 Ga0207695_10712211
1077 Ga0207671_10144381
1078 Ga0207671_10252828
1079 Ga0207693_10005634
1080 Ga0207693_10300167
1081 Ga0207663_10019930
1082 Ga0207663_10084346
1083 Ga0207660_10084813
1084 Ga0207662_10503254
1085 Ga0207657_10124408
1086 Ga0207657_10218934
1087 Ga0207657_10782627
1088 Ga0207649_10073427
1089 Ga0207649_10253274
1090 Ga0207681_10204137
1091 Ga0207681_10710688
1092 Ga0207694_11107222
1093 Ga0207650_11318542
1094 Ga0207650_11331314
1095 Ga0207659_10247783
1096 Ga0207659_10457442
1097 Ga0207687_10050505
1098 Ga0207687_10076939
1099 Ga0207687_10093689
1100 Ga0207687_11217605
1101 Ga0207700_10230740
1102 Ga0207664_11880645
1103 Ga0207644_10966667
1104 Ga0207644_11076291
1105 Ga0207690_10024539
1106 Ga0207690_10194394
1107 Ga0207690_10687625
1108 Ga0207690_11264351
1109 Ga0207690_11406683
1110 Ga0207706_10026790
1111 Ga0207706_10139244
1112 Ga0207706_10186869
1113 Ga0207686_10299375
1114 Ga0207686_10709347
1115 Ga0207686_11374664
1116 Ga0207709_10026039
1117 Ga0207709_10144498
1118 Ga0207709_11042130
1119 Ga0207709_11130641
1120 Ga0207709_11590485
1121 Ga0207670_10113821
1122 Ga0207670_10202422
1123 Ga0207670_11577994
1124 Ga0207669_10131199
1125 Ga0207669_10141168
1126 Ga0207669_10143114
1127 Ga0207669_10517522
1128 Ga0207669_10583297
1129 Ga0207669_11840826
1130 Ga0207704_10095144
1131 Ga0207704_10171911
1132 Ga0207704_10258070
1133 Ga0207704_10599004
1134 Ga0207691_10070998
1135 Ga0207691_10102250
1136 Ga0207711_10059686
1137 Ga0207711_10393255
1138 Ga0207689_10090441
1139 Ga0207689_10128523
1140 Ga0207689_10268882
1141 Ga0207689_11264981
1142 Ga0207661_10039166
1143 Ga0207661_10108611
1144 Ga0207661_10720916
1145 Ga0207661_10749663
1146 Ga0207661_10907195
1147 Ga0207679_10162872
1148 Ga0207679_10167064
1149 Ga0207679_10359539
1150 Ga0207667_11723435
1151 Ga0207651_10016886
1152 Ga0207651_10519490
1153 Ga0207651_10791527
1154 Ga0207712_10092026
1155 Ga0207712_10580554
1156 Ga0207668_10408229
1157 Ga0207668_10551717
1158 Ga0207668_10622380
1159 Ga0207668_10886377
1160 Ga0207640_10399040
1161 Ga0207640_10974442
1162 Ga0207640_11270694
1163 Ga0207640_11558466
1164 Ga0207658_10347370
1165 Ga0207677_10001873
1166 Ga0207677_10007277
1167 Ga0207677_10373004
1168 Ga0207639_10124164
1169 Ga0207639_10164470
1170 Ga0207678_10069534
1171 Ga0207678_10089685
1172 Ga0207678_10107395
1173 Ga0207678_10307973
1174 Ga0207678_11691192
1175 Ga0207708_10000223
1176 Ga0207708_10026985
1177 Ga0207708_10314841
1178 Ga0207702_10200761
1179 Ga0207702_10364336
1180 Ga0207702_11502806
1181 Ga0207702_12165281
1182 Ga0207641_10495662
1183 Ga0207641_11698338
1184 Ga0207648_10088896
1185 Ga0207648_10226852
1186 Ga0207676_10052530
1187 Ga0207676_10157285
1188 Ga0207676_10159585
1189 Ga0207676_10327525
1190 Ga0207674_10028587
1191 Ga0207674_10042372
1192 Ga0207674_10670549
1193 Ga0207675_100116129
1194 Ga0207675_100307003
1195 Ga0207675_100445190
1196 Ga0207675_100737007
1197 Ga0207675_102305539
1198 Ga0207683_10012859
1199 Ga0207683_10037149
1200 Ga0207683_10091966
1201 Ga0207683_10697422
1202 Ga0207698_10228448
1203 Ga0207698_10908715
1204 Ga0207428_10238235
1205 Ga0207428_10241562
1206 Ga0207428_11052388
1207 Ga0268266_10540961
1208 Ga0268266_10624106
1209 Ga0268266_10671983
1210 Ga0268265_10710546
1211 Ga0268265_12408632
1212 Ga0268264_10092840
1213 Ga0268264_10166099
1214 Ga0265319_1001081
1215 Ga0265318_10000919
1216 Ga0265322_10039602
1217 Ga0265338_10057286
1218 Ga0265320_10101138
1219 Ga0265320_10204852
1220 Ga0265325_10280154
1221 Ga0265316_10084983
1222 Ga0265314_10059017
1223 Ga0307405_11926244
1224 Ga0307405_12031375
1225 Ga0307413_10384809
1226 Ga0307413_11211760
1227 Ga0307410_11268123
1228 Ga0307410_11844703
1229 Ga0307406_10154454
1230 Ga0307406_10388871
1231 Ga0307406_10488611
1232 Ga0307406_11284815
1233 Ga0307406_11971895
1234 Ga0307407_10599476
1235 Ga0307407_11242068
1236 Ga0307407_11699956
1237 Ga0307412_11463136
1238 Ga0307412_11495712
1239 Ga0307409_100778199
1240 Ga0307409_100911435
1241 Ga0307409_100952768
1242 Ga0307409_102196052
1243 Ga0307409_102340652
1244 Ga0307409_102381785
1245 Ga0307409_102690477
1246 Ga0307416_100106163
1247 Ga0307416_100182425
1248 Ga0307416_101036336
1249 Ga0307416_101189171
1250 Ga0307416_101763568
1251 Ga0307416_102297162
1252 Ga0307416_102552500
1253 Ga0307416_102736076
1254 Ga0307416_103459671
1255 Ga0307414_10629867
1256 Ga0307414_11170800
1257 Ga0307414_11975068
1258 Ga0307411_10898667
1259 Ga0307411_11026099
1260 Ga0307411_11029076
1261 Ga0307411_11444466
1262 Ga0307415_100402626
1263 Ga0307415_101403539
1264 Ga0373938_0242228
1265 Ga0373949_0109805
1266 Ga0373951_0071481
1267 Ga0373932_0170076
1268 Ga0373941_0230715
1269 Ga0373961_0122487
1270 Ga0373962_0058439
1271 Ga0373931_0225995
1272 Ga0395899_0266747
1273 Ga0395899_0827438
1274 Ga0395899_0876877
1275 Ga0395900_0131127
1276 Ga0395900_0153966
1277 Ga0395900_0238575
1278 Ga0395900_1216285
1279 Ga0395900_1310258
1280 Ga0395898_0082011
1281 Ga0395898_0479142
1282 Ga0395898_1118957
1283 Ga0395898_1414456
1284 Ga0395905_0233006
1285 Ga0395905_0528885
1286 Ga0395901_0007408
1287 Ga0395901_0057056
1288 Ga0395901_0201106
1289 Ga0395901_0201904
1290 Ga0436362_0582956
1291 Ga0451793_0153898
1292 Ga0451797_0288226
1293 Ga0451800_0401211
1294 Ga0451847_0114656
1295 Ga0451853_0409858
1296 Ga0451853_1022236
1297 Ga0439450_048756
1298 Ga0439463_090489
1299 Ga0439463_172456
1300 Ga0450917_006756
1301 Ga0450888_012734
1302 Ga0450902_011919
1303 Ga0439459_0009596
1304 Ga0439459_0219484
1305 Ga0439464_0089051
1306 Ga0450916_070949
1307 Ga0439440_0008123
1308 Ga0466972_0566222
1309 Ga0466965_0092004
1310 Ga0466965_0517557
1311 Ga0466965_0818912
1312 Ga0466961_0467297
1313 Ga0466963_0179475
1314 Ga0466964_0190131
1315 Ga0466964_0198165
1316 Ga0466971_0223739
1317 Ga0466968_0039042
1318 Ga0466970_0262051
1319 Ga0466957_0863148
1320 Ga0466957_1337025
1321 Ga0466960_0019837
1322 Ga0466960_0071371
1323 Ga0466960_0099349
1324 Ga0466960_0111414
1325 Ga0466960_0119542
1326 Ga0466960_0203989
1327 Ga0466960_0247255
1328 Ga0466960_0452585
1329 Ga0466960_0514732
1330 Ga0466960_0713345
1331 Ga0466960_1005138
1332 Ga0466960_1056772
1333 Ga0466959_0152088
1334 Ga0466958_0335740
1335 Ga0466958_0822598
1336 Ga0466967_0051036
1337 Ga0466967_0315742
1338 Ga0466967_0458268
1339 Ga0466967_0713723
1340 Ga0466967_0807421
1341 Ga0466967_1009353
1342 Ga0466967_1093705
1343 Ga0466967_1106420
1344 Ga0466967_1899435
1345 Ga0495641_0147896
1346 Ga0495650_0000566
1347 Ga0495596_0244269
1348 Ga0495631_0261610
1349 Ga0495644_0146900
1350 Ga0495609_0412528
1351 Ga0495597_0187653
1352 Ga0495676_0844508
1353 Ga0495686_0447993
1354 Ga0496100_0195928
1355 Ga0496100_0350863
1356 Ga0496100_1100539
1357 Ga0496101_0074799
1358 Ga0496101_0313282
1359 Ga0496101_1040639
1360 Ga0496101_1549055
1361 Ga0496102_0032868
1362 Ga0496102_0037097
1363 Ga0496102_1301928
1364 Ga0496103_0337789
1365 Ga0496104_0012111
1366 Ga0496104_0015132
1367 Ga0496104_0117932
1368 Ga0496104_1415516
1369 Ga0496105_0005432
1370 Ga0496105_0153586
1371 Ga0496105_0590949
1372 Ga0496106_0358996
1373 Ga0496107_0035393
1374 Ga0496107_0483682
1375 Ga0496107_0594501
1376 Ga0496108_0004602
1377 Ga0496108_0014671
1378 Ga0496108_0730725
1379 Ga0496108_1167154
1380 Ga0496109_0040902
1381 Ga0496109_0044251
1382 Ga0496109_0368243
1383 Ga0496109_1446504
1384 Ga0496110_0026369
1385 Ga0496110_1224792
1386 Ga0496111_0077189
1387 Ga0496111_0093415
1388 Ga0496111_0469320
1389 Ga0496111_0564387
1390 Ga0496112_0014014
1391 Ga0496112_0305405
1392 Ga0496112_0368233
1393 Ga0496112_1689225
1394 Ga0496113_0029259
1395 Ga0496113_0049709
1396 Ga0496113_0655954
1397 Ga0496114_0091721
1398 Ga0496114_0765324
1399 Ga0496115_0335960
1400 Ga0496115_0455850
1401 Ga0496121_0170550
1402 Ga0501034_0054286
1403 Ga0501067_0297704
1404 Ga0501067_0507186
1405 Ga0501068_0411670
1406 Ga0501212_099130
1407 nmdc:mga05p37_300519_c1
1408 nmdc:mga0qj67_655663_c1
1409 nmdc:mga06r32_73896_c1
1410 nmdc:mga08y16_1273453_c1
1411 nmdc:mga08y16_1489191_c1
1412 nmdc:mga08y16_325295_c1
1413 nmdc:mga08y16_338924_c1
1414 nmdc:mga08y16_775624_c1
1415 nmdc:mga0n895_1481807_c1
1416 nmdc:mga0n895_349941_c1
1417 nmdc:mga0n895_567487_c1
1418 nmdc:mga0n895_95487_c1
1419 nmdc:mga0rr50_273256_c1
1420 nmdc:mga0rr50_420634_c1
1421 nmdc:mga0rr50_70675_c1
1422 nmdc:mga08x19_118323_c1
1423 nmdc:mga08x19_138517_c1
1424 nmdc:mga08x19_572986_c1
1425 nmdc:mga0a205_543013_c1
1426 nmdc:mga0a205_660360_c1
1427 Ga0495612_0367657
1428 Ga0495655_0282930
1429 Ga0587066_012193
1430 Ga0587119_033840
1431 Ga0466962_0064156
1432 Ga0530510_1255065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

25

93

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8804 3 75
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8623 1 75
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8604 3 75
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8592 4 75
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.8587 7 75
ID Description Score Start End Superfamily
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9136 1 74 3.10.20.90
af_Q9NEY7_29_106_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9114 4 75 3.30.300.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9098 4 75 3.30.300.90
af_Q4CW19_9_87_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8948 2 75 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8908 1 74 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A7W0THP9-F1-model_v4 BolA family transcriptional regulator 1 1 75
AF-A0A7W0THP9-F1-model_v4 BolA family transcriptional regulator 0.987 1 75
AF-A0A2M8BAG2-F1-model_v4 BolA family transcriptional regulator 0.9639 2 75
AF-A0A2W4YH00-F1-model_v4 BolA family transcriptional regulator 0.9617 1 74
AF-A0A538C319-F1-model_v4 BolA family transcriptional regulator 0.961 1 75

Map