F476960

General Info

Members Datasets Scaffolds Average Seq Length
714 291 1428 251

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0025591|Ga0495580_0025591_1269_2117
Length 282
Sequence MMKGRLLNKLRSSFVQEKSMRLRSLWVCALGVGLAVSVVACGGGSKESSAPAESAASATGQKVDPATAGDINGVVSFDGVAPKNEAIKMNADPVCVKANPTPQTQETYEVDNGKLANVFVYVKDGLGNYVYDAPAGSVTIDQMGCRYHPHVFGIRVGQTLEIKNSDPTLHNIHALPMGNKEFNTGQPIQGMVTKHTFDNKEVMVPFKCDVHGWMNAYVGVLDHPFFAVTDKDGKFSLKGLPPGTYTIEAWHEKGGRQTAMVTLGAKDTKEANFTFKAAAASD

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
269 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 21.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0025591 3300046472 Bacteria 4313
2 JGI24751J29686_10004718 3300002459 Bacteria 2767
3 JGI25406J46586_10003702 3300003203 Bacteria 7163
4 Ga0058863_11793103 3300004799 Bacteria 873
5 Ga0058863_11819918 3300004799 Bacteria 1092
6 Ga0058863_11903460 3300004799 Bacteria 1092
7 Ga0058863_11955445 3300004799 Unclassified 1580
8 Ga0058861_11918555 3300004800 Bacteria 965
9 Ga0058862_10128726 3300004803 Unclassified 1036
10 Ga0058862_12595308 3300004803 Bacteria 899
11 Ga0058862_12801063 3300004803 Bacteria 989
12 Ga0065715_10156445 3300005293 Unclassified 1672
13 Ga0070658_10090436 3300005327 Unclassified 2522
14 Ga0070676_10024056 3300005328 Bacteria 3428
15 Ga0070676_10092393 3300005328 Bacteria 1856
16 Ga0070676_10127272 3300005328 Bacteria 1606
17 Ga0070676_10277229 3300005328 Unclassified 1128
18 Ga0070683_100023652 3300005329 Bacteria 5498
19 Ga0070690_100038643 3300005330 Bacteria 3013
20 Ga0070690_100081385 3300005330 Bacteria 2119
21 Ga0070690_100375565 3300005330 Bacteria 1038
22 Ga0070670_100004279 3300005331 Bacteria 11948
23 Ga0070670_100066204 3300005331 Bacteria 3100
24 Ga0070670_100351214 3300005331 Unclassified 1295
25 Ga0070677_10015682 3300005333 Bacteria 2686
26 Ga0068869_100124837 3300005334 Bacteria 1973
27 Ga0068869_100302563 3300005334 Bacteria 1292
28 Ga0070666_10060437 3300005335 Unclassified 2564
29 Ga0070666_10069262 3300005335 Bacteria 2398
30 Ga0070666_10091864 3300005335 Bacteria 2086
31 Ga0070680_100325206 3300005336 Bacteria 1306
32 Ga0068868_100004255 3300005338 Bacteria 10017
33 Ga0068868_100012014 3300005338 Bacteria 6320
34 Ga0068868_100033676 3300005338 Bacteria 3950
35 Ga0068868_100142502 3300005338 Bacteria 1969
36 Ga0068868_100152845 3300005338 Bacteria 1902
37 Ga0068868_100170243 3300005338 Bacteria 1803
38 Ga0070660_100132983 3300005339 Unclassified 1992
39 Ga0070689_100069852 3300005340 Bacteria 2741
40 Ga0070687_100010448 3300005343 Bacteria 4016
41 Ga0070687_100031684 3300005343 Bacteria 2596
42 Ga0070687_100039704 3300005343 Bacteria 2367
43 Ga0070687_100224465 3300005343 Bacteria 1152
44 Ga0070687_100243360 3300005343 Bacteria 1114
45 Ga0070661_100182745 3300005344 Bacteria 1596
46 Ga0070669_100012423 3300005353 Bacteria 6042
47 Ga0070669_100016932 3300005353 Bacteria 5204
48 Ga0070669_100024992 3300005353 Bacteria 4287
49 Ga0070669_100317741 3300005353 Bacteria 1257
50 Ga0070675_100006173 3300005354 Bacteria 9188
51 Ga0070675_100021696 3300005354 Bacteria 5131
52 Ga0070675_100024561 3300005354 Bacteria 4827
53 Ga0070675_100067606 3300005354 Unclassified 2957
54 Ga0070675_100465160 3300005354 Unclassified 1136
55 Ga0070671_100032906 3300005355 Bacteria 4285
56 Ga0070671_100042838 3300005355 Bacteria 3764
57 Ga0070671_100431751 3300005355 Unclassified 1129
58 Ga0070674_100003575 3300005356 Bacteria 8740
59 Ga0070674_100554905 3300005356 Bacteria 964
60 Ga0070673_100022519 3300005364 Bacteria 4587
61 Ga0070673_100083799 3300005364 Bacteria 2591
62 Ga0070673_100207878 3300005364 Bacteria 1689
63 Ga0070688_100168426 3300005365 Bacteria 1510
64 Ga0070659_100098339 3300005366 Bacteria 2353
65 Ga0070667_100000788 3300005367 Bacteria 29712
66 Ga0070667_100095073 3300005367 Unclassified 2568
67 Ga0070667_100313640 3300005367 Bacteria 1414
68 Ga0070709_10596701 3300005434 Bacteria 850
69 Ga0070714_100013693 3300005435 Bacteria 6504
70 Ga0070713_100041429 3300005436 Unclassified 3751
71 Ga0070701_10049421 3300005438 Bacteria 2175
72 Ga0070711_100048088 3300005439 Bacteria 2915
73 Ga0070711_100086415 3300005439 Bacteria 2249
74 Ga0070705_100170889 3300005440 Bacteria 1463
75 Ga0070705_100484065 3300005440 Bacteria 936
76 Ga0070700_100021472 3300005441 Bacteria 3753
77 Ga0070708_100139103 3300005445 Bacteria 2251
78 Ga0070708_100153696 3300005445 Bacteria 2141
79 Ga0070708_100234367 3300005445 Unclassified 1723
80 Ga0070678_100025520 3300005456 Bacteria 3978
81 Ga0070678_100043368 3300005456 Bacteria 3204
82 Ga0070678_100127754 3300005456 Bacteria 2015
83 Ga0070678_100204850 3300005456 Bacteria 1631
84 Ga0070662_100524909 3300005457 Bacteria 990
85 Ga0070681_10155045 3300005458 Bacteria 2216
86 Ga0070681_10180089 3300005458 Bacteria 2035
87 Ga0068867_100038270 3300005459 Bacteria 3491
88 Ga0068867_100235992 3300005459 Unclassified 1481
89 Ga0070685_10135022 3300005466 Bacteria 1547
90 Ga0070685_10412363 3300005466 Unclassified 938
91 Ga0070706_100353838 3300005467 Bacteria 1369
92 Ga0070706_100729248 3300005467 Unclassified 919
93 Ga0070707_100069464 3300005468 Bacteria 3392
94 Ga0070707_100507477 3300005468 Bacteria 1168
95 Ga0070698_100034751 3300005471 Bacteria 5216
96 Ga0070698_100089817 3300005471 Bacteria 3056
97 Ga0070698_100386334 3300005471 Bacteria 1333
98 Ga0070699_100630122 3300005518 Bacteria 978
99 Ga0070679_100140701 3300005530 Bacteria 2393
100 Ga0070684_100081709 3300005535 Bacteria 2860
101 Ga0070684_100120972 3300005535 Bacteria 2355
102 Ga0070697_100020164 3300005536 Bacteria 5270
103 Ga0070697_100169594 3300005536 Bacteria 1846
104 Ga0070697_100239620 3300005536 Unclassified 1549
105 Ga0070697_100328654 3300005536 Bacteria 1318
106 Ga0070672_100003753 3300005543 Bacteria 9888
107 Ga0070672_100282623 3300005543 Unclassified 1403
108 Ga0070686_100032978 3300005544 Bacteria 3179
109 Ga0070686_100134141 3300005544 Bacteria 1716
110 Ga0070695_100014055 3300005545 Bacteria 4820
111 Ga0070695_100016035 3300005545 Bacteria 4530
112 Ga0070695_100078380 3300005545 Bacteria 2178
113 Ga0070695_100087666 3300005545 Unclassified 2071
114 Ga0070696_100049906 3300005546 Bacteria 2908
115 Ga0070696_100059747 3300005546 Bacteria 2665
116 Ga0070696_100126208 3300005546 Bacteria 1857
117 Ga0070693_100329414 3300005547 Bacteria 1039
118 Ga0070665_100012795 3300005548 Bacteria 8452
119 Ga0070665_100028996 3300005548 Bacteria 5571
120 Ga0070665_100057829 3300005548 Bacteria 3887
121 Ga0070665_100278719 3300005548 Bacteria 1674
122 Ga0070665_100671994 3300005548 Bacteria 1049
123 Ga0070704_100009388 3300005549 Bacteria 5908
124 Ga0070704_100025719 3300005549 Bacteria 3879
125 Ga0070704_100130507 3300005549 Bacteria 1947
126 Ga0068855_100048456 3300005563 Bacteria 5013
127 Ga0070664_100038767 3300005564 Bacteria 4012
128 Ga0068857_100041707 3300005577 Bacteria 4070
129 Ga0068854_100037452 3300005578 Bacteria 3404
130 Ga0068854_100037921 3300005578 Bacteria 3386
131 Ga0070702_100019858 3300005615 Bacteria 3512
132 Ga0070702_100250219 3300005615 Bacteria 1201
133 Ga0068859_100155774 3300005617 Bacteria 2362
134 Ga0068859_100360092 3300005617 Unclassified 1550
135 Ga0068859_100526461 3300005617 Bacteria 1277
136 Ga0068859_100554466 3300005617 Unclassified 1244
137 Ga0068864_100001796 3300005618 Bacteria 17613
138 Ga0068864_100010022 3300005618 Bacteria 7823
139 Ga0068864_100044823 3300005618 Bacteria 3793
140 Ga0068864_100480227 3300005618 Bacteria 1193
141 Ga0068864_100670834 3300005618 Bacteria 1011
142 Ga0068861_100007605 3300005719 Bacteria 7437
143 Ga0068861_100260412 3300005719 Bacteria 1485
144 Ga0068861_100481712 3300005719 Bacteria 1118
145 Ga0068851_10058392 3300005834 Bacteria 1972
146 Ga0068863_100008228 3300005841 Bacteria 10190
147 Ga0068863_100026573 3300005841 Bacteria 5520
148 Ga0068863_100073804 3300005841 Bacteria 3228
149 Ga0068863_100090084 3300005841 Bacteria 2908
150 Ga0068863_100690948 3300005841 Unclassified 1014
151 Ga0068858_100000616 3300005842 Bacteria 37281
152 Ga0068858_100006021 3300005842 Bacteria 11828
153 Ga0068858_100048236 3300005842 Bacteria 3947
154 Ga0068858_100060657 3300005842 Unclassified 3496
155 Ga0068858_100071484 3300005842 Bacteria 3219
156 Ga0068858_100073214 3300005842 Bacteria 3181
157 Ga0068858_100080020 3300005842 Bacteria 3036
158 Ga0068858_100137028 3300005842 Bacteria 2297
159 Ga0068858_100254439 3300005842 Bacteria 1669
160 Ga0068860_100099433 3300005843 Unclassified 2774
161 Ga0068860_100122640 3300005843 Bacteria 2490
162 Ga0068860_100411173 3300005843 Unclassified 1340
163 Ga0068860_100842235 3300005843 Bacteria 932
164 Ga0068862_100009306 3300005844 Bacteria 8134
165 Ga0068862_100245874 3300005844 Bacteria 1628
166 Ga0068862_100298663 3300005844 Bacteria 1481
167 Ga0068862_100652952 3300005844 Bacteria 1015
168 Ga0081455_10088558 3300005937 Bacteria 2514
169 Ga0081538_10117511 3300005981 Unclassified 1287
170 Ga0081539_10000024 3300005985 Bacteria 354702
171 Ga0081539_10022119 3300005985 Bacteria 4218
172 Ga0070717_10107145 3300006028 Unclassified 2380
173 Ga0070716_100215270 3300006173 Unclassified 1287
174 Ga0097621_100001059 3300006237 Bacteria 19256
175 Ga0097621_100001084 3300006237 Bacteria 19020
176 Ga0097621_100011496 3300006237 Bacteria 6521
177 Ga0097621_100014616 3300006237 Bacteria 5882
178 Ga0097621_100052329 3300006237 Bacteria 3326
179 Ga0097621_100075461 3300006237 Unclassified 2795
180 Ga0097621_100086066 3300006237 Unclassified 2622
181 Ga0097621_100104243 3300006237 Bacteria 2390
182 Ga0097621_100537119 3300006237 Bacteria 1063
183 Ga0068871_100000786 3300006358 Bacteria 21338
184 Ga0068871_100011894 3300006358 Bacteria 6403
185 Ga0068871_100027948 3300006358 Bacteria 4417
186 Ga0068871_100055718 3300006358 Unclassified 3210
187 Ga0068871_100245291 3300006358 Bacteria 1559
188 Ga0068871_100284683 3300006358 Bacteria 1447
189 Ga0075428_100000005 3300006844 Bacteria 326130
190 Ga0075428_100021848 3300006844 Bacteria 7085
191 Ga0075428_100314255 3300006844 Unclassified 1684
192 Ga0075428_100399108 3300006844 Bacteria 1474
193 Ga0075428_100784746 3300006844 Bacteria 1013
194 Ga0075430_100009215 3300006846 Bacteria 8343
195 Ga0075430_100072242 3300006846 Bacteria 2894
196 Ga0075431_100014557 3300006847 Bacteria 7958
197 Ga0075431_100050246 3300006847 Bacteria 4300
198 Ga0075433_10001124 3300006852 Bacteria 19366
199 Ga0075433_10022443 3300006852 Bacteria 5297
200 Ga0075433_10025196 3300006852 Bacteria 5028
201 Ga0075433_10238087 3300006852 Bacteria 1616
202 Ga0075433_10385304 3300006852 Bacteria 1237
203 Ga0075434_100002581 3300006871 Bacteria 15989
204 Ga0075434_100012292 3300006871 Bacteria 8112
205 Ga0075434_100042874 3300006871 Bacteria 4487
206 Ga0075434_100173329 3300006871 Bacteria 2177
207 Ga0075434_100299877 3300006871 Bacteria 1627
208 Ga0075429_100050281 3300006880 Bacteria 3627
209 Ga0075429_100138354 3300006880 Bacteria 2131
210 Ga0068865_100054823 3300006881 Bacteria 2772
211 Ga0068865_100071770 3300006881 Bacteria 2457
212 Ga0075436_100001416 3300006914 Bacteria 16288
213 Ga0075436_100011962 3300006914 Bacteria 5952
214 Ga0075436_100014018 3300006914 Bacteria 5485
215 Ga0075436_100034680 3300006914 Bacteria 3480
216 Ga0075436_100137369 3300006914 Bacteria 1717
217 Ga0075436_100178571 3300006914 Bacteria 1500
218 Ga0097620_100155776 3300006931 Bacteria 2362
219 Ga0097620_100360066 3300006931 Unclassified 1550
220 Ga0097620_100526514 3300006931 Bacteria 1277
221 Ga0097620_100554446 3300006931 Unclassified 1244
222 Ga0075435_100000062 3300007076 Bacteria 55669
223 Ga0075435_100000709 3300007076 Bacteria 20651
224 Ga0075435_100009695 3300007076 Bacteria 6995
225 Ga0075435_100037589 3300007076 Bacteria 3856
226 Ga0075435_100293853 3300007076 Bacteria 1389
227 Ga0075435_100384442 3300007076 Unclassified 1206
228 Ga0075435_100389236 3300007076 Bacteria 1198
229 Ga0105251_10201054 3300009011 Unclassified 898
230 Ga0105240_10058725 3300009093 Bacteria 4802
231 Ga0105240_10254290 3300009093 Bacteria 2030
232 Ga0111539_10002628 3300009094 Bacteria 23814
233 Ga0111539_10003468 3300009094 Bacteria 20768
234 Ga0111539_10005472 3300009094 Bacteria 16430
235 Ga0111539_10013059 3300009094 Bacteria 10392
236 Ga0111539_10026974 3300009094 Bacteria 7017
237 Ga0111539_10058512 3300009094 Bacteria 4572
238 Ga0111539_10508513 3300009094 Bacteria 1403
239 Ga0105245_10040124 3300009098 Bacteria 4169
240 Ga0105247_10008913 3300009101 Bacteria 6114
241 Ga0105247_10147122 3300009101 Unclassified 1549
242 Ga0105247_10254385 3300009101 Bacteria 1202
243 Ga0105247_10376743 3300009101 Unclassified 1005
244 Ga0114129_10004809 3300009147 Bacteria 19090
245 Ga0114129_10019535 3300009147 Bacteria 9647
246 Ga0114129_10046235 3300009147 Bacteria 6118
247 Ga0114129_10068600 3300009147 Bacteria 4944
248 Ga0114129_10078288 3300009147 Bacteria 4599
249 Ga0114129_10090982 3300009147 Bacteria 4229
250 Ga0114129_10095989 3300009147 Unclassified 4105
251 Ga0114129_10120779 3300009147 Bacteria 3607
252 Ga0114129_10170317 3300009147 Bacteria 2969
253 Ga0114129_10514098 3300009147 Bacteria 1562
254 Ga0114129_10569511 3300009147 Bacteria 1471
255 Ga0105243_10042279 3300009148 Bacteria 3567
256 Ga0105243_10380112 3300009148 Bacteria 1306
257 Ga0105243_10416943 3300009148 Bacteria 1251
258 Ga0105242_10018876 3300009176 Bacteria 5400
259 Ga0105242_10058604 3300009176 Bacteria 3158
260 Ga0105242_10101813 3300009176 Unclassified 2435
261 Ga0105242_10146487 3300009176 Bacteria 2055
262 Ga0105242_10232451 3300009176 Bacteria 1653
263 Ga0105248_10012897 3300009177 Bacteria 9217
264 Ga0105248_10016893 3300009177 Bacteria 8035
265 Ga0105248_10026983 3300009177 Bacteria 6388
266 Ga0105248_10037323 3300009177 Bacteria 5436
267 Ga0105248_10047966 3300009177 Bacteria 4790
268 Ga0105248_10081115 3300009177 Unclassified 3647
269 Ga0105248_10092284 3300009177 Bacteria 3410
270 Ga0105248_10107427 3300009177 Bacteria 3147
271 Ga0105248_10165613 3300009177 Bacteria 2492
272 Ga0105248_10222812 3300009177 Bacteria 2123
273 Ga0105248_10256768 3300009177 Bacteria 1967
274 Ga0105238_10243811 3300009551 Bacteria 1775
275 Ga0105238_10398933 3300009551 Bacteria 1368
276 Ga0105238_10701582 3300009551 Bacteria 1024
277 Ga0105249_10339122 3300009553 Unclassified 1519
278 Ga0105249_10425295 3300009553 Bacteria 1363
279 Ga0105249_10610799 3300009553 Unclassified 1146
280 Ga0105249_10742087 3300009553 Bacteria 1044
281 Ga0105239_10690052 3300010375 Bacteria 1167
282 Ga0105246_10180698 3300011119 Unclassified 1624
283 Ga0105246_10262562 3300011119 Bacteria 1376
284 Ga0157374_10003656 3300013296 Bacteria 12937
285 Ga0157374_10115513 3300013296 Bacteria 2585
286 Ga0157374_10304592 3300013296 Bacteria 1577
287 Ga0157374_10318252 3300013296 Unclassified 1541
288 Ga0157378_10002822 3300013297 Bacteria 15498
289 Ga0157378_10143172 3300013297 Unclassified 2222
290 Ga0157378_10221133 3300013297 Bacteria 1800
291 Ga0157378_10426801 3300013297 Bacteria 1311
292 Ga0163162_10000855 3300013306 Bacteria 28374
293 Ga0163162_10023111 3300013306 Bacteria 6133
294 Ga0157372_10308853 3300013307 Unclassified 1840
295 Ga0157372_10483327 3300013307 Bacteria 1444
296 Ga0157375_10384413 3300013308 Bacteria 1570
297 Ga0157375_10420041 3300013308 Bacteria 1503
298 Ga0157375_10438890 3300013308 Bacteria 1471
299 Ga0157375_10556458 3300013308 Unclassified 1308
300 Ga0163163_10004547 3300014325 Bacteria 11847
301 Ga0163163_10056735 3300014325 Unclassified 3870
302 Ga0163163_10062730 3300014325 Bacteria 3683
303 Ga0157380_10072605 3300014326 Bacteria 2788
304 Ga0157380_10121107 3300014326 Bacteria 2216
305 Ga0157380_10135277 3300014326 Bacteria 2109
306 Ga0157380_10497046 3300014326 Bacteria 1184
307 Ga0157380_10577193 3300014326 Bacteria 1108
308 Ga0157377_10214631 3300014745 Bacteria 1229
309 Ga0157379_10041413 3300014968 Unclassified 4112
310 Ga0157379_10044547 3300014968 Bacteria 3961
311 Ga0157379_10085234 3300014968 Bacteria 2831
312 Ga0157379_10124084 3300014968 Unclassified 2324
313 Ga0157379_10183515 3300014968 Bacteria 1890
314 Ga0157379_10309446 3300014968 Unclassified 1441
315 Ga0157376_10000241 3300014969 Bacteria 38280
316 Ga0157376_10018203 3300014969 Bacteria 5378
317 Ga0157376_10112165 3300014969 Unclassified 2402
318 Ga0157376_10296793 3300014969 Bacteria 1528
319 Ga0163161_10054974 3300017792 Unclassified 2890
320 Ga0206351_10459999 3300020077 Unclassified 847
321 Ga0224712_10170926 3300022467 Unclassified 975
322 Ga0207697_10033459 3300025315 Bacteria 2104
323 Ga0207697_10067786 3300025315 Bacteria 1492
324 Ga0207682_10012967 3300025893 Bacteria 3250
325 Ga0207682_10015589 3300025893 Bacteria 2959
326 Ga0207642_10193054 3300025899 Bacteria 1119
327 Ga0207642_10196736 3300025899 Bacteria 1110
328 Ga0207710_10020102 3300025900 Unclassified 2853
329 Ga0207645_10030489 3300025907 Bacteria 3475
330 Ga0207645_10043643 3300025907 Unclassified 2870
331 Ga0207645_10048555 3300025907 Bacteria 2710
332 Ga0207645_10230317 3300025907 Bacteria 1223
333 Ga0207645_10270864 3300025907 Unclassified 1126
334 Ga0207643_10038197 3300025908 Bacteria 2697
335 Ga0207643_10097415 3300025908 Bacteria 1721
336 Ga0207643_10332400 3300025908 Bacteria 951
337 Ga0207705_10515380 3300025909 Unclassified 929
338 Ga0207684_10278039 3300025910 Bacteria 1444
339 Ga0207707_10110829 3300025912 Bacteria 2399
340 Ga0207707_10327160 3300025912 Unclassified 1323
341 Ga0207707_10408176 3300025912 Bacteria 1166
342 Ga0207695_10168001 3300025913 Bacteria 2121
343 Ga0207695_10426628 3300025913 Bacteria 1210
344 Ga0207663_10105988 3300025916 Bacteria 1899
345 Ga0207660_10139314 3300025917 Bacteria 1854
346 Ga0207662_10024338 3300025918 Unclassified 3484
347 Ga0207662_10196489 3300025918 Bacteria 1304
348 Ga0207657_10011114 3300025919 Bacteria 8950
349 Ga0207652_10104586 3300025921 Bacteria 2504
350 Ga0207646_10101175 3300025922 Bacteria 2584
351 Ga0207646_10104106 3300025922 Bacteria 2545
352 Ga0207646_10378039 3300025922 Bacteria 1280
353 Ga0207681_10009628 3300025923 Bacteria 5907
354 Ga0207681_10094910 3300025923 Bacteria 2138
355 Ga0207681_10114364 3300025923 Bacteria 1968
356 Ga0207681_10305010 3300025923 Bacteria 1261
357 Ga0207681_10357209 3300025923 Bacteria 1171
358 Ga0207650_10003322 3300025925 Bacteria 11076
359 Ga0207650_10023170 3300025925 Bacteria 4403
360 Ga0207650_10437070 3300025925 Bacteria 1087
361 Ga0207659_10002433 3300025926 Bacteria 11092
362 Ga0207659_10088385 3300025926 Unclassified 2308
363 Ga0207659_10199841 3300025926 Bacteria 1596
364 Ga0207659_10246763 3300025926 Unclassified 1447
365 Ga0207659_10247759 3300025926 Bacteria 1444
366 Ga0207659_10248254 3300025926 Unclassified 1443
367 Ga0207687_10022738 3300025927 Bacteria 4175
368 Ga0207687_10110103 3300025927 Bacteria 2042
369 Ga0207700_10004877 3300025928 Bacteria 7970
370 Ga0207644_10003677 3300025931 Bacteria 9944
371 Ga0207644_10129229 3300025931 Bacteria 1932
372 Ga0207644_10465750 3300025931 Bacteria 1039
373 Ga0207690_10087647 3300025932 Unclassified 2191
374 Ga0207706_10041530 3300025933 Bacteria 4077
375 Ga0207706_10081752 3300025933 Bacteria 2839
376 Ga0207706_10347128 3300025933 Bacteria 1290
377 Ga0207706_10564306 3300025933 Unclassified 979
378 Ga0207686_10025700 3300025934 Bacteria 3429
379 Ga0207686_10107123 3300025934 Bacteria 1878
380 Ga0207686_10549998 3300025934 Unclassified 902
381 Ga0207709_10247450 3300025935 Bacteria 1300
382 Ga0207709_10445264 3300025935 Unclassified 1000
383 Ga0207670_10302372 3300025936 Unclassified 1253
384 Ga0207669_10077766 3300025937 Bacteria 2111
385 Ga0207704_10033183 3300025938 Bacteria 2932
386 Ga0207704_10043798 3300025938 Bacteria 2646
387 Ga0207704_10057757 3300025938 Bacteria 2385
388 Ga0207704_10191554 3300025938 Bacteria 1488
389 Ga0207691_10010435 3300025940 Bacteria 8910
390 Ga0207691_10159010 3300025940 Bacteria 1983
391 Ga0207691_10186224 3300025940 Bacteria 1812
392 Ga0207711_10001738 3300025941 Bacteria 19988
393 Ga0207711_10002396 3300025941 Bacteria 16751
394 Ga0207711_10012901 3300025941 Bacteria 6939
395 Ga0207711_10017589 3300025941 Bacteria 5939
396 Ga0207711_10074662 3300025941 Bacteria 2949
397 Ga0207711_10119803 3300025941 Bacteria 2348
398 Ga0207711_10153493 3300025941 Unclassified 2080
399 Ga0207711_10235401 3300025941 Bacteria 1678
400 Ga0207711_10370850 3300025941 Bacteria 1327
401 Ga0207711_10405327 3300025941 Bacteria 1267
402 Ga0207711_10761689 3300025941 Bacteria 902
403 Ga0207711_10784765 3300025941 Bacteria 887
404 Ga0207689_10221231 3300025942 Bacteria 1564
405 Ga0207661_10090888 3300025944 Unclassified 2543
406 Ga0207679_10295398 3300025945 Bacteria 1394
407 Ga0207651_10013098 3300025960 Bacteria 4730
408 Ga0207651_10066053 3300025960 Unclassified 2540
409 Ga0207651_10231446 3300025960 Unclassified 1500
410 Ga0207712_10514206 3300025961 Bacteria 1025
411 Ga0207668_10100033 3300025972 Bacteria 2152
412 Ga0207640_10010404 3300025981 Bacteria 5242
413 Ga0207640_10024556 3300025981 Bacteria 3638
414 Ga0207658_10003213 3300025986 Bacteria 11621
415 Ga0207658_10045288 3300025986 Bacteria 3207
416 Ga0207658_10055681 3300025986 Unclassified 2932
417 Ga0207658_10147486 3300025986 Unclassified 1913
418 Ga0207658_10467463 3300025986 Bacteria 1119
419 Ga0207677_10002844 3300026023 Bacteria 9127
420 Ga0207677_10013235 3300026023 Bacteria 4773
421 Ga0207677_10049837 3300026023 Bacteria 2828
422 Ga0207677_10126674 3300026023 Bacteria 1931
423 Ga0207677_10127527 3300026023 Unclassified 1926
424 Ga0207703_10012648 3300026035 Bacteria 6581
425 Ga0207703_10058992 3300026035 Bacteria 3135
426 Ga0207703_10076630 3300026035 Unclassified 2774
427 Ga0207703_10080983 3300026035 Bacteria 2705
428 Ga0207703_10101914 3300026035 Unclassified 2435
429 Ga0207703_10133894 3300026035 Unclassified 2143
430 Ga0207703_10210317 3300026035 Bacteria 1734
431 Ga0207708_10017733 3300026075 Bacteria 5359
432 Ga0207708_10327520 3300026075 Bacteria 1251
433 Ga0207702_10012492 3300026078 Bacteria 7064
434 Ga0207702_10296113 3300026078 Unclassified 1534
435 Ga0207641_10001164 3300026088 Bacteria 26455
436 Ga0207641_10071424 3300026088 Bacteria 2986
437 Ga0207641_10144205 3300026088 Unclassified 2152
438 Ga0207641_10346753 3300026088 Bacteria 1414
439 Ga0207648_10007189 3300026089 Bacteria 10979
440 Ga0207648_10052098 3300026089 Bacteria 3578
441 Ga0207648_10143726 3300026089 Unclassified 2104
442 Ga0207648_10225282 3300026089 Bacteria 1667
443 Ga0207648_10232421 3300026089 Bacteria 1640
444 Ga0207648_10293322 3300026089 Unclassified 1457
445 Ga0207648_10330098 3300026089 Unclassified 1372
446 Ga0207676_10000283 3300026095 Bacteria 43770
447 Ga0207676_10317864 3300026095 Bacteria 1428
448 Ga0207676_10504244 3300026095 Unclassified 1149
449 Ga0207674_10051601 3300026116 Bacteria 4197
450 Ga0207674_10404994 3300026116 Bacteria 1318
451 Ga0207675_100047033 3300026118 Bacteria 4030
452 Ga0207675_100619043 3300026118 Bacteria 1087
453 Ga0207683_10013100 3300026121 Bacteria 7073
454 Ga0207683_10038395 3300026121 Bacteria 4173
455 Ga0207683_10071784 3300026121 Bacteria 3061
456 Ga0207683_10160539 3300026121 Bacteria 2032
457 Ga0207683_10369156 3300026121 Bacteria 1318
458 Ga0207683_10668859 3300026121 Bacteria 962
459 Ga0207698_10093283 3300026142 Bacteria 2471
460 Ga0207428_10077262 3300027907 Bacteria 2607
461 Ga0207428_10084956 3300027907 Unclassified 2465
462 Ga0207428_10131125 3300027907 Bacteria 1918
463 Ga0207428_10173948 3300027907 Unclassified 1629
464 Ga0268266_10004231 3300028379 Bacteria 13821
465 Ga0268266_10022670 3300028379 Bacteria 5345
466 Ga0268266_10095815 3300028379 Bacteria 2607
467 Ga0268266_10359710 3300028379 Bacteria 1369
468 Ga0268266_10463613 3300028379 Bacteria 1206
469 Ga0268265_10016409 3300028380 Bacteria 5086
470 Ga0268265_10062152 3300028380 Unclassified 2868
471 Ga0268265_10349106 3300028380 Bacteria 1350
472 Ga0268264_10024784 3300028381 Bacteria 4899
473 Ga0268264_10800375 3300028381 Bacteria 942
474 Ga0265318_10036682 3300028577 Bacteria 1880
475 Ga0307408_100022978 3300031548 Bacteria 4244
476 Ga0265314_10085805 3300031711 Unclassified 2063
477 Ga0307405_10000559 3300031731 Bacteria 14159
478 Ga0307405_10089250 3300031731 Bacteria 2036
479 Ga0307413_10025505 3300031824 Bacteria 3241
480 Ga0307413_10168435 3300031824 Unclassified 1547
481 Ga0307410_10007167 3300031852 Bacteria 6080
482 Ga0307410_10009520 3300031852 Bacteria 5452
483 Ga0307410_10080817 3300031852 Unclassified 2281
484 Ga0307410_10230012 3300031852 Bacteria 1431
485 Ga0307406_10032609 3300031901 Bacteria 3182
486 Ga0307407_10007930 3300031903 Bacteria 4841
487 Ga0307407_10011743 3300031903 Bacteria 4184
488 Ga0307412_10003955 3300031911 Bacteria 8258
489 Ga0307412_10493603 3300031911 Bacteria 1018
490 Ga0307409_100010186 3300031995 Bacteria 5827
491 Ga0307409_100105600 3300031995 Bacteria 2348
492 Ga0307416_100080080 3300032002 Bacteria 2755
493 Ga0307414_10187755 3300032004 Bacteria 1669
494 Ga0307411_10023165 3300032005 Bacteria 3672
495 Ga0307411_10066415 3300032005 Bacteria 2423
496 Ga0373930_0000811 3300034816 Unclassified 4446
497 Ga0373948_0003377 3300034817 Unclassified 2450
498 Ga0373950_0007400 3300034818 Unclassified 1704
499 Ga0373959_0008947 3300034820 Unclassified 1716
500 Ga0373938_0002390 3300034957 Unclassified 3022
501 Ga0373928_0000258 3300035084 Bacteria 10500
502 Ga0373929_0000270 3300035085 Bacteria 9587
503 Ga0373949_0001590 3300035090 Bacteria 6402
504 Ga0373952_0004041 3300035092 Unclassified 2650
505 Ga0373923_0016295 3300035111 Bacteria 2820
506 Ga0373923_0069428 3300035111 Bacteria 1511
507 Ga0373932_0034296 3300035112 Bacteria 1429
508 Ga0373936_0069108 3300035113 Bacteria 1453
509 Ga0373939_0001843 3300035114 Bacteria 5087
510 Ga0373941_0035955 3300035115 Unclassified 1503
511 Ga0373956_0031428 3300035119 Bacteria 2327
512 Ga0373960_0001467 3300035121 Bacteria 5224
513 Ga0373946_0049699 3300035171 Bacteria 1749
514 Ga0373946_0225196 3300035171 Bacteria 907
515 Ga0373955_0044840 3300035172 Bacteria 2384
516 Ga0373942_0002435 3300035207 Bacteria 4521
517 Ga0373961_0007415 3300035241 Unclassified 2652
518 Ga0373962_0006979 3300035242 Unclassified 2754
519 Ga0373924_0062770 3300035410 Bacteria 1557
520 Ga0373924_0224544 3300035410 Unclassified 830
521 Ga0373931_0001629 3300035691 Bacteria 9710
522 Ga0373935_0266812 3300035692 Unclassified 1202
523 Ga0373927_0014712 3300035695 Bacteria 5173
524 Ga0373947_0028078 3300035725 Bacteria 3296
525 Ga0373937_0122719 3300036401 Bacteria 2422
526 Ga0373937_0140523 3300036401 Bacteria 2259
527 Ga0373937_0259941 3300036401 Bacteria 1637
528 Ga0373937_0288077 3300036401 Unclassified 1551
529 Ga0373937_0420020 3300036401 Unclassified 1269
530 Ga0373937_0449399 3300036401 Bacteria 1224
531 Ga0373937_0612803 3300036401 Bacteria 1033
532 Ga0373925_0015515 3300037068 Bacteria 5510
533 Ga0436365_0156909 3300039437 Unclassified 1637
534 Ga0436365_0792179 3300039437 Bacteria 1701
535 Ga0450917_001368 3300042120 Bacteria 1749
536 Ga0450923_010605 3300042125 Bacteria 1640
537 Ga0439434_0038972 3300042435 Bacteria 1457
538 Ga0439434_0042405 3300042435 Bacteria 1399
539 Ga0439435_0001455 3300042436 Unclassified 4386
540 Ga0439435_0005981 3300042436 Bacteria 2711
541 Ga0466963_0302049 3300044694 Bacteria 1126
542 Ga0466967_0743463 3300045976 Unclassified 973
543 Ga0495603_0341092 3300046455 Bacteria 860
544 Ga0495590_0086884 3300046457 Unclassified 1105
545 Ga0495629_0244835 3300046459 Unclassified 1234
546 Ga0495629_0413635 3300046459 Unclassified 916
547 Ga0495651_0149178 3300046462 Bacteria 1688
548 Ga0495651_0251484 3300046462 Bacteria 1207
549 Ga0495582_0011700 3300046473 Unclassified 4836
550 Ga0495639_0043698 3300046475 Unclassified 2025
551 Ga0495639_0098876 3300046475 Unclassified 1376
552 Ga0495662_0023494 3300046476 Bacteria 2977
553 Ga0495608_0035388 3300046511 Bacteria 3368
554 Ga0495628_0284421 3300046516 Bacteria 1227
555 Ga0495630_0013298 3300046517 Bacteria 5990
556 Ga0495630_0634009 3300046517 Unclassified 819
557 Ga0495640_0229573 3300046533 Unclassified 1168
558 Ga0495586_0069395 3300046535 Bacteria 1924
559 Ga0495587_0127597 3300046536 Bacteria 1455
560 Ga0495621_0073355 3300046539 Unclassified 1265
561 Ga0495645_0032133 3300046543 Bacteria 3827
562 Ga0495645_0237061 3300046543 Bacteria 1219
563 Ga0495667_0046581 3300046559 Bacteria 2867
564 Ga0495667_0221104 3300046559 Bacteria 1209
565 Ga0495635_0122700 3300046663 Unclassified 1772
566 Ga0495659_0116030 3300046664 Bacteria 1050
567 Ga0495599_0080957 3300046678 Bacteria 2028
568 Ga0495599_0328664 3300046678 Unclassified 919
569 Ga0495623_0244490 3300046679 Bacteria 1012
570 Ga0495647_0005521 3300046681 Unclassified 4147
571 Ga0495613_0000718 3300046689 Bacteria 25924
572 Ga0495613_0139241 3300046689 Unclassified 1735
573 Ga0495613_0224711 3300046689 Bacteria 1317
574 Ga0495600_0108327 3300046809 Unclassified 1810
575 Ga0495581_0164890 3300047315 Unclassified 1296
576 Ga0495604_0425207 3300047317 Bacteria 871
577 Ga0495674_0036197 3300047319 Bacteria 4446
578 Ga0495674_0307449 3300047319 Bacteria 1294
579 Ga0495674_0339320 3300047319 Bacteria 1221
580 Ga0495674_0347563 3300047319 Unclassified 1204
581 Ga0495674_0677302 3300047319 Unclassified 811
582 Ga0495675_0089861 3300047444 Bacteria 1928
583 Ga0495684_0000048 3300047471 Bacteria 89243
584 Ga0496101_0002815 3300048904 Bacteria 10689
585 Ga0496102_0096581 3300048905 Bacteria 2740
586 Ga0496104_0009724 3300048907 Bacteria 8572
587 Ga0496104_0590983 3300048907 Bacteria 1020
588 Ga0496105_0007544 3300048908 Bacteria 8429
589 Ga0496105_0076168 3300048908 Bacteria 2770
590 Ga0496105_0513555 3300048908 Bacteria 939
591 Ga0496106_0054938 3300048909 Bacteria 3010
592 Ga0496106_0098808 3300048909 Unclassified 2262
593 Ga0496106_0171523 3300048909 Unclassified 1720
594 Ga0496106_0488561 3300048909 Unclassified 989
595 Ga0496107_0101999 3300048910 Bacteria 2104
596 Ga0496107_0288648 3300048910 Unclassified 1221
597 Ga0496108_0018661 3300048911 Bacteria 5683
598 Ga0496108_0335744 3300048911 Unclassified 1318
599 Ga0496109_0140404 3300048912 Unclassified 2259
600 Ga0496110_0206422 3300048913 Bacteria 1786
601 Ga0496112_0013681 3300048915 Bacteria 7498
602 Ga0496112_0199745 3300048915 Bacteria 1959
603 Ga0496112_0245592 3300048915 Bacteria 1742
604 Ga0496113_0036076 3300048916 Unclassified 3621
605 Ga0496113_0170435 3300048916 Unclassified 1724
606 Ga0496114_0005516 3300048917 Bacteria 9910
607 Ga0496114_0065691 3300048917 Bacteria 3040
608 Ga0496114_0094437 3300048917 Bacteria 2544
609 Ga0496114_0095254 3300048917 Unclassified 2533
610 Ga0496114_0109836 3300048917 Unclassified 2362
611 Ga0496114_0260964 3300048917 Bacteria 1525
612 Ga0501033_0441466 3300049570 Bacteria 905
613 Ga0501034_0141883 3300049571 Bacteria 2381
614 Ga0501036_0486498 3300049572 Bacteria 1027
615 Ga0501038_0293165 3300049574 Bacteria 1278
616 Ga0501039_0238442 3300049575 Bacteria 1430
617 Ga0501047_0167305 3300049581 Unclassified 2069
618 Ga0501073_0206421 3300049589 Unclassified 1358
619 Ga0501075_0023531 3300049591 Bacteria 4512
620 Ga0501075_0027832 3300049591 Bacteria 4168
621 Ga0501076_0014037 3300049592 Bacteria 6021
622 Ga0501076_0105339 3300049592 Bacteria 2276
623 Ga0501076_0186750 3300049592 Bacteria 1691
624 Ga0501249_007717 3300049679 Bacteria 2229
625 Ga0501225_0018189 3300049705 Bacteria 1949
626 Ga0501080_0397023 3300049742 Bacteria 1241
627 Ga0501081_0108120 3300049743 Bacteria 1972
628 Ga0501268_040928 3300049765 Bacteria 872
629 Ga0501283_006643 3300049779 Bacteria 1626
630 Ga0501283_018676 3300049779 Bacteria 1093
631 Ga0501044_0008350 3300049823 Bacteria 11353
632 Ga0501045_0068770 3300049824 Bacteria 2602
633 nmdc:mga05p37_127892_c1 3300050507 Unclassified 3119
634 nmdc:mga05p37_139109_c1 3300050507 Bacteria 2975
635 nmdc:mga05p37_147929_c1 3300050507 Unclassified 2335
636 nmdc:mga05p37_166893_c1 3300050507 Bacteria 2686
637 nmdc:mga05p37_242913_c1 3300050507 Bacteria 2164
638 nmdc:mga05p37_251732_c1 3300050507 Bacteria 2118
639 nmdc:mga05p37_32763_c1 3300050507 Bacteria 6358
640 nmdc:mga05p37_42046_c1 3300050507 Bacteria 5614
641 nmdc:mga05p37_60049_c1 3300050507 Unclassified 4682
642 nmdc:mga05p37_72249_c1 3300050507 Bacteria 4245
643 nmdc:mga05p37_80475_c1 3300050507 Bacteria 4013
644 nmdc:mga05p37_83865_c1 3300050507 Bacteria 3926
645 nmdc:mga05p37_90500_c1 3300050507 Bacteria 3771
646 nmdc:mga05p37_90710_c1 3300050507 Unclassified 3766
647 nmdc:mga09592_202278_c1 3300050508 Bacteria 1720
648 nmdc:mga09592_37318_c1 3300050508 Bacteria 4076
649 nmdc:mga09592_39556_c1 3300050508 Bacteria 3961
650 nmdc:mga0qj67_32045_c1 3300050509 Bacteria 4097
651 nmdc:mga0qj67_368066_c1 3300050509 Bacteria 1161
652 nmdc:mga0qj67_5327_c1 3300050509 Bacteria 9382
653 nmdc:mga06r32_20127_c1 3300050510 Bacteria 6139
654 nmdc:mga06r32_331212_c1 3300050510 Bacteria 1507
655 nmdc:mga06r32_38502_c1 3300050510 Bacteria 4531
656 nmdc:mga08y16_1071_c1 3300050511 Bacteria 26933
657 nmdc:mga08y16_26975_c1 3300050511 Bacteria 6054
658 nmdc:mga08y16_38982_c1 3300050511 Bacteria 4987
659 nmdc:mga08y16_47289_c1 3300050511 Bacteria 4503
660 nmdc:mga0n895_104681_c1 3300050512 Unclassified 2842
661 nmdc:mga0n895_121214_c1 3300050512 Bacteria 2636
662 nmdc:mga0n895_268582_c1 3300050512 Unclassified 1730
663 nmdc:mga0n895_339359_c1 3300050512 Unclassified 1522
664 nmdc:mga0n895_372_c1 3300050512 Bacteria 30333
665 nmdc:mga0n895_385273_c1 3300050512 Bacteria 1418
666 nmdc:mga0n895_45763_c1 3300050512 Unclassified 4272
667 nmdc:mga0n895_680584_c1 3300050512 Unclassified 1026
668 nmdc:mga0n895_720_c1 3300050512 Bacteria 23272
669 nmdc:mga0rr50_10832_c1 3300050513 Bacteria 5813
670 nmdc:mga0rr50_1320_c1 3300050513 Bacteria 13523
671 nmdc:mga0rr50_2869_c1 3300050513 Bacteria 9822
672 nmdc:mga0rr50_29597_c1 3300050513 Bacteria 3865
673 nmdc:mga0rr50_365464_c1 3300050513 Unclassified 1215
674 nmdc:mga0rr50_616164_c1 3300050513 Bacteria 926
675 nmdc:mga0rr50_70840_c1 3300050513 Unclassified 2658
676 nmdc:mga0rr50_77_c1 3300050513 Bacteria 55683
677 nmdc:mga08x19_23270_c1 3300050514 Bacteria 3843
678 nmdc:mga08x19_276160_c1 3300050514 Bacteria 1164
679 nmdc:mga08x19_837_c1 3300050514 Bacteria 19540
680 nmdc:mga0a205_154052_c1 3300050515 Bacteria 2197
681 nmdc:mga0a205_24060_c1 3300050515 Bacteria 5784
682 nmdc:mga0a205_276362_c1 3300050515 Bacteria 1556
683 nmdc:mga0a205_280666_c1 3300050515 Bacteria 1541
684 nmdc:mga0a205_30294_c1 3300050515 Bacteria 5179
685 nmdc:mga0a205_312_c1 3300050515 Bacteria 36141
686 nmdc:mga0a205_376039_c1 3300050515 Bacteria 1286
687 nmdc:mga0a205_4541_c1 3300050515 Bacteria 12460
688 nmdc:mga0a205_50058_c1 3300050515 Bacteria 4034
689 nmdc:mga0a205_71064_c1 3300050515 Bacteria 3362
690 Ga0495601_0006677 3300053077 Bacteria 6755
691 Ga0495601_0007001 3300053077 Archaea 6607
692 Ga0495601_0042176 3300053077 Unclassified 2862
693 Ga0495601_0160924 3300053077 Unclassified 1467
694 Ga0495595_0155745 3300053084 Unclassified 1126
695 Ga0495595_0177645 3300053084 Bacteria 1055
696 Ga0495619_0026256 3300053085 Bacteria 3746
697 Ga0495619_0136316 3300053085 Unclassified 1688
698 Ga0495619_0297959 3300053085 Bacteria 1117
699 Ga0495619_0313538 3300053085 Bacteria 1086
700 Ga0495619_0350377 3300053085 Bacteria 1021
701 Ga0501084_0036556 3300054114 Bacteria 4102
702 Ga0501084_0261405 3300054114 Unclassified 1461
703 Ga0501084_0736088 3300054114 Unclassified 831
704 Ga0590074_000865 3300059423 Bacteria 4702
705 Ga0590074_003842 3300059423 Bacteria 2490
706 Ga0590075_000213 3300059424 Bacteria 16227
707 Ga0590075_013902 3300059424 Bacteria 1965
708 Ga0590077_000088 3300059426 Bacteria 23458
709 Ga0590077_003150 3300059426 Bacteria 3449
710 Ga0590077_010402 3300059426 Bacteria 1913
711 Ga0587073_0026727 3300059492 Bacteria 1158
712 Ga0587083_0027114 3300059505 Bacteria 1111
713 Ga0501082_0048076 3300060353 Bacteria 3677
714 Ga0530510_0265151 3300061734 Bacteria 1281
715 Ga0495580_0025591
716 JGI24751J29686_10004718
717 JGI25406J46586_10003702
718 Ga0058863_11793103
719 Ga0058863_11819918
720 Ga0058863_11903460
721 Ga0058863_11955445
722 Ga0058861_11918555
723 Ga0058862_10128726
724 Ga0058862_12595308
725 Ga0058862_12801063
726 Ga0065715_10156445
727 Ga0070658_10090436
728 Ga0070676_10024056
729 Ga0070676_10092393
730 Ga0070676_10127272
731 Ga0070676_10277229
732 Ga0070683_100023652
733 Ga0070690_100038643
734 Ga0070690_100081385
735 Ga0070690_100375565
736 Ga0070670_100004279
737 Ga0070670_100066204
738 Ga0070670_100351214
739 Ga0070677_10015682
740 Ga0068869_100124837
741 Ga0068869_100302563
742 Ga0070666_10060437
743 Ga0070666_10069262
744 Ga0070666_10091864
745 Ga0070680_100325206
746 Ga0068868_100004255
747 Ga0068868_100012014
748 Ga0068868_100033676
749 Ga0068868_100142502
750 Ga0068868_100152845
751 Ga0068868_100170243
752 Ga0070660_100132983
753 Ga0070689_100069852
754 Ga0070687_100010448
755 Ga0070687_100031684
756 Ga0070687_100039704
757 Ga0070687_100224465
758 Ga0070687_100243360
759 Ga0070661_100182745
760 Ga0070669_100012423
761 Ga0070669_100016932
762 Ga0070669_100024992
763 Ga0070669_100317741
764 Ga0070675_100006173
765 Ga0070675_100021696
766 Ga0070675_100024561
767 Ga0070675_100067606
768 Ga0070675_100465160
769 Ga0070671_100032906
770 Ga0070671_100042838
771 Ga0070671_100431751
772 Ga0070674_100003575
773 Ga0070674_100554905
774 Ga0070673_100022519
775 Ga0070673_100083799
776 Ga0070673_100207878
777 Ga0070688_100168426
778 Ga0070659_100098339
779 Ga0070667_100000788
780 Ga0070667_100095073
781 Ga0070667_100313640
782 Ga0070709_10596701
783 Ga0070714_100013693
784 Ga0070713_100041429
785 Ga0070701_10049421
786 Ga0070711_100048088
787 Ga0070711_100086415
788 Ga0070705_100170889
789 Ga0070705_100484065
790 Ga0070700_100021472
791 Ga0070708_100139103
792 Ga0070708_100153696
793 Ga0070708_100234367
794 Ga0070678_100025520
795 Ga0070678_100043368
796 Ga0070678_100127754
797 Ga0070678_100204850
798 Ga0070662_100524909
799 Ga0070681_10155045
800 Ga0070681_10180089
801 Ga0068867_100038270
802 Ga0068867_100235992
803 Ga0070685_10135022
804 Ga0070685_10412363
805 Ga0070706_100353838
806 Ga0070706_100729248
807 Ga0070707_100069464
808 Ga0070707_100507477
809 Ga0070698_100034751
810 Ga0070698_100089817
811 Ga0070698_100386334
812 Ga0070699_100630122
813 Ga0070679_100140701
814 Ga0070684_100081709
815 Ga0070684_100120972
816 Ga0070697_100020164
817 Ga0070697_100169594
818 Ga0070697_100239620
819 Ga0070697_100328654
820 Ga0070672_100003753
821 Ga0070672_100282623
822 Ga0070686_100032978
823 Ga0070686_100134141
824 Ga0070695_100014055
825 Ga0070695_100016035
826 Ga0070695_100078380
827 Ga0070695_100087666
828 Ga0070696_100049906
829 Ga0070696_100059747
830 Ga0070696_100126208
831 Ga0070693_100329414
832 Ga0070665_100012795
833 Ga0070665_100028996
834 Ga0070665_100057829
835 Ga0070665_100278719
836 Ga0070665_100671994
837 Ga0070704_100009388
838 Ga0070704_100025719
839 Ga0070704_100130507
840 Ga0068855_100048456
841 Ga0070664_100038767
842 Ga0068857_100041707
843 Ga0068854_100037452
844 Ga0068854_100037921
845 Ga0070702_100019858
846 Ga0070702_100250219
847 Ga0068859_100155774
848 Ga0068859_100360092
849 Ga0068859_100526461
850 Ga0068859_100554466
851 Ga0068864_100001796
852 Ga0068864_100010022
853 Ga0068864_100044823
854 Ga0068864_100480227
855 Ga0068864_100670834
856 Ga0068861_100007605
857 Ga0068861_100260412
858 Ga0068861_100481712
859 Ga0068851_10058392
860 Ga0068863_100008228
861 Ga0068863_100026573
862 Ga0068863_100073804
863 Ga0068863_100090084
864 Ga0068863_100690948
865 Ga0068858_100000616
866 Ga0068858_100006021
867 Ga0068858_100048236
868 Ga0068858_100060657
869 Ga0068858_100071484
870 Ga0068858_100073214
871 Ga0068858_100080020
872 Ga0068858_100137028
873 Ga0068858_100254439
874 Ga0068860_100099433
875 Ga0068860_100122640
876 Ga0068860_100411173
877 Ga0068860_100842235
878 Ga0068862_100009306
879 Ga0068862_100245874
880 Ga0068862_100298663
881 Ga0068862_100652952
882 Ga0081455_10088558
883 Ga0081538_10117511
884 Ga0081539_10000024
885 Ga0081539_10022119
886 Ga0070717_10107145
887 Ga0070716_100215270
888 Ga0097621_100001059
889 Ga0097621_100001084
890 Ga0097621_100011496
891 Ga0097621_100014616
892 Ga0097621_100052329
893 Ga0097621_100075461
894 Ga0097621_100086066
895 Ga0097621_100104243
896 Ga0097621_100537119
897 Ga0068871_100000786
898 Ga0068871_100011894
899 Ga0068871_100027948
900 Ga0068871_100055718
901 Ga0068871_100245291
902 Ga0068871_100284683
903 Ga0075428_100000005
904 Ga0075428_100021848
905 Ga0075428_100314255
906 Ga0075428_100399108
907 Ga0075428_100784746
908 Ga0075430_100009215
909 Ga0075430_100072242
910 Ga0075431_100014557
911 Ga0075431_100050246
912 Ga0075433_10001124
913 Ga0075433_10022443
914 Ga0075433_10025196
915 Ga0075433_10238087
916 Ga0075433_10385304
917 Ga0075434_100002581
918 Ga0075434_100012292
919 Ga0075434_100042874
920 Ga0075434_100173329
921 Ga0075434_100299877
922 Ga0075429_100050281
923 Ga0075429_100138354
924 Ga0068865_100054823
925 Ga0068865_100071770
926 Ga0075436_100001416
927 Ga0075436_100011962
928 Ga0075436_100014018
929 Ga0075436_100034680
930 Ga0075436_100137369
931 Ga0075436_100178571
932 Ga0097620_100155776
933 Ga0097620_100360066
934 Ga0097620_100526514
935 Ga0097620_100554446
936 Ga0075435_100000062
937 Ga0075435_100000709
938 Ga0075435_100009695
939 Ga0075435_100037589
940 Ga0075435_100293853
941 Ga0075435_100384442
942 Ga0075435_100389236
943 Ga0105251_10201054
944 Ga0105240_10058725
945 Ga0105240_10254290
946 Ga0111539_10002628
947 Ga0111539_10003468
948 Ga0111539_10005472
949 Ga0111539_10013059
950 Ga0111539_10026974
951 Ga0111539_10058512
952 Ga0111539_10508513
953 Ga0105245_10040124
954 Ga0105247_10008913
955 Ga0105247_10147122
956 Ga0105247_10254385
957 Ga0105247_10376743
958 Ga0114129_10004809
959 Ga0114129_10019535
960 Ga0114129_10046235
961 Ga0114129_10068600
962 Ga0114129_10078288
963 Ga0114129_10090982
964 Ga0114129_10095989
965 Ga0114129_10120779
966 Ga0114129_10170317
967 Ga0114129_10514098
968 Ga0114129_10569511
969 Ga0105243_10042279
970 Ga0105243_10380112
971 Ga0105243_10416943
972 Ga0105242_10018876
973 Ga0105242_10058604
974 Ga0105242_10101813
975 Ga0105242_10146487
976 Ga0105242_10232451
977 Ga0105248_10012897
978 Ga0105248_10016893
979 Ga0105248_10026983
980 Ga0105248_10037323
981 Ga0105248_10047966
982 Ga0105248_10081115
983 Ga0105248_10092284
984 Ga0105248_10107427
985 Ga0105248_10165613
986 Ga0105248_10222812
987 Ga0105248_10256768
988 Ga0105238_10243811
989 Ga0105238_10398933
990 Ga0105238_10701582
991 Ga0105249_10339122
992 Ga0105249_10425295
993 Ga0105249_10610799
994 Ga0105249_10742087
995 Ga0105239_10690052
996 Ga0105246_10180698
997 Ga0105246_10262562
998 Ga0157374_10003656
999 Ga0157374_10115513
1000 Ga0157374_10304592
1001 Ga0157374_10318252
1002 Ga0157378_10002822
1003 Ga0157378_10143172
1004 Ga0157378_10221133
1005 Ga0157378_10426801
1006 Ga0163162_10000855
1007 Ga0163162_10023111
1008 Ga0157372_10308853
1009 Ga0157372_10483327
1010 Ga0157375_10384413
1011 Ga0157375_10420041
1012 Ga0157375_10438890
1013 Ga0157375_10556458
1014 Ga0163163_10004547
1015 Ga0163163_10056735
1016 Ga0163163_10062730
1017 Ga0157380_10072605
1018 Ga0157380_10121107
1019 Ga0157380_10135277
1020 Ga0157380_10497046
1021 Ga0157380_10577193
1022 Ga0157377_10214631
1023 Ga0157379_10041413
1024 Ga0157379_10044547
1025 Ga0157379_10085234
1026 Ga0157379_10124084
1027 Ga0157379_10183515
1028 Ga0157379_10309446
1029 Ga0157376_10000241
1030 Ga0157376_10018203
1031 Ga0157376_10112165
1032 Ga0157376_10296793
1033 Ga0163161_10054974
1034 Ga0206351_10459999
1035 Ga0224712_10170926
1036 Ga0207697_10033459
1037 Ga0207697_10067786
1038 Ga0207682_10012967
1039 Ga0207682_10015589
1040 Ga0207642_10193054
1041 Ga0207642_10196736
1042 Ga0207710_10020102
1043 Ga0207645_10030489
1044 Ga0207645_10043643
1045 Ga0207645_10048555
1046 Ga0207645_10230317
1047 Ga0207645_10270864
1048 Ga0207643_10038197
1049 Ga0207643_10097415
1050 Ga0207643_10332400
1051 Ga0207705_10515380
1052 Ga0207684_10278039
1053 Ga0207707_10110829
1054 Ga0207707_10327160
1055 Ga0207707_10408176
1056 Ga0207695_10168001
1057 Ga0207695_10426628
1058 Ga0207663_10105988
1059 Ga0207660_10139314
1060 Ga0207662_10024338
1061 Ga0207662_10196489
1062 Ga0207657_10011114
1063 Ga0207652_10104586
1064 Ga0207646_10101175
1065 Ga0207646_10104106
1066 Ga0207646_10378039
1067 Ga0207681_10009628
1068 Ga0207681_10094910
1069 Ga0207681_10114364
1070 Ga0207681_10305010
1071 Ga0207681_10357209
1072 Ga0207650_10003322
1073 Ga0207650_10023170
1074 Ga0207650_10437070
1075 Ga0207659_10002433
1076 Ga0207659_10088385
1077 Ga0207659_10199841
1078 Ga0207659_10246763
1079 Ga0207659_10247759
1080 Ga0207659_10248254
1081 Ga0207687_10022738
1082 Ga0207687_10110103
1083 Ga0207700_10004877
1084 Ga0207644_10003677
1085 Ga0207644_10129229
1086 Ga0207644_10465750
1087 Ga0207690_10087647
1088 Ga0207706_10041530
1089 Ga0207706_10081752
1090 Ga0207706_10347128
1091 Ga0207706_10564306
1092 Ga0207686_10025700
1093 Ga0207686_10107123
1094 Ga0207686_10549998
1095 Ga0207709_10247450
1096 Ga0207709_10445264
1097 Ga0207670_10302372
1098 Ga0207669_10077766
1099 Ga0207704_10033183
1100 Ga0207704_10043798
1101 Ga0207704_10057757
1102 Ga0207704_10191554
1103 Ga0207691_10010435
1104 Ga0207691_10159010
1105 Ga0207691_10186224
1106 Ga0207711_10001738
1107 Ga0207711_10002396
1108 Ga0207711_10012901
1109 Ga0207711_10017589
1110 Ga0207711_10074662
1111 Ga0207711_10119803
1112 Ga0207711_10153493
1113 Ga0207711_10235401
1114 Ga0207711_10370850
1115 Ga0207711_10405327
1116 Ga0207711_10761689
1117 Ga0207711_10784765
1118 Ga0207689_10221231
1119 Ga0207661_10090888
1120 Ga0207679_10295398
1121 Ga0207651_10013098
1122 Ga0207651_10066053
1123 Ga0207651_10231446
1124 Ga0207712_10514206
1125 Ga0207668_10100033
1126 Ga0207640_10010404
1127 Ga0207640_10024556
1128 Ga0207658_10003213
1129 Ga0207658_10045288
1130 Ga0207658_10055681
1131 Ga0207658_10147486
1132 Ga0207658_10467463
1133 Ga0207677_10002844
1134 Ga0207677_10013235
1135 Ga0207677_10049837
1136 Ga0207677_10126674
1137 Ga0207677_10127527
1138 Ga0207703_10012648
1139 Ga0207703_10058992
1140 Ga0207703_10076630
1141 Ga0207703_10080983
1142 Ga0207703_10101914
1143 Ga0207703_10133894
1144 Ga0207703_10210317
1145 Ga0207708_10017733
1146 Ga0207708_10327520
1147 Ga0207702_10012492
1148 Ga0207702_10296113
1149 Ga0207641_10001164
1150 Ga0207641_10071424
1151 Ga0207641_10144205
1152 Ga0207641_10346753
1153 Ga0207648_10007189
1154 Ga0207648_10052098
1155 Ga0207648_10143726
1156 Ga0207648_10225282
1157 Ga0207648_10232421
1158 Ga0207648_10293322
1159 Ga0207648_10330098
1160 Ga0207676_10000283
1161 Ga0207676_10317864
1162 Ga0207676_10504244
1163 Ga0207674_10051601
1164 Ga0207674_10404994
1165 Ga0207675_100047033
1166 Ga0207675_100619043
1167 Ga0207683_10013100
1168 Ga0207683_10038395
1169 Ga0207683_10071784
1170 Ga0207683_10160539
1171 Ga0207683_10369156
1172 Ga0207683_10668859
1173 Ga0207698_10093283
1174 Ga0207428_10077262
1175 Ga0207428_10084956
1176 Ga0207428_10131125
1177 Ga0207428_10173948
1178 Ga0268266_10004231
1179 Ga0268266_10022670
1180 Ga0268266_10095815
1181 Ga0268266_10359710
1182 Ga0268266_10463613
1183 Ga0268265_10016409
1184 Ga0268265_10062152
1185 Ga0268265_10349106
1186 Ga0268264_10024784
1187 Ga0268264_10800375
1188 Ga0265318_10036682
1189 Ga0307408_100022978
1190 Ga0265314_10085805
1191 Ga0307405_10000559
1192 Ga0307405_10089250
1193 Ga0307413_10025505
1194 Ga0307413_10168435
1195 Ga0307410_10007167
1196 Ga0307410_10009520
1197 Ga0307410_10080817
1198 Ga0307410_10230012
1199 Ga0307406_10032609
1200 Ga0307407_10007930
1201 Ga0307407_10011743
1202 Ga0307412_10003955
1203 Ga0307412_10493603
1204 Ga0307409_100010186
1205 Ga0307409_100105600
1206 Ga0307416_100080080
1207 Ga0307414_10187755
1208 Ga0307411_10023165
1209 Ga0307411_10066415
1210 Ga0373930_0000811
1211 Ga0373948_0003377
1212 Ga0373950_0007400
1213 Ga0373959_0008947
1214 Ga0373938_0002390
1215 Ga0373928_0000258
1216 Ga0373929_0000270
1217 Ga0373949_0001590
1218 Ga0373952_0004041
1219 Ga0373923_0016295
1220 Ga0373923_0069428
1221 Ga0373932_0034296
1222 Ga0373936_0069108
1223 Ga0373939_0001843
1224 Ga0373941_0035955
1225 Ga0373956_0031428
1226 Ga0373960_0001467
1227 Ga0373946_0049699
1228 Ga0373946_0225196
1229 Ga0373955_0044840
1230 Ga0373942_0002435
1231 Ga0373961_0007415
1232 Ga0373962_0006979
1233 Ga0373924_0062770
1234 Ga0373924_0224544
1235 Ga0373931_0001629
1236 Ga0373935_0266812
1237 Ga0373927_0014712
1238 Ga0373947_0028078
1239 Ga0373937_0122719
1240 Ga0373937_0140523
1241 Ga0373937_0259941
1242 Ga0373937_0288077
1243 Ga0373937_0420020
1244 Ga0373937_0449399
1245 Ga0373937_0612803
1246 Ga0373925_0015515
1247 Ga0436365_0156909
1248 Ga0436365_0792179
1249 Ga0450917_001368
1250 Ga0450923_010605
1251 Ga0439434_0038972
1252 Ga0439434_0042405
1253 Ga0439435_0001455
1254 Ga0439435_0005981
1255 Ga0466963_0302049
1256 Ga0466967_0743463
1257 Ga0495603_0341092
1258 Ga0495590_0086884
1259 Ga0495629_0244835
1260 Ga0495629_0413635
1261 Ga0495651_0149178
1262 Ga0495651_0251484
1263 Ga0495582_0011700
1264 Ga0495639_0043698
1265 Ga0495639_0098876
1266 Ga0495662_0023494
1267 Ga0495608_0035388
1268 Ga0495628_0284421
1269 Ga0495630_0013298
1270 Ga0495630_0634009
1271 Ga0495640_0229573
1272 Ga0495586_0069395
1273 Ga0495587_0127597
1274 Ga0495621_0073355
1275 Ga0495645_0032133
1276 Ga0495645_0237061
1277 Ga0495667_0046581
1278 Ga0495667_0221104
1279 Ga0495635_0122700
1280 Ga0495659_0116030
1281 Ga0495599_0080957
1282 Ga0495599_0328664
1283 Ga0495623_0244490
1284 Ga0495647_0005521
1285 Ga0495613_0000718
1286 Ga0495613_0139241
1287 Ga0495613_0224711
1288 Ga0495600_0108327
1289 Ga0495581_0164890
1290 Ga0495604_0425207
1291 Ga0495674_0036197
1292 Ga0495674_0307449
1293 Ga0495674_0339320
1294 Ga0495674_0347563
1295 Ga0495674_0677302
1296 Ga0495675_0089861
1297 Ga0495684_0000048
1298 Ga0496101_0002815
1299 Ga0496102_0096581
1300 Ga0496104_0009724
1301 Ga0496104_0590983
1302 Ga0496105_0007544
1303 Ga0496105_0076168
1304 Ga0496105_0513555
1305 Ga0496106_0054938
1306 Ga0496106_0098808
1307 Ga0496106_0171523
1308 Ga0496106_0488561
1309 Ga0496107_0101999
1310 Ga0496107_0288648
1311 Ga0496108_0018661
1312 Ga0496108_0335744
1313 Ga0496109_0140404
1314 Ga0496110_0206422
1315 Ga0496112_0013681
1316 Ga0496112_0199745
1317 Ga0496112_0245592
1318 Ga0496113_0036076
1319 Ga0496113_0170435
1320 Ga0496114_0005516
1321 Ga0496114_0065691
1322 Ga0496114_0094437
1323 Ga0496114_0095254
1324 Ga0496114_0109836
1325 Ga0496114_0260964
1326 Ga0501033_0441466
1327 Ga0501034_0141883
1328 Ga0501036_0486498
1329 Ga0501038_0293165
1330 Ga0501039_0238442
1331 Ga0501047_0167305
1332 Ga0501073_0206421
1333 Ga0501075_0023531
1334 Ga0501075_0027832
1335 Ga0501076_0014037
1336 Ga0501076_0105339
1337 Ga0501076_0186750
1338 Ga0501249_007717
1339 Ga0501225_0018189
1340 Ga0501080_0397023
1341 Ga0501081_0108120
1342 Ga0501268_040928
1343 Ga0501283_006643
1344 Ga0501283_018676
1345 Ga0501044_0008350
1346 Ga0501045_0068770
1347 nmdc:mga05p37_127892_c1
1348 nmdc:mga05p37_139109_c1
1349 nmdc:mga05p37_147929_c1
1350 nmdc:mga05p37_166893_c1
1351 nmdc:mga05p37_242913_c1
1352 nmdc:mga05p37_251732_c1
1353 nmdc:mga05p37_32763_c1
1354 nmdc:mga05p37_42046_c1
1355 nmdc:mga05p37_60049_c1
1356 nmdc:mga05p37_72249_c1
1357 nmdc:mga05p37_80475_c1
1358 nmdc:mga05p37_83865_c1
1359 nmdc:mga05p37_90500_c1
1360 nmdc:mga05p37_90710_c1
1361 nmdc:mga09592_202278_c1
1362 nmdc:mga09592_37318_c1
1363 nmdc:mga09592_39556_c1
1364 nmdc:mga0qj67_32045_c1
1365 nmdc:mga0qj67_368066_c1
1366 nmdc:mga0qj67_5327_c1
1367 nmdc:mga06r32_20127_c1
1368 nmdc:mga06r32_331212_c1
1369 nmdc:mga06r32_38502_c1
1370 nmdc:mga08y16_1071_c1
1371 nmdc:mga08y16_26975_c1
1372 nmdc:mga08y16_38982_c1
1373 nmdc:mga08y16_47289_c1
1374 nmdc:mga0n895_104681_c1
1375 nmdc:mga0n895_121214_c1
1376 nmdc:mga0n895_268582_c1
1377 nmdc:mga0n895_339359_c1
1378 nmdc:mga0n895_372_c1
1379 nmdc:mga0n895_385273_c1
1380 nmdc:mga0n895_45763_c1
1381 nmdc:mga0n895_680584_c1
1382 nmdc:mga0n895_720_c1
1383 nmdc:mga0rr50_10832_c1
1384 nmdc:mga0rr50_1320_c1
1385 nmdc:mga0rr50_2869_c1
1386 nmdc:mga0rr50_29597_c1
1387 nmdc:mga0rr50_365464_c1
1388 nmdc:mga0rr50_616164_c1
1389 nmdc:mga0rr50_70840_c1
1390 nmdc:mga0rr50_77_c1
1391 nmdc:mga08x19_23270_c1
1392 nmdc:mga08x19_276160_c1
1393 nmdc:mga08x19_837_c1
1394 nmdc:mga0a205_154052_c1
1395 nmdc:mga0a205_24060_c1
1396 nmdc:mga0a205_276362_c1
1397 nmdc:mga0a205_280666_c1
1398 nmdc:mga0a205_30294_c1
1399 nmdc:mga0a205_312_c1
1400 nmdc:mga0a205_376039_c1
1401 nmdc:mga0a205_4541_c1
1402 nmdc:mga0a205_50058_c1
1403 nmdc:mga0a205_71064_c1
1404 Ga0495601_0006677
1405 Ga0495601_0007001
1406 Ga0495601_0042176
1407 Ga0495601_0160924
1408 Ga0495595_0155745
1409 Ga0495595_0177645
1410 Ga0495619_0026256
1411 Ga0495619_0136316
1412 Ga0495619_0297959
1413 Ga0495619_0313538
1414 Ga0495619_0350377
1415 Ga0501084_0036556
1416 Ga0501084_0261405
1417 Ga0501084_0736088
1418 Ga0590074_000865
1419 Ga0590074_003842
1420 Ga0590075_000213
1421 Ga0590075_013902
1422 Ga0590077_000088
1423 Ga0590077_003150
1424 Ga0590077_010402
1425 Ga0587073_0026727
1426 Ga0587083_0027114
1427 Ga0501082_0048076
1428 Ga0530510_0265151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

214

276

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jxg-assembly2.cif.gz_B the 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge 0.8601 92 174
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.8591 176 232
7pcy-assembly1.cif.gz_A the crystal structure of plastocyanin from a green alga, enteromorpha prolifera 0.8527 92 174
1byp-assembly1.cif.gz_A e43k,d44k double mutant plastocyanin from silene 0.8524 92 174
2cj3-assembly2.cif.gz_B crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis 0.8499 90 174
ID Description Score Start End Superfamily
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8821 176 231 2.60.40.1120
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8669 177 232 2.60.40.1120
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8521 179 237 2.60.40.1120
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8499 90 174 2.60.40.420
af_Q54I77_467_541_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8314 176 229 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A2V8HEZ0-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9977 76 231 GO:0030246
AF-A0A7W1CAV1-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9968 103 231 GO:0004180
AF-A0A1Q7H432-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9895 14 237
AF-A0A7W1CAV1-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9891 103 231 GO:0004180
AF-A0A2V8HEZ0-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.985 76 231 GO:0030246

Map