F476649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 385 | 631 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10002750|Ga0075366_100027507 |
| Length | 313 |
| Sequence | MRTVPDDIESRVGVCAHDIGLRGAGSETARTALQANGRALPAVTRHAHEPMPILDSLRPTPGLRVLVTAGAGGIGAAVARAFHEAGSRVHVCDIDRSALDRMTSEIPGITGSMADASIAADVDLVFDDVQGTLGGLDVLVSNAGISGPTGPIEAIDGTGWERTIAVNLHSQYYFARRAVPLLKQSTAAPCLIAMGSVAGRLGYAFRTPYASSKWAIVGMMKSLAIELGPHGIRVNAILPGTVEGERMRAVIAARAQSIGIDVDAMRQQYLNRISLRRMVGSDDVAALALFLCSPGARNLTGQAISVDGNVEYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 2 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 8 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 9 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 10 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 11 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 12 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 13 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 14 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 15 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 16 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 17 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 18 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 19 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 20 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 21 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 22 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 23 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 24 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 25 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 26 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 27 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 28 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 29 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 30 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 31 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 32 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 33 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 34 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 35 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 36 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 37 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 38 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 39 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 40 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 41 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 42 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 43 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 44 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 45 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 46 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 47 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 48 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 49 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 50 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 51 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 52 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 53 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 54 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 55 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 56 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 57 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 58 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 59 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 60 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 61 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 62 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 63 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 64 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 65 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 66 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 67 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 68 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 69 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 72 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 73 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 74 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 80 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 81 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 208 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 209 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 213 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 363 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 366 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 371 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 374 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 377 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 378 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 379 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 380 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 381 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 382 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 383 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 384 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 385 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.86 |
| Metatranscriptomes | 0 |
| Isolates | 11.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.16 |
| Nodule | 1.97 |
| Rhizoplane | 5.22 |
| Rhizosphere | 72.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001284 | 3300001989 | Bacteria | 9444 |
| 2 | JGI25156J39149_1000693 | 3300002705 | Bacteria | 18068 |
| 3 | JGI25162J39368_1000085 | 3300002737 | Bacteria | 107722 |
| 4 | JGI25163J39215_1000077 | 3300002771 | Bacteria | 43838 |
| 5 | JGI25164J39214_1000063 | 3300002772 | Bacteria | 107722 |
| 6 | JGI25152J39213_1001586 | 3300002773 | Bacteria | 9538 |
| 7 | JGI25151J46595_10000626 | 3300003187 | Bacteria | 30738 |
| 8 | JGI25165J46597_1000160 | 3300003214 | Bacteria | 107722 |
| 9 | JGI25153J46596_10000537 | 3300003215 | Bacteria | 23734 |
| 10 | rootH2_10053359 | 3300003320 | Bacteria | 5584 |
| 11 | rootH2_10208268 | 3300003320 | Bacteria | 1106 |
| 12 | rootH1_10015346 | 3300003316 | Bacteria | 8043 |
| 13 | rootH1_10015346 | 3300003323 | Bacteria | 2240 |
| 14 | rootH1_10024313 | 3300003323 | Bacteria | 4312 |
| 15 | rootH1_10082241 | 3300003323 | Bacteria | 4962 |
| 16 | Ga0055538_1000099 | 3300003751 | Bacteria | 70627 |
| 17 | Ga0055539_1000147 | 3300003752 | Bacteria | 70627 |
| 18 | Ga0055533_1000151 | 3300003756 | Bacteria | 70627 |
| 19 | Ga0055532_1000108 | 3300003758 | Bacteria | 88720 |
| 20 | Ga0055525_1000199 | 3300003759 | Bacteria | 70627 |
| 21 | Ga0055535_1005776 | 3300003761 | Bacteria | 2637 |
| 22 | Ga0055526_1000296 | 3300003771 | Bacteria | 41724 |
| 23 | Ga0055541_1000099 | 3300003841 | Bacteria | 70627 |
| 24 | Ga0065714_10003563 | 3300005288 | Bacteria | 9659 |
| 25 | Ga0065714_10005194 | 3300005288 | Bacteria | 4691 |
| 26 | Ga0065714_10075280 | 3300005288 | Bacteria | 2924 |
| 27 | Ga0070658_10031491 | 3300005327 | Bacteria | 4259 |
| 28 | Ga0070670_100006151 | 3300005331 | Bacteria | 10147 |
| 29 | Ga0068868_100000303 | 3300005338 | Bacteria | 33136 |
| 30 | Ga0070661_100000081 | 3300005344 | Bacteria | 75382 |
| 31 | Ga0070661_100028695 | 3300005344 | Bacteria | 4015 |
| 32 | Ga0070669_100002322 | 3300005353 | Bacteria | 13763 |
| 33 | Ga0070669_100036015 | 3300005353 | Bacteria | 3585 |
| 34 | Ga0070671_100207179 | 3300005355 | Bacteria | 1663 |
| 35 | Ga0070714_100293439 | 3300005435 | Bacteria | 1514 |
| 36 | Ga0070714_100442186 | 3300005435 | Bacteria | 1234 |
| 37 | Ga0070700_100325297 | 3300005441 | Unclassified | 1131 |
| 38 | Ga0070662_100000351 | 3300005457 | Bacteria | 27650 |
| 39 | Ga0070662_100003486 | 3300005457 | Bacteria | 9810 |
| 40 | Ga0070662_100232563 | 3300005457 | Bacteria | 1475 |
| 41 | Ga0070681_10303405 | 3300005458 | Bacteria | 1506 |
| 42 | Ga0070684_100018459 | 3300005535 | Bacteria | 5746 |
| 43 | Ga0068853_100025298 | 3300005539 | Bacteria | 4981 |
| 44 | Ga0068853_100062262 | 3300005539 | Bacteria | 3228 |
| 45 | Ga0068853_100239588 | 3300005539 | Bacteria | 1662 |
| 46 | Ga0070665_100018543 | 3300005548 | Bacteria | 6974 |
| 47 | Ga0068855_100002732 | 3300005563 | Bacteria | 21749 |
| 48 | Ga0070664_100000139 | 3300005564 | Bacteria | 49134 |
| 49 | Ga0070664_100004768 | 3300005564 | Bacteria | 10866 |
| 50 | Ga0070664_100264008 | 3300005564 | Bacteria | 1549 |
| 51 | Ga0068857_100013031 | 3300005577 | Bacteria | 7244 |
| 52 | Ga0068854_100009910 | 3300005578 | Bacteria | 6164 |
| 53 | Ga0068856_100031354 | 3300005614 | Bacteria | 5200 |
| 54 | Ga0068852_100006625 | 3300005616 | Bacteria | 8392 |
| 55 | Ga0068852_100020085 | 3300005616 | Bacteria | 5306 |
| 56 | Ga0068851_10000153 | 3300005834 | Bacteria | 36772 |
| 57 | Ga0068851_10021353 | 3300005834 | Bacteria | 3143 |
| 58 | Ga0068863_100061145 | 3300005841 | Bacteria | 3561 |
| 59 | Ga0068860_100053043 | 3300005843 | Bacteria | 3855 |
| 60 | Ga0068860_100136359 | 3300005843 | Bacteria | 2357 |
| 61 | Ga0070717_10091481 | 3300006028 | Bacteria | 2569 |
| 62 | Ga0075364_10131376 | 3300006051 | Bacteria | 1681 |
| 63 | Ga0075432_10000690 | 3300006058 | Bacteria | 10388 |
| 64 | Ga0075366_10002750 | 3300006195 | Bacteria | 9093 |
| 65 | Ga0075366_10085613 | 3300006195 | Bacteria | 1885 |
| 66 | Ga0075370_10007960 | 3300006353 | Bacteria | 5430 |
| 67 | Ga0105251_10000637 | 3300009011 | Bacteria | 32170 |
| 68 | Ga0105251_10007326 | 3300009011 | Bacteria | 6822 |
| 69 | Ga0105251_10011398 | 3300009011 | Bacteria | 5081 |
| 70 | Ga0105244_10001072 | 3300009036 | Bacteria | 22803 |
| 71 | Ga0105244_10001073 | 3300009036 | Bacteria | 22794 |
| 72 | Ga0105244_10002639 | 3300009036 | Bacteria | 13442 |
| 73 | Ga0105244_10040282 | 3300009036 | Bacteria | 2427 |
| 74 | Ga0105250_10043374 | 3300009092 | Bacteria | 1802 |
| 75 | Ga0105240_10005332 | 3300009093 | Bacteria | 19184 |
| 76 | Ga0105240_10422434 | 3300009093 | Bacteria | 1497 |
| 77 | Ga0105243_10000480 | 3300009148 | Bacteria | 40986 |
| 78 | Ga0105242_10000964 | 3300009176 | Bacteria | 22474 |
| 79 | Ga0105237_10153001 | 3300009545 | Bacteria | 2303 |
| 80 | Ga0105238_10003764 | 3300009551 | Bacteria | 15071 |
| 81 | Ga0105238_10020373 | 3300009551 | Bacteria | 6751 |
| 82 | Ga0105249_11029158 | 3300009553 | Bacteria | 893 |
| 83 | Ga0105246_10012195 | 3300011119 | Bacteria | 5356 |
| 84 | Ga0157373_10010062 | 3300013100 | Bacteria | 6969 |
| 85 | Ga0157373_10266881 | 3300013100 | Bacteria | 1212 |
| 86 | Ga0157371_10000115 | 3300013102 | Bacteria | 122316 |
| 87 | Ga0157371_10000788 | 3300013102 | Bacteria | 36497 |
| 88 | Ga0157371_10129583 | 3300013102 | Bacteria | 1794 |
| 89 | Ga0157371_10215647 | 3300013102 | Bacteria | 1378 |
| 90 | Ga0157370_10002111 | 3300013104 | Bacteria | 24281 |
| 91 | Ga0157370_10113715 | 3300013104 | Bacteria | 2529 |
| 92 | Ga0157370_10165503 | 3300013104 | Bacteria | 2056 |
| 93 | Ga0157369_10000562 | 3300013105 | Bacteria | 48790 |
| 94 | Ga0157369_10001753 | 3300013105 | Bacteria | 26296 |
| 95 | Ga0157369_10514757 | 3300013105 | Bacteria | 1238 |
| 96 | Ga0157374_10211008 | 3300013296 | Bacteria | 1904 |
| 97 | Ga0163162_10000095 | 3300013306 | Bacteria | 80739 |
| 98 | Ga0157372_10006766 | 3300013307 | Bacteria | 12188 |
| 99 | Ga0157372_10164808 | 3300013307 | Bacteria | 2563 |
| 100 | Ga0157375_10001188 | 3300013308 | Bacteria | 22474 |
| 101 | Ga0157375_10006323 | 3300013308 | Bacteria | 10319 |
| 102 | Ga0182008_10000352 | 3300014497 | Bacteria | 35836 |
| 103 | Ga0182008_10002951 | 3300014497 | Bacteria | 10470 |
| 104 | Ga0182008_10037244 | 3300014497 | Bacteria | 2433 |
| 105 | Ga0182006_1000389 | 3300015261 | Bacteria | 36185 |
| 106 | Ga0182007_10004403 | 3300015262 | Bacteria | 6388 |
| 107 | Ga0182005_1000055 | 3300015265 | Bacteria | 111824 |
| 108 | Ga0182005_1008262 | 3300015265 | Bacteria | 3075 |
| 109 | Ga0163161_10015507 | 3300017792 | Bacteria | 5313 |
| 110 | Ga0209760_100039 | 3300025207 | Bacteria | 118977 |
| 111 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 112 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 113 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 114 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 115 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 116 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 117 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 118 | Ga0209437_103142 | 3300025233 | Bacteria | 3035 |
| 119 | Ga0209258_100364 | 3300025242 | Bacteria | 60333 |
| 120 | Ga0207425_1000259 | 3300025245 | Bacteria | 39126 |
| 121 | Ga0209646_1000199 | 3300025246 | Bacteria | 71982 |
| 122 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 123 | Ga0209759_1000033 | 3300025256 | Bacteria | 276117 |
| 124 | Ga0209129_1000175 | 3300025258 | Bacteria | 93817 |
| 125 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 126 | Ga0209233_1024030 | 3300025261 | Bacteria | 1532 |
| 127 | Ga0209025_1004094 | 3300025294 | Bacteria | 13003 |
| 128 | Ga0209564_1000136 | 3300025295 | Bacteria | 185198 |
| 129 | Ga0209758_1000275 | 3300025297 | Bacteria | 102404 |
| 130 | Ga0209050_1000247 | 3300025298 | Bacteria | 116514 |
| 131 | Ga0207656_10000074 | 3300025321 | Bacteria | 36744 |
| 132 | Ga0207656_10043847 | 3300025321 | Bacteria | 1909 |
| 133 | Ga0207655_1000250 | 3300025728 | Bacteria | 86806 |
| 134 | Ga0207655_1000325 | 3300025728 | Bacteria | 70385 |
| 135 | Ga0207655_1001605 | 3300025728 | Bacteria | 20188 |
| 136 | Ga0207655_1032026 | 3300025728 | Bacteria | 2410 |
| 137 | Ga0207713_1000819 | 3300025735 | Bacteria | 28789 |
| 138 | Ga0207713_1010502 | 3300025735 | Bacteria | 5119 |
| 139 | Ga0207713_1011993 | 3300025735 | Bacteria | 4667 |
| 140 | Ga0207695_10004475 | 3300025913 | Bacteria | 19039 |
| 141 | Ga0207671_10000566 | 3300025914 | Bacteria | 49574 |
| 142 | Ga0207657_10022124 | 3300025919 | Bacteria | 5965 |
| 143 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 144 | Ga0207649_10006870 | 3300025920 | Bacteria | 6183 |
| 145 | Ga0207681_10003046 | 3300025923 | Bacteria | 10536 |
| 146 | Ga0207681_10041536 | 3300025923 | Bacteria | 3067 |
| 147 | Ga0207694_10232014 | 3300025924 | Bacteria | 1507 |
| 148 | Ga0207650_10000621 | 3300025925 | Bacteria | 28378 |
| 149 | Ga0207644_10051830 | 3300025931 | Bacteria | 2947 |
| 150 | Ga0207706_10000127 | 3300025933 | Bacteria | 81664 |
| 151 | Ga0207686_10003977 | 3300025934 | Bacteria | 7932 |
| 152 | Ga0207709_10001023 | 3300025935 | Bacteria | 20702 |
| 153 | Ga0207661_10018345 | 3300025944 | Bacteria | 5199 |
| 154 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 155 | Ga0207679_10010572 | 3300025945 | Bacteria | 5946 |
| 156 | Ga0207667_10004150 | 3300025949 | Bacteria | 17803 |
| 157 | Ga0207667_10397062 | 3300025949 | Bacteria | 1404 |
| 158 | Ga0207640_10009388 | 3300025981 | Bacteria | 5477 |
| 159 | Ga0207640_10018539 | 3300025981 | Bacteria | 4092 |
| 160 | Ga0207639_10011324 | 3300026041 | Bacteria | 6191 |
| 161 | Ga0207639_10121482 | 3300026041 | Bacteria | 2147 |
| 162 | Ga0207702_10016633 | 3300026078 | Bacteria | 6087 |
| 163 | Ga0207641_10116066 | 3300026088 | Bacteria | 2381 |
| 164 | Ga0207674_10033462 | 3300026116 | Bacteria | 5381 |
| 165 | Ga0207683_10582240 | 3300026121 | Bacteria | 1035 |
| 166 | Ga0207698_10073644 | 3300026142 | Bacteria | 2720 |
| 167 | Ga0209970_1000492 | 3300027614 | Bacteria | 6760 |
| 168 | Ga0207428_10002286 | 3300027907 | Bacteria | 19238 |
| 169 | Ga0268266_10054139 | 3300028379 | Bacteria | 3448 |
| 170 | Ga0268265_10024597 | 3300028380 | Bacteria | 4263 |
| 171 | Ga0307517_10289765 | 3300028786 | Bacteria | 926 |
| 172 | Ga0265338_10030476 | 3300028800 | Bacteria | 5313 |
| 173 | Ga0265328_10063747 | 3300031239 | Bacteria | 1354 |
| 174 | Ga0265327_10000266 | 3300031251 | Bacteria | 103308 |
| 175 | Ga0265327_10001259 | 3300031251 | Bacteria | 33543 |
| 176 | Ga0307408_100169281 | 3300031548 | Bacteria | 1743 |
| 177 | Ga0307516_10013066 | 3300031730 | Bacteria | 8879 |
| 178 | Ga0307412_10016220 | 3300031911 | Bacteria | 4432 |
| 179 | Ga0307412_10178095 | 3300031911 | Bacteria | 1596 |
| 180 | Ga0373954_0007214 | 3300035118 | Bacteria | 4855 |
| 181 | Ga0373956_0167976 | 3300035119 | Bacteria | 1035 |
| 182 | Ga0373924_0137850 | 3300035410 | Bacteria | 1063 |
| 183 | Ga0373935_0343183 | 3300035692 | Bacteria | 1063 |
| 184 | Ga0373937_0000503 | 3300036401 | Bacteria | 35778 |
| 185 | Ga0373925_0040516 | 3300037068 | Bacteria | 3449 |
| 186 | Ga0395899_0051379 | 3300037312 | Bacteria | 3059 |
| 187 | Ga0395899_0170161 | 3300037312 | Bacteria | 1534 |
| 188 | Ga0395900_0014754 | 3300037418 | Bacteria | 7964 |
| 189 | Ga0395900_0356133 | 3300037418 | Bacteria | 1436 |
| 190 | Ga0395900_0690779 | 3300037418 | Bacteria | 954 |
| 191 | Ga0395898_0517389 | 3300037466 | Bacteria | 1134 |
| 192 | Ga0395898_0848856 | 3300037466 | Bacteria | 852 |
| 193 | Ga0395905_0018276 | 3300037471 | Bacteria | 6656 |
| 194 | Ga0395905_0083477 | 3300037471 | Bacteria | 2993 |
| 195 | Ga0395905_0470621 | 3300037471 | Bacteria | 1155 |
| 196 | Ga0436364_1500992 | 3300037853 | Bacteria | 965 |
| 197 | Ga0395901_0169177 | 3300038443 | Bacteria | 2293 |
| 198 | Ga0395901_0255426 | 3300038443 | Bacteria | 1825 |
| 199 | Ga0395901_0769172 | 3300038443 | Bacteria | 954 |
| 200 | Ga0436365_0662455 | 3300039437 | Bacteria | 1050 |
| 201 | Ga0439447_000608 | 3300041407 | Bacteria | 13329 |
| 202 | Ga0439447_033219 | 3300041407 | Bacteria | 1287 |
| 203 | Ga0439465_0096135 | 3300041413 | Bacteria | 1018 |
| 204 | Ga0451789_1213403 | 3300041443 | Bacteria | 2476 |
| 205 | Ga0451798_0026135 | 3300041458 | Bacteria | 1541 |
| 206 | Ga0439432_046290 | 3300042006 | Bacteria | 1367 |
| 207 | Ga0439452_000329 | 3300042010 | Bacteria | 29549 |
| 208 | Ga0450902_000221 | 3300042137 | Bacteria | 6741 |
| 209 | Ga0466969_0055611 | 3300044656 | Bacteria | 1935 |
| 210 | Ga0466966_0010921 | 3300044684 | Bacteria | 6031 |
| 211 | Ga0466961_0135943 | 3300044693 | Bacteria | 1540 |
| 212 | Ga0466963_0053293 | 3300044694 | Bacteria | 2686 |
| 213 | Ga0466968_0000406 | 3300044735 | Bacteria | 14242 |
| 214 | Ga0466959_0019340 | 3300045049 | Bacteria | 5008 |
| 215 | Ga0466967_0010897 | 3300045976 | Bacteria | 6850 |
| 216 | Ga0466967_0155763 | 3300045976 | Bacteria | 2140 |
| 217 | Ga0495617_001372 | 3300046452 | Bacteria | 10756 |
| 218 | Ga0495617_017418 | 3300046452 | Bacteria | 2427 |
| 219 | Ga0495627_000031 | 3300046453 | Bacteria | 226981 |
| 220 | Ga0495627_006756 | 3300046453 | Bacteria | 4465 |
| 221 | Ga0495592_0093928 | 3300046454 | Bacteria | 2147 |
| 222 | Ga0495603_0060554 | 3300046455 | Bacteria | 2237 |
| 223 | Ga0495590_0005411 | 3300046457 | Bacteria | 5069 |
| 224 | Ga0495590_0100824 | 3300046457 | Bacteria | 1025 |
| 225 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 226 | Ga0495591_000900 | 3300046458 | Bacteria | 20775 |
| 227 | Ga0495591_001235 | 3300046458 | Bacteria | 16515 |
| 228 | Ga0495591_002447 | 3300046458 | Bacteria | 10325 |
| 229 | Ga0495591_003161 | 3300046458 | Bacteria | 8690 |
| 230 | Ga0495629_0000160 | 3300046459 | Bacteria | 59328 |
| 231 | Ga0495629_0001997 | 3300046459 | Bacteria | 15850 |
| 232 | Ga0495629_0013424 | 3300046459 | Bacteria | 5909 |
| 233 | Ga0495638_0001043 | 3300046460 | Bacteria | 27399 |
| 234 | Ga0495638_0003860 | 3300046460 | Bacteria | 11627 |
| 235 | Ga0495638_0014085 | 3300046460 | Bacteria | 5416 |
| 236 | Ga0495638_0034890 | 3300046460 | Bacteria | 3210 |
| 237 | Ga0495638_0159871 | 3300046460 | Bacteria | 1300 |
| 238 | Ga0495638_0182939 | 3300046460 | Bacteria | 1194 |
| 239 | Ga0495651_0077070 | 3300046462 | Bacteria | 2524 |
| 240 | Ga0495653_0000434 | 3300046463 | Bacteria | 32947 |
| 241 | Ga0495653_0001768 | 3300046463 | Bacteria | 17039 |
| 242 | Ga0495653_0010954 | 3300046463 | Bacteria | 7425 |
| 243 | Ga0495653_0101965 | 3300046463 | Bacteria | 2078 |
| 244 | Ga0495650_0000405 | 3300046471 | Bacteria | 71148 |
| 245 | Ga0495650_0001089 | 3300046471 | Bacteria | 29820 |
| 246 | Ga0495650_0002844 | 3300046471 | Bacteria | 13245 |
| 247 | Ga0495650_0003246 | 3300046471 | Bacteria | 12065 |
| 248 | Ga0495650_0062890 | 3300046471 | Bacteria | 1482 |
| 249 | Ga0495580_0087310 | 3300046472 | Bacteria | 2172 |
| 250 | Ga0495582_0051614 | 3300046473 | Bacteria | 2267 |
| 251 | Ga0495582_0101061 | 3300046473 | Bacteria | 1614 |
| 252 | Ga0495605_0000219 | 3300046474 | Bacteria | 70638 |
| 253 | Ga0495605_0007400 | 3300046474 | Bacteria | 6231 |
| 254 | Ga0495605_0022199 | 3300046474 | Bacteria | 3354 |
| 255 | Ga0495605_0097769 | 3300046474 | Bacteria | 1352 |
| 256 | Ga0495639_0046860 | 3300046475 | Bacteria | 1957 |
| 257 | Ga0495639_0050595 | 3300046475 | Bacteria | 1888 |
| 258 | Ga0495662_0124902 | 3300046476 | Bacteria | 1264 |
| 259 | Ga0495664_0037859 | 3300046477 | Bacteria | 2847 |
| 260 | Ga0495584_0004304 | 3300046491 | Bacteria | 7674 |
| 261 | Ga0495584_0034167 | 3300046491 | Bacteria | 2573 |
| 262 | Ga0495585_0000551 | 3300046492 | Bacteria | 35441 |
| 263 | Ga0495585_0002544 | 3300046492 | Bacteria | 12938 |
| 264 | Ga0495585_0008977 | 3300046492 | Bacteria | 6024 |
| 265 | Ga0495585_0020021 | 3300046492 | Bacteria | 3849 |
| 266 | Ga0495596_0000010 | 3300046500 | Bacteria | 145028 |
| 267 | Ga0495596_0000028 | 3300046500 | Bacteria | 103710 |
| 268 | Ga0495596_0000132 | 3300046500 | Bacteria | 51646 |
| 269 | Ga0495596_0043654 | 3300046500 | Bacteria | 1767 |
| 270 | Ga0495596_0075564 | 3300046500 | Bacteria | 1308 |
| 271 | Ga0495607_0003360 | 3300046501 | Bacteria | 12271 |
| 272 | Ga0495607_0022265 | 3300046501 | Bacteria | 3981 |
| 273 | Ga0495607_0025790 | 3300046501 | Bacteria | 3653 |
| 274 | Ga0495607_0027353 | 3300046501 | Bacteria | 3527 |
| 275 | Ga0495607_0169027 | 3300046501 | Bacteria | 1105 |
| 276 | Ga0495583_0000151 | 3300046506 | Bacteria | 117627 |
| 277 | Ga0495583_0000334 | 3300046506 | Bacteria | 74547 |
| 278 | Ga0495583_0002225 | 3300046506 | Bacteria | 17145 |
| 279 | Ga0495583_0003405 | 3300046506 | Bacteria | 12156 |
| 280 | Ga0495583_0003426 | 3300046506 | Bacteria | 12088 |
| 281 | Ga0495606_0001711 | 3300046507 | Bacteria | 28286 |
| 282 | Ga0495606_0002465 | 3300046507 | Bacteria | 21444 |
| 283 | Ga0495606_0007586 | 3300046507 | Bacteria | 9658 |
| 284 | Ga0495606_0024635 | 3300046507 | Bacteria | 4330 |
| 285 | Ga0495606_0027422 | 3300046507 | Bacteria | 4040 |
| 286 | Ga0495606_0116002 | 3300046507 | Bacteria | 1609 |
| 287 | Ga0495606_0123203 | 3300046507 | Bacteria | 1549 |
| 288 | Ga0495608_0000956 | 3300046511 | Bacteria | 20362 |
| 289 | Ga0495608_0020916 | 3300046511 | Bacteria | 4494 |
| 290 | Ga0495610_0000287 | 3300046512 | Bacteria | 52829 |
| 291 | Ga0495610_0003015 | 3300046512 | Bacteria | 13495 |
| 292 | Ga0495610_0012735 | 3300046512 | Bacteria | 5038 |
| 293 | Ga0495610_0085625 | 3300046512 | Bacteria | 1437 |
| 294 | Ga0495610_0121672 | 3300046512 | Bacteria | 1143 |
| 295 | Ga0495616_0221907 | 3300046513 | Unclassified | 822 |
| 296 | Ga0495618_0001015 | 3300046514 | Bacteria | 19228 |
| 297 | Ga0495618_0005918 | 3300046514 | Bacteria | 7430 |
| 298 | Ga0495620_0004145 | 3300046515 | Bacteria | 8225 |
| 299 | Ga0495620_0005836 | 3300046515 | Bacteria | 6831 |
| 300 | Ga0495620_0031070 | 3300046515 | Bacteria | 2450 |
| 301 | Ga0495620_0097742 | 3300046515 | Bacteria | 1173 |
| 302 | Ga0495628_0005536 | 3300046516 | Bacteria | 11055 |
| 303 | Ga0495628_0156031 | 3300046516 | Bacteria | 1736 |
| 304 | Ga0495630_0010794 | 3300046517 | Bacteria | 6593 |
| 305 | Ga0495630_0024678 | 3300046517 | Bacteria | 4443 |
| 306 | Ga0495630_0083747 | 3300046517 | Bacteria | 2408 |
| 307 | Ga0495631_0000117 | 3300046518 | Bacteria | 52920 |
| 308 | Ga0495631_0016675 | 3300046518 | Bacteria | 3495 |
| 309 | Ga0495631_0177538 | 3300046518 | Unclassified | 913 |
| 310 | Ga0495632_0000102 | 3300046519 | Bacteria | 87253 |
| 311 | Ga0495632_0000661 | 3300046519 | Bacteria | 31618 |
| 312 | Ga0495632_0000950 | 3300046519 | Bacteria | 25312 |
| 313 | Ga0495632_0001670 | 3300046519 | Bacteria | 18179 |
| 314 | Ga0495632_0003923 | 3300046519 | Bacteria | 10332 |
| 315 | Ga0495632_0004390 | 3300046519 | Bacteria | 9588 |
| 316 | Ga0495632_0014538 | 3300046519 | Bacteria | 4448 |
| 317 | Ga0495632_0014996 | 3300046519 | Bacteria | 4361 |
| 318 | Ga0495632_0019088 | 3300046519 | Bacteria | 3742 |
| 319 | Ga0495632_0050331 | 3300046519 | Bacteria | 2054 |
| 320 | Ga0495637_0000074 | 3300046520 | Bacteria | 80233 |
| 321 | Ga0495637_0000082 | 3300046520 | Bacteria | 73771 |
| 322 | Ga0495637_0000476 | 3300046520 | Bacteria | 29269 |
| 323 | Ga0495637_0000597 | 3300046520 | Bacteria | 25843 |
| 324 | Ga0495637_0009926 | 3300046520 | Bacteria | 4631 |
| 325 | Ga0495637_0053360 | 3300046520 | Bacteria | 1683 |
| 326 | Ga0495637_0076070 | 3300046520 | Bacteria | 1345 |
| 327 | Ga0495643_0001044 | 3300046522 | Bacteria | 28024 |
| 328 | Ga0495643_0020348 | 3300046522 | Bacteria | 3826 |
| 329 | Ga0495643_0049734 | 3300046522 | Bacteria | 2259 |
| 330 | Ga0495643_0166629 | 3300046522 | Bacteria | 1080 |
| 331 | Ga0495644_0005721 | 3300046523 | Bacteria | 4852 |
| 332 | Ga0495644_0012548 | 3300046523 | Bacteria | 3257 |
| 333 | Ga0495644_0026090 | 3300046523 | Bacteria | 2218 |
| 334 | Ga0495648_0000093 | 3300046524 | Bacteria | 111381 |
| 335 | Ga0495648_0001459 | 3300046524 | Bacteria | 23132 |
| 336 | Ga0495648_0006203 | 3300046524 | Bacteria | 9790 |
| 337 | Ga0495648_0008616 | 3300046524 | Bacteria | 8000 |
| 338 | Ga0495666_0004392 | 3300046526 | Bacteria | 7126 |
| 339 | Ga0495642_0001229 | 3300046528 | Bacteria | 11776 |
| 340 | Ga0495652_0002282 | 3300046529 | Bacteria | 20011 |
| 341 | Ga0495652_0003170 | 3300046529 | Bacteria | 16394 |
| 342 | Ga0495654_0000352 | 3300046530 | Bacteria | 39778 |
| 343 | Ga0495654_0000462 | 3300046530 | Bacteria | 33930 |
| 344 | Ga0495654_0001145 | 3300046530 | Bacteria | 18998 |
| 345 | Ga0495654_0002780 | 3300046530 | Bacteria | 11029 |
| 346 | Ga0495654_0009697 | 3300046530 | Bacteria | 5271 |
| 347 | Ga0495654_0047522 | 3300046530 | Bacteria | 2109 |
| 348 | Ga0495654_0071568 | 3300046530 | Bacteria | 1643 |
| 349 | Ga0495665_0006976 | 3300046531 | Bacteria | 6093 |
| 350 | Ga0495640_0003936 | 3300046533 | Bacteria | 11896 |
| 351 | Ga0495586_0047858 | 3300046535 | Bacteria | 2309 |
| 352 | Ga0495586_0118789 | 3300046535 | Bacteria | 1476 |
| 353 | Ga0495586_0134457 | 3300046535 | Bacteria | 1385 |
| 354 | Ga0495587_0000332 | 3300046536 | Bacteria | 33763 |
| 355 | Ga0495587_0092093 | 3300046536 | Bacteria | 1750 |
| 356 | Ga0495609_0000034 | 3300046538 | Bacteria | 201125 |
| 357 | Ga0495609_0000043 | 3300046538 | Bacteria | 166590 |
| 358 | Ga0495609_0000217 | 3300046538 | Bacteria | 57243 |
| 359 | Ga0495597_0004246 | 3300046542 | Bacteria | 7925 |
| 360 | Ga0495597_0008705 | 3300046542 | Bacteria | 5069 |
| 361 | Ga0495597_0012908 | 3300046542 | Bacteria | 4017 |
| 362 | Ga0495597_0017524 | 3300046542 | Bacteria | 3368 |
| 363 | Ga0495597_0017790 | 3300046542 | Bacteria | 3340 |
| 364 | Ga0495645_0000466 | 3300046543 | Bacteria | 27957 |
| 365 | Ga0495645_0020662 | 3300046543 | Bacteria | 4754 |
| 366 | Ga0495645_0032404 | 3300046543 | Bacteria | 3812 |
| 367 | Ga0495622_0000017 | 3300046557 | Bacteria | 176313 |
| 368 | Ga0495622_0003205 | 3300046557 | Bacteria | 7751 |
| 369 | Ga0495622_0034856 | 3300046557 | Bacteria | 2347 |
| 370 | Ga0495622_0153828 | 3300046557 | Bacteria | 1039 |
| 371 | Ga0495633_0000165 | 3300046558 | Bacteria | 86867 |
| 372 | Ga0495667_0008299 | 3300046559 | Bacteria | 7042 |
| 373 | Ga0495667_0017394 | 3300046559 | Bacteria | 4855 |
| 374 | Ga0495668_0000238 | 3300046616 | Bacteria | 78527 |
| 375 | Ga0495668_0000503 | 3300046616 | Bacteria | 48861 |
| 376 | Ga0495668_0004158 | 3300046616 | Bacteria | 10455 |
| 377 | Ga0495668_0008635 | 3300046616 | Bacteria | 6335 |
| 378 | Ga0495634_0142378 | 3300046642 | Bacteria | 1521 |
| 379 | Ga0495611_0000475 | 3300046648 | Bacteria | 23978 |
| 380 | Ga0495611_0000485 | 3300046648 | Bacteria | 23749 |
| 381 | Ga0495611_0004026 | 3300046648 | Bacteria | 6398 |
| 382 | Ga0495625_0000101 | 3300046660 | Bacteria | 139139 |
| 383 | Ga0495625_0003863 | 3300046660 | Bacteria | 14477 |
| 384 | Ga0495625_0005733 | 3300046660 | Bacteria | 11227 |
| 385 | Ga0495625_0007856 | 3300046660 | Bacteria | 9189 |
| 386 | Ga0495625_0096092 | 3300046660 | Bacteria | 2041 |
| 387 | Ga0495635_0001180 | 3300046663 | Bacteria | 17400 |
| 388 | Ga0495661_0000024 | 3300046665 | Bacteria | 188844 |
| 389 | Ga0495661_0000143 | 3300046665 | Bacteria | 83493 |
| 390 | Ga0495661_0000242 | 3300046665 | Bacteria | 62935 |
| 391 | Ga0495661_0006203 | 3300046665 | Bacteria | 8414 |
| 392 | Ga0495661_0010038 | 3300046665 | Bacteria | 6474 |
| 393 | Ga0495661_0011066 | 3300046665 | Bacteria | 6127 |
| 394 | Ga0495661_0031972 | 3300046665 | Bacteria | 3331 |
| 395 | Ga0495661_0045604 | 3300046665 | Bacteria | 2679 |
| 396 | Ga0495661_0084625 | 3300046665 | Bacteria | 1819 |
| 397 | Ga0495657_0137672 | 3300046675 | Bacteria | 1524 |
| 398 | Ga0495657_0225531 | 3300046675 | Bacteria | 1135 |
| 399 | Ga0495599_0001203 | 3300046678 | Bacteria | 14666 |
| 400 | Ga0495599_0192945 | 3300046678 | Bacteria | 1252 |
| 401 | Ga0495623_0000068 | 3300046679 | Bacteria | 63878 |
| 402 | Ga0495623_0000505 | 3300046679 | Bacteria | 25846 |
| 403 | Ga0495623_0001196 | 3300046679 | Bacteria | 17603 |
| 404 | Ga0495623_0003843 | 3300046679 | Bacteria | 9901 |
| 405 | Ga0495623_0016582 | 3300046679 | Bacteria | 4758 |
| 406 | Ga0495623_0242701 | 3300046679 | Bacteria | 1017 |
| 407 | Ga0495646_0006822 | 3300046680 | Bacteria | 7246 |
| 408 | Ga0495646_0032940 | 3300046680 | Bacteria | 3222 |
| 409 | Ga0495658_0178342 | 3300046683 | Bacteria | 1317 |
| 410 | Ga0495669_0050553 | 3300046684 | Bacteria | 1864 |
| 411 | Ga0495613_0011354 | 3300046689 | Bacteria | 6619 |
| 412 | Ga0495613_0120028 | 3300046689 | Bacteria | 1888 |
| 413 | Ga0495624_0054484 | 3300046690 | Bacteria | 2521 |
| 414 | Ga0495624_0089518 | 3300046690 | Bacteria | 1899 |
| 415 | Ga0495624_0107895 | 3300046690 | Bacteria | 1712 |
| 416 | Ga0495670_0000021 | 3300046691 | Bacteria | 104769 |
| 417 | Ga0495670_0005114 | 3300046691 | Bacteria | 6451 |
| 418 | Ga0495670_0007216 | 3300046691 | Bacteria | 5466 |
| 419 | Ga0495670_0131631 | 3300046691 | Bacteria | 1304 |
| 420 | Ga0495671_0002059 | 3300046692 | Bacteria | 12899 |
| 421 | Ga0495671_0003858 | 3300046692 | Bacteria | 9109 |
| 422 | Ga0495671_0007495 | 3300046692 | Bacteria | 6212 |
| 423 | Ga0495671_0028235 | 3300046692 | Bacteria | 2893 |
| 424 | Ga0495671_0095146 | 3300046692 | Bacteria | 1457 |
| 425 | Ga0495649_0001521 | 3300046694 | Bacteria | 17422 |
| 426 | Ga0495649_0022444 | 3300046694 | Bacteria | 3532 |
| 427 | Ga0495649_0049626 | 3300046694 | Bacteria | 2279 |
| 428 | Ga0495589_0000255 | 3300046794 | Bacteria | 43527 |
| 429 | Ga0495589_0000681 | 3300046794 | Bacteria | 22193 |
| 430 | Ga0495589_0016127 | 3300046794 | Bacteria | 3838 |
| 431 | Ga0495589_0024701 | 3300046794 | Bacteria | 3053 |
| 432 | Ga0495589_0081220 | 3300046794 | Bacteria | 1577 |
| 433 | Ga0495600_0049652 | 3300046809 | Bacteria | 2737 |
| 434 | Ga0495600_0078568 | 3300046809 | Bacteria | 2155 |
| 435 | Ga0495600_0080493 | 3300046809 | Bacteria | 2126 |
| 436 | Ga0495660_0000325 | 3300046810 | Bacteria | 42181 |
| 437 | Ga0495660_0006667 | 3300046810 | Bacteria | 6817 |
| 438 | Ga0495660_0007007 | 3300046810 | Bacteria | 6645 |
| 439 | Ga0495660_0010416 | 3300046810 | Bacteria | 5409 |
| 440 | Ga0495660_0046322 | 3300046810 | Bacteria | 2384 |
| 441 | Ga0495660_0055478 | 3300046810 | Bacteria | 2145 |
| 442 | Ga0495660_0058092 | 3300046810 | Bacteria | 2085 |
| 443 | Ga0495660_0110899 | 3300046810 | Bacteria | 1400 |
| 444 | Ga0495660_0151786 | 3300046810 | Bacteria | 1143 |
| 445 | Ga0495581_0007346 | 3300047315 | Bacteria | 6373 |
| 446 | Ga0495581_0059600 | 3300047315 | Bacteria | 2206 |
| 447 | Ga0495604_0000356 | 3300047317 | Bacteria | 40982 |
| 448 | Ga0495604_0009667 | 3300047317 | Bacteria | 7624 |
| 449 | Ga0495604_0029323 | 3300047317 | Bacteria | 4377 |
| 450 | Ga0495674_0001529 | 3300047319 | Bacteria | 22615 |
| 451 | Ga0495674_0004590 | 3300047319 | Bacteria | 13282 |
| 452 | Ga0495672_0001131 | 3300047320 | Bacteria | 27027 |
| 453 | Ga0495672_0033024 | 3300047320 | Bacteria | 3210 |
| 454 | Ga0495672_0063320 | 3300047320 | Bacteria | 2123 |
| 455 | Ga0495676_0000071 | 3300047321 | Bacteria | 76592 |
| 456 | Ga0495676_0008883 | 3300047321 | Bacteria | 9179 |
| 457 | Ga0495680_0002429 | 3300047322 | Bacteria | 19072 |
| 458 | Ga0495680_0003371 | 3300047322 | Bacteria | 15786 |
| 459 | Ga0495680_0039272 | 3300047322 | Bacteria | 3777 |
| 460 | Ga0495683_0000849 | 3300047323 | Bacteria | 21676 |
| 461 | Ga0495683_0002891 | 3300047323 | Bacteria | 10165 |
| 462 | Ga0495683_0005326 | 3300047323 | Bacteria | 7149 |
| 463 | Ga0495683_0010946 | 3300047323 | Bacteria | 4784 |
| 464 | Ga0495683_0014936 | 3300047323 | Bacteria | 4044 |
| 465 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 466 | Ga0495675_0000473 | 3300047444 | Bacteria | 26369 |
| 467 | Ga0495675_0002160 | 3300047444 | Bacteria | 11720 |
| 468 | Ga0495675_0002754 | 3300047444 | Bacteria | 10534 |
| 469 | Ga0495675_0011625 | 3300047444 | Bacteria | 5527 |
| 470 | Ga0495675_0022924 | 3300047444 | Bacteria | 3979 |
| 471 | Ga0495675_0051668 | 3300047444 | Bacteria | 2610 |
| 472 | Ga0495679_000064 | 3300047446 | Bacteria | 102509 |
| 473 | Ga0495679_000236 | 3300047446 | Bacteria | 45851 |
| 474 | Ga0495679_001857 | 3300047446 | Bacteria | 11385 |
| 475 | Ga0495673_0002335 | 3300047469 | Bacteria | 13494 |
| 476 | Ga0495673_0002995 | 3300047469 | Bacteria | 11381 |
| 477 | Ga0495673_0003146 | 3300047469 | Bacteria | 11052 |
| 478 | Ga0495673_0003863 | 3300047469 | Bacteria | 9660 |
| 479 | Ga0495673_0003972 | 3300047469 | Bacteria | 9457 |
| 480 | Ga0495673_0005866 | 3300047469 | Bacteria | 7340 |
| 481 | Ga0495673_0007314 | 3300047469 | Bacteria | 6370 |
| 482 | Ga0495673_0020536 | 3300047469 | Bacteria | 3285 |
| 483 | Ga0495673_0054555 | 3300047469 | Bacteria | 1737 |
| 484 | Ga0495673_0064357 | 3300047469 | Bacteria | 1560 |
| 485 | Ga0495681_0000034 | 3300047470 | Bacteria | 125396 |
| 486 | Ga0495681_0001515 | 3300047470 | Bacteria | 17345 |
| 487 | Ga0495681_0002308 | 3300047470 | Bacteria | 13717 |
| 488 | Ga0495681_0004761 | 3300047470 | Bacteria | 9198 |
| 489 | Ga0495681_0017134 | 3300047470 | Bacteria | 4035 |
| 490 | Ga0495681_0023117 | 3300047470 | Bacteria | 3308 |
| 491 | Ga0495684_0082542 | 3300047471 | Bacteria | 2438 |
| 492 | Ga0495686_0001239 | 3300047472 | Bacteria | 29105 |
| 493 | Ga0495686_0030833 | 3300047472 | Bacteria | 3480 |
| 494 | Ga0495686_0134174 | 3300047472 | Bacteria | 1465 |
| 495 | Ga0495686_0158291 | 3300047472 | Bacteria | 1325 |
| 496 | Ga0495593_0000045 | 3300047673 | Bacteria | 50149 |
| 497 | Ga0495593_0027010 | 3300047673 | Bacteria | 3164 |
| 498 | Ga0495593_0031662 | 3300047673 | Bacteria | 2887 |
| 499 | Ga0495593_0123531 | 3300047673 | Bacteria | 1316 |
| 500 | Ga0495602_0001885 | 3300048088 | Bacteria | 20999 |
| 501 | Ga0495602_0004432 | 3300048088 | Bacteria | 14658 |
| 502 | Ga0495602_0049627 | 3300048088 | Bacteria | 3756 |
| 503 | Ga0495602_0218242 | 3300048088 | Bacteria | 1441 |
| 504 | Ga0495614_0003119 | 3300048089 | Bacteria | 7386 |
| 505 | Ga0495614_0061824 | 3300048089 | Bacteria | 1609 |
| 506 | Ga0495626_0000045 | 3300048091 | Bacteria | 164931 |
| 507 | Ga0495626_0000166 | 3300048091 | Bacteria | 81272 |
| 508 | Ga0495626_0000816 | 3300048091 | Bacteria | 28047 |
| 509 | Ga0496100_0026260 | 3300048903 | Bacteria | 3569 |
| 510 | Ga0496102_0001291 | 3300048905 | Bacteria | 22509 |
| 511 | Ga0496102_0005827 | 3300048905 | Bacteria | 10481 |
| 512 | Ga0496103_0017085 | 3300048906 | Bacteria | 4338 |
| 513 | Ga0496104_0333105 | 3300048907 | Bacteria | 1431 |
| 514 | Ga0496105_0016101 | 3300048908 | Bacteria | 5964 |
| 515 | Ga0496106_0002941 | 3300048909 | Bacteria | 12680 |
| 516 | Ga0496107_0073685 | 3300048910 | Bacteria | 2484 |
| 517 | Ga0496107_0405998 | 3300048910 | Bacteria | 1013 |
| 518 | Ga0496108_0432978 | 3300048911 | Bacteria | 1149 |
| 519 | Ga0496110_0454507 | 3300048913 | Unclassified | 1167 |
| 520 | Ga0496114_0000816 | 3300048917 | Bacteria | 23339 |
| 521 | Ga0496115_0228805 | 3300048918 | Bacteria | 1534 |
| 522 | Ga0496115_0333789 | 3300048918 | Bacteria | 1238 |
| 523 | Ga0496116_0000366 | 3300048919 | Bacteria | 69492 |
| 524 | Ga0496116_0003129 | 3300048919 | Bacteria | 16611 |
| 525 | Ga0496117_0000469 | 3300048920 | Bacteria | 67036 |
| 526 | Ga0496117_0000708 | 3300048920 | Bacteria | 52863 |
| 527 | Ga0496117_0003647 | 3300048920 | Bacteria | 17731 |
| 528 | Ga0496117_0118602 | 3300048920 | Bacteria | 1631 |
| 529 | Ga0496118_0000167 | 3300048921 | Bacteria | 119146 |
| 530 | Ga0496118_0026815 | 3300048921 | Bacteria | 4896 |
| 531 | Ga0496118_0029626 | 3300048921 | Bacteria | 4586 |
| 532 | Ga0496118_0201456 | 3300048921 | Bacteria | 1178 |
| 533 | Ga0496119_0067523 | 3300048922 | Bacteria | 2109 |
| 534 | Ga0496121_0000722 | 3300048924 | Bacteria | 61133 |
| 535 | Ga0496121_0025971 | 3300048924 | Bacteria | 5539 |
| 536 | Ga0496121_0029703 | 3300048924 | Bacteria | 5043 |
| 537 | Ga0496121_0035577 | 3300048924 | Bacteria | 4460 |
| 538 | Ga0496121_0220040 | 3300048924 | Bacteria | 1338 |
| 539 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 540 | Ga0496122_0001006 | 3300048925 | Bacteria | 49938 |
| 541 | Ga0496122_0001194 | 3300048925 | Bacteria | 44317 |
| 542 | Ga0496122_0029896 | 3300048925 | Bacteria | 4580 |
| 543 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 544 | Ga0496123_0000532 | 3300048926 | Bacteria | 65557 |
| 545 | Ga0496123_0000784 | 3300048926 | Bacteria | 51269 |
| 546 | Ga0496123_0080317 | 3300048926 | Bacteria | 1988 |
| 547 | Ga0496124_0000123 | 3300048927 | Bacteria | 161106 |
| 548 | Ga0496124_0052354 | 3300048927 | Bacteria | 3468 |
| 549 | Ga0496124_0070237 | 3300048927 | Bacteria | 2905 |
| 550 | Ga0496124_0285145 | 3300048927 | Bacteria | 1202 |
| 551 | Ga0496125_0001211 | 3300048928 | Bacteria | 38785 |
| 552 | Ga0496125_0002955 | 3300048928 | Bacteria | 21369 |
| 553 | Ga0496125_0004960 | 3300048928 | Bacteria | 15051 |
| 554 | Ga0496125_0069394 | 3300048928 | Bacteria | 2766 |
| 555 | Ga0496125_0105560 | 3300048928 | Bacteria | 2059 |
| 556 | Ga0496125_0149947 | 3300048928 | Bacteria | 1604 |
| 557 | Ga0496126_0477565 | 3300048929 | Bacteria | 999 |
| 558 | Ga0495678_000008 | 3300049459 | Bacteria | 445926 |
| 559 | Ga0495678_000957 | 3300049459 | Bacteria | 25009 |
| 560 | Ga0495678_001067 | 3300049459 | Bacteria | 23249 |
| 561 | Ga0495678_024367 | 3300049459 | Bacteria | 2613 |
| 562 | Ga0495678_060672 | 3300049459 | Bacteria | 1422 |
| 563 | Ga0501031_0012665 | 3300049568 | Bacteria | 5507 |
| 564 | Ga0501031_0050911 | 3300049568 | Bacteria | 2697 |
| 565 | Ga0501032_0006231 | 3300049569 | Bacteria | 8778 |
| 566 | Ga0501033_0003584 | 3300049570 | Bacteria | 12688 |
| 567 | Ga0501033_0040771 | 3300049570 | Bacteria | 3466 |
| 568 | Ga0501034_0006814 | 3300049571 | Bacteria | 12219 |
| 569 | Ga0501034_0031655 | 3300049571 | Bacteria | 5373 |
| 570 | Ga0501034_0446484 | 3300049571 | Bacteria | 1211 |
| 571 | Ga0501036_0001771 | 3300049572 | Bacteria | 16761 |
| 572 | Ga0501037_0004252 | 3300049573 | Bacteria | 10376 |
| 573 | Ga0501038_0000494 | 3300049574 | Bacteria | 34711 |
| 574 | Ga0501038_0244999 | 3300049574 | Bacteria | 1422 |
| 575 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 576 | Ga0501043_0001194 | 3300049579 | Bacteria | 22852 |
| 577 | Ga0501043_0329906 | 3300049579 | Bacteria | 1162 |
| 578 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 579 | Ga0501046_0002440 | 3300049580 | Bacteria | 17427 |
| 580 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 581 | Ga0501047_0004711 | 3300049581 | Bacteria | 12827 |
| 582 | Ga0501047_0065098 | 3300049581 | Bacteria | 3514 |
| 583 | Ga0501048_0000035 | 3300049582 | Bacteria | 64516 |
| 584 | Ga0501073_0014617 | 3300049589 | Bacteria | 5704 |
| 585 | Ga0501035_0030053 | 3300049822 | Bacteria | 4954 |
| 586 | Ga0501035_0082472 | 3300049822 | Bacteria | 2837 |
| 587 | Ga0501044_0004644 | 3300049823 | Bacteria | 15368 |
| 588 | Ga0501044_0012609 | 3300049823 | Bacteria | 9154 |
| 589 | Ga0501044_0086468 | 3300049823 | Bacteria | 3167 |
| 590 | Ga0501045_0001444 | 3300049824 | Bacteria | 15788 |
| 591 | nmdc:mga00v17_184220_c1 | 3300050491 | Bacteria | 1347 |
| 592 | nmdc:mga0k408_52499_c1 | 3300050493 | Bacteria | 2363 |
| 593 | nmdc:mga0k408_5367_c1 | 3300050493 | Bacteria | 6813 |
| 594 | nmdc:mga07m45_40525_c1 | 3300050496 | Bacteria | 2606 |
| 595 | nmdc:mga07m45_77806_c1 | 3300050496 | Bacteria | 1892 |
| 596 | nmdc:mga0n895_66941_c1 | 3300050512 | Bacteria | 3556 |
| 597 | Ga0495601_0011976 | 3300053077 | Bacteria | 5196 |
| 598 | Ga0495612_0006526 | 3300053078 | Bacteria | 4793 |
| 599 | Ga0500635_0118954 | 3300053080 | Bacteria | 988 |
| 600 | Ga0495595_0000132 | 3300053084 | Bacteria | 30927 |
| 601 | Ga0495619_0004062 | 3300053085 | Bacteria | 9374 |
| 602 | Ga0500578_0000282 | 3300053086 | Bacteria | 62821 |
| 603 | Ga0500578_0124117 | 3300053086 | Bacteria | 1622 |
| 604 | Ga0500578_0149621 | 3300053086 | Bacteria | 1455 |
| 605 | Ga0500644_0051563 | 3300053088 | Bacteria | 1413 |
| 606 | Ga0500646_0002851 | 3300053090 | Bacteria | 4436 |
| 607 | Ga0500646_0013202 | 3300053090 | Bacteria | 2138 |
| 608 | Ga0500647_0007604 | 3300053091 | Bacteria | 4666 |
| 609 | Ga0500651_0046365 | 3300053093 | Bacteria | 2733 |
| 610 | Ga0500569_016299 | 3300053109 | Bacteria | 1880 |
| 611 | Ga0500595_042643 | 3300053119 | Bacteria | 1450 |
| 612 | Ga0500607_156492 | 3300053121 | Bacteria | 1048 |
| 613 | Ga0500628_000922 | 3300053129 | Bacteria | 5169 |
| 614 | Ga0500642_0006046 | 3300053130 | Bacteria | 3954 |
| 615 | Ga0500652_001232 | 3300053131 | Bacteria | 8133 |
| 616 | Ga0500652_075867 | 3300053131 | Bacteria | 1397 |
| 617 | Ga0500655_007191 | 3300053133 | Bacteria | 2002 |
| 618 | Ga0500559_0000193 | 3300053136 | Bacteria | 49137 |
| 619 | Ga0500568_0009200 | 3300053139 | Bacteria | 4711 |
| 620 | Ga0500568_0086760 | 3300053139 | Bacteria | 1183 |
| 621 | Ga0500573_0056999 | 3300053140 | Bacteria | 2243 |
| 622 | Ga0500622_0000413 | 3300053156 | Bacteria | 40682 |
| 623 | Ga0500622_0001707 | 3300053156 | Bacteria | 17033 |
| 624 | Ga0500622_0002091 | 3300053156 | Bacteria | 14874 |
| 625 | Ga0500622_0205665 | 3300053156 | Bacteria | 892 |
| 626 | Ga0500636_0218752 | 3300053177 | Bacteria | 994 |
| 627 | Ga0500645_002529 | 3300053730 | Bacteria | 8073 |
| 628 | Ga0500552_011783 | 3300053733 | Bacteria | 1105 |
| 629 | Ga0500587_001150 | 3300053739 | Bacteria | 3653 |
| 630 | Ga0501082_0134862 | 3300060353 | Bacteria | 2142 |
| 631 | Ga0501082_0513149 | 3300060353 | Bacteria | 1048 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0178342 | Ga0495658_0178342_14_1075 | 232 |
| 2 | 3300005327 | Ga0070658_10031491 | Ga0070658_100314912 | 238 |
| 3 | 3300005344 | Ga0070661_100028695 | Ga0070661_1000286953 | 238 |
| 4 | 3300005355 | Ga0070671_100207179 | Ga0070671_1002071792 | 238 |
| 5 | 3300005457 | Ga0070662_100232563 | Ga0070662_1002325632 | 238 |
| 6 | 3300005458 | Ga0070681_10303405 | Ga0070681_103034052 | 238 |
| 7 | 3300005535 | Ga0070684_100018459 | Ga0070684_1000184593 | 238 |
| 8 | 3300005539 | Ga0068853_100025298 | Ga0068853_1000252983 | 238 |
| 9 | 3300005564 | Ga0070664_100004768 | Ga0070664_1000047687 | 238 |
| 10 | 3300005577 | Ga0068857_100013031 | Ga0068857_1000130315 | 238 |
| 11 | 3300005614 | Ga0068856_100031354 | Ga0068856_1000313542 | 238 |
| 12 | 3300005616 | Ga0068852_100020085 | Ga0068852_1000200853 | 238 |
| 13 | 3300005834 | Ga0068851_10021353 | Ga0068851_100213532 | 238 |
| 14 | 3300009093 | Ga0105240_10422434 | Ga0105240_104224342 | 238 |
| 15 | 3300009551 | Ga0105238_10003764 | Ga0105238_100037642 | 238 |
| 16 | 3300013100 | Ga0157373_10010062 | Ga0157373_100100625 | 238 |
| 17 | 3300013296 | Ga0157374_10211008 | Ga0157374_102110082 | 238 |
| 18 | 3300013307 | Ga0157372_10006766 | Ga0157372_100067663 | 238 |
| 19 | 3300025321 | Ga0207656_10043847 | Ga0207656_100438472 | 238 |
| 20 | 3300025919 | Ga0207657_10022124 | Ga0207657_100221244 | 238 |
| 21 | 3300025920 | Ga0207649_10006870 | Ga0207649_100068702 | 238 |
| 22 | 3300025931 | Ga0207644_10051830 | Ga0207644_100518302 | 238 |
| 23 | 3300025944 | Ga0207661_10018345 | Ga0207661_100183452 | 238 |
| 24 | 3300025945 | Ga0207679_10010572 | Ga0207679_100105722 | 238 |
| 25 | 3300025981 | Ga0207640_10009388 | Ga0207640_100093883 | 238 |
| 26 | 3300026078 | Ga0207702_10016633 | Ga0207702_100166333 | 238 |
| 27 | 3300026116 | Ga0207674_10033462 | Ga0207674_100334622 | 238 |
| 28 | 3300026142 | Ga0207698_10073644 | Ga0207698_100736442 | 238 |
| 29 | 3300005338 | Ga0068868_100000303 | Ga0068868_1000003031 | 239 |
| 30 | 3300005457 | Ga0070662_100003486 | Ga0070662_1000034867 | 239 |
| 31 | 3300035118 | Ga0373954_0007214 | Ga0373954_0007214_323_1063 | 246 |
| 32 | 3300035119 | Ga0373956_0167976 | Ga0373956_0167976_50_790 | 246 |
| 33 | 3300035410 | Ga0373924_0137850 | Ga0373924_0137850_247_987 | 246 |
| 34 | 3300035692 | Ga0373935_0343183 | Ga0373935_0343183_79_819 | 246 |
| 35 | 3300036401 | Ga0373937_0000503 | Ga0373937_0000503_26375_27115 | 246 |
| 36 | 3300046459 | Ga0495629_0001997 | Ga0495629_0001997_457_1197 | 246 |
| 37 | 3300046463 | Ga0495653_0001768 | Ga0495653_0001768_4821_5561 | 246 |
| 38 | 3300046476 | Ga0495662_0124902 | Ga0495662_0124902_352_1092 | 246 |
| 39 | 3300046511 | Ga0495608_0000956 | Ga0495608_0000956_8590_9330 | 246 |
| 40 | 3300046514 | Ga0495618_0001015 | Ga0495618_0001015_6688_7428 | 246 |
| 41 | 3300046516 | Ga0495628_0156031 | Ga0495628_0156031_266_1006 | 246 |
| 42 | 3300046517 | Ga0495630_0083747 | Ga0495630_0083747_1489_2229 | 246 |
| 43 | 3300046529 | Ga0495652_0003170 | Ga0495652_0003170_9216_9956 | 246 |
| 44 | 3300046533 | Ga0495640_0003936 | Ga0495640_0003936_10130_10870 | 246 |
| 45 | 3300046536 | Ga0495587_0000332 | Ga0495587_0000332_14941_15681 | 246 |
| 46 | 3300046559 | Ga0495667_0008299 | Ga0495667_0008299_1107_1847 | 246 |
| 47 | 3300046663 | Ga0495635_0001180 | Ga0495635_0001180_14609_15349 | 246 |
| 48 | 3300046675 | Ga0495657_0137672 | Ga0495657_0137672_266_1006 | 246 |
| 49 | 3300046678 | Ga0495599_0001203 | Ga0495599_0001203_2218_2958 | 246 |
| 50 | 3300046679 | Ga0495623_0000505 | Ga0495623_0000505_19161_19901 | 246 |
| 51 | 3300046680 | Ga0495646_0006822 | Ga0495646_0006822_1587_2327 | 246 |
| 52 | 3300046689 | Ga0495613_0120028 | Ga0495613_0120028_1013_1753 | 246 |
| 53 | 3300046809 | Ga0495600_0080493 | Ga0495600_0080493_474_1214 | 246 |
| 54 | 3300047315 | Ga0495581_0059600 | Ga0495581_0059600_990_1730 | 246 |
| 55 | 3300047317 | Ga0495604_0000356 | Ga0495604_0000356_30329_31069 | 246 |
| 56 | 3300047319 | Ga0495674_0001529 | Ga0495674_0001529_20066_20806 | 246 |
| 57 | 3300047322 | Ga0495680_0003371 | Ga0495680_0003371_4645_5385 | 246 |
| 58 | 3300047444 | Ga0495675_0002754 | Ga0495675_0002754_7748_8488 | 246 |
| 59 | 3300047471 | Ga0495684_0082542 | Ga0495684_0082542_290_1030 | 246 |
| 60 | 3300047673 | Ga0495593_0027010 | Ga0495593_0027010_1498_2238 | 246 |
| 61 | 3300048088 | Ga0495602_0001885 | Ga0495602_0001885_18207_18947 | 246 |
| 62 | 3300053077 | Ga0495601_0011976 | Ga0495601_0011976_1806_2546 | 246 |
| 63 | 3300053078 | Ga0495612_0006526 | Ga0495612_0006526_175_915 | 246 |
| 64 | 3300053084 | Ga0495595_0000132 | Ga0495595_0000132_14838_15578 | 246 |
| 65 | 3300053085 | Ga0495619_0004062 | Ga0495619_0004062_6496_7236 | 246 |
| 66 | 3300046794 | Ga0495589_0081220 | Ga0495589_0081220_513_1256 | 247 |
| 67 | 3300009036 | Ga0105244_10001072 | Ga0105244_1000107220 | 248 |
| 68 | 3300011119 | Ga0105246_10012195 | Ga0105246_100121955 | 248 |
| 69 | 3300013100 | Ga0157373_10266881 | Ga0157373_102668811 | 248 |
| 70 | 3300013105 | Ga0157369_10000562 | Ga0157369_1000056234 | 248 |
| 71 | 3300046515 | Ga0495620_0097742 | Ga0495620_0097742_357_1103 | 248 |
| 72 | 3300046665 | Ga0495661_0000242 | Ga0495661_0000242_34766_35512 | 248 |
| 73 | 3300048920 | Ga0496117_0000469 | Ga0496117_0000469_13520_14266 | 248 |
| 74 | 3300048921 | Ga0496118_0201456 | Ga0496118_0201456_407_1153 | 248 |
| 75 | 3300048928 | Ga0496125_0001211 | Ga0496125_0001211_20612_21358 | 248 |
| 76 | 3300048929 | Ga0496126_0477565 | Ga0496126_0477565_178_924 | 248 |
| 77 | 3300060353 | Ga0501082_0513149 | Ga0501082_0513149_172_969 | 249 |
| 78 | 3300046457 | Ga0495590_0005411 | Ga0495590_0005411_16_768 | 250 |
| 79 | 3300046513 | Ga0495616_0221907 | Ga0495616_0221907_59_811 | 250 |
| 80 | 3300046542 | Ga0495597_0008705 | Ga0495597_0008705_16_768 | 250 |
| 81 | 3300048918 | Ga0496115_0228805 | Ga0496115_0228805_258_1118 | 253 |
| 82 | 3300025294 | Ga0209025_1004094 | Ga0209025_10040947 | 254 |
| 83 | 3300046463 | Ga0495653_0101965 | Ga0495653_0101965_68_856 | 254 |
| 84 | 3300046557 | Ga0495622_0153828 | Ga0495622_0153828_42_830 | 254 |
| 85 | 3300039437 | Ga0436365_0662455 | Ga0436365_0662455_96_866 | 255 |
| 86 | 3300026121 | Ga0207683_10582240 | Ga0207683_105822401 | 257 |
| 87 | 3300005435 | Ga0070714_100442186 | Ga0070714_1004421862 | 258 |
| 88 | iso_pu_bacteria | 2511231031 | 2511413088 | 258 |
| 89 | iso_pu_bacteria | 2554235341 | 2555668462 | 258 |
| 90 | iso_pu_bacteria | 2585428057 | 2587730926 | 258 |
| 91 | iso_pu_bacteria | 2585428058 | 2587736039 | 258 |
| 92 | iso_pu_bacteria | 2585428062 | 2587756349 | 258 |
| 93 | iso_pu_bacteria | 2588253510 | 2588295810 | 258 |
| 94 | iso_pu_bacteria | 2599185160 | 2599355459 | 258 |
| 95 | iso_pu_bacteria | 2599185161 | 2599360702 | 258 |
| 96 | iso_pu_bacteria | 2599185162 | 2599367024 | 258 |
| 97 | iso_pu_bacteria | 2599185163 | 2599373814 | 258 |
| 98 | iso_pu_bacteria | 2599185164 | 2599380565 | 258 |
| 99 | iso_pu_bacteria | 2599185165 | 2599387012 | 258 |
| 100 | iso_pu_bacteria | 2599185166 | 2599392672 | 258 |
| 101 | iso_pu_bacteria | 2599185167 | 2599396659 | 258 |
| 102 | iso_pu_bacteria | 2599185168 | 2599404439 | 258 |
| 103 | iso_pu_bacteria | 2599185179 | 2599453281 | 258 |
| 104 | iso_pu_bacteria | 2599185181 | 2599462293 | 258 |
| 105 | iso_pu_bacteria | 2599185182 | 2599466648 | 258 |
| 106 | iso_pu_bacteria | 2599185186 | 2599490615 | 258 |
| 107 | iso_pu_bacteria | 2599185190 | 2599514613 | 258 |
| 108 | iso_pu_bacteria | 2599185191 | 2599517456 | 258 |
| 109 | iso_pu_bacteria | 2599185290 | 2599894122 | 258 |
| 110 | iso_pu_bacteria | 2599185356 | 2600214915 | 258 |
| 111 | iso_pu_bacteria | 2600255296 | 2601691312 | 258 |
| 112 | iso_pu_bacteria | 2600255313 | 2601774380 | 258 |
| 113 | iso_pu_bacteria | 2619619299 | 2621301126 | 258 |
| 114 | iso_pu_bacteria | 2643221592 | 2643971050 | 258 |
| 115 | iso_pu_bacteria | 2643221603 | 2644031016 | 258 |
| 116 | iso_pu_bacteria | 2643221625 | 2644144213 | 258 |
| 117 | iso_pu_bacteria | 2643221648 | 2644275235 | 258 |
| 118 | iso_pu_bacteria | 2643221683 | 2644467753 | 258 |
| 119 | iso_pu_bacteria | 2667528171 | 2671098079 | 258 |
| 120 | iso_pu_bacteria | 2721755607 | 2723247611 | 258 |
| 121 | iso_pu_bacteria | 2721755755 | 2723844538 | 258 |
| 122 | iso_pu_bacteria | 2738541265 | 2738670249 | 258 |
| 123 | iso_pu_bacteria | 2738541271 | 2738687791 | 258 |
| 124 | iso_pu_bacteria | 2738541282 | 2738748642 | 258 |
| 125 | iso_pu_bacteria | 2738541303 | 2738857684 | 258 |
| 126 | iso_pu_bacteria | 2738541307 | 2738883028 | 258 |
| 127 | iso_pu_bacteria | 2738543016 | 2739263774 | 258 |
| 128 | iso_pu_bacteria | 2773857672 | 2774129550 | 258 |
| 129 | iso_pu_bacteria | 2816332298 | 2817489520 | 258 |
| 130 | iso_pu_bacteria | 2818991464 | 2819703146 | 258 |
| 131 | iso_pu_bacteria | 2834028612 | 2834029434 | 258 |
| 132 | iso_pu_bacteria | 2855730933 | 2855731816 | 258 |
| 133 | iso_pu_bacteria | 2855767633 | 2855768522 | 258 |
| 134 | iso_pu_bacteria | 2857542790 | 2857547176 | 258 |
| 135 | iso_pu_bacteria | 2857576091 | 2857576503 | 258 |
| 136 | iso_pu_bacteria | 2881665667 | 2881672774 | 258 |
| 137 | iso_pu_bacteria | 2912963787 | 2912965892 | 258 |
| 138 | iso_pu_bacteria | 2917070673 | 2917072230 | 258 |
| 139 | iso_pu_bacteria | 2919085039 | 2919085879 | 258 |
| 140 | iso_pu_bacteria | 2931390751 | 2931392443 | 258 |
| 141 | iso_pu_bacteria | 2935353572 | 2935354399 | 258 |
| 142 | iso_pu_bacteria | 2935648319 | 2935656676 | 258 |
| 143 | iso_pu_bacteria | 2935656913 | 2935665486 | 258 |
| 144 | iso_pu_bacteria | 2935984226 | 2935989232 | 258 |
| 145 | iso_pu_bacteria | 2936011229 | 2936019539 | 258 |
| 146 | iso_pu_bacteria | 2936019824 | 2936028167 | 258 |
| 147 | iso_pu_bacteria | 2936028420 | 2936037040 | 258 |
| 148 | iso_pu_bacteria | 2936046547 | 2936055012 | 258 |
| 149 | iso_pu_bacteria | 2939651529 | 2939653632 | 258 |
| 150 | iso_pu_bacteria | 2945909444 | 2945909466 | 258 |
| 151 | iso_pu_bacteria | 2945961074 | 2945961760 | 258 |
| 152 | iso_pu_bacteria | 2945984333 | 2945988554 | 258 |
| 153 | iso_pu_bacteria | 2947233263 | 2947236256 | 258 |
| 154 | iso_pu_bacteria | 3007619802 | 3007624793 | 258 |
| 155 | iso_pu_bacteria | 637000220 | 637318821 | 258 |
| 156 | iso_pu_bacteria | 642555113 | 642620540 | 258 |
| 157 | iso_pu_bacteria | 8016583857 | 8016584200 | 258 |
| 158 | iso_pu_bacteria | 8019769354 | 8019770993 | 258 |
| 159 | iso_pu_bacteria | 8054285046 | 8054286806 | 258 |
| 160 | iso_pu_bacteria | 8055817908 | 8055819474 | 258 |
| 161 | iso_pu_bacteria | 8056161164 | 8056164767 | 258 |
| 162 | iso_pu_bacteria | 8056177738 | 8056178648 | 258 |
| 163 | iso_pu_bacteria | 8056673599 | 8056677250 | 258 |
| 164 | iso_pu_bacteria | 8057798959 | 8057803744 | 258 |
| 165 | 3300046690 | Ga0495624_0054484 | Ga0495624_0054484_773_1555 | 259 |
| 166 | 3300001989 | JGI24739J22299_10001284 | JGI24739J22299_100012844 | 262 |
| 167 | 3300002705 | JGI25156J39149_1000693 | JGI25156J39149_100069315 | 262 |
| 168 | 3300002737 | JGI25162J39368_1000085 | JGI25162J39368_100008534 | 262 |
| 169 | 3300002771 | JGI25163J39215_1000077 | JGI25163J39215_100007739 | 262 |
| 170 | 3300002772 | JGI25164J39214_1000063 | JGI25164J39214_100006334 | 262 |
| 171 | 3300002773 | JGI25152J39213_1001586 | JGI25152J39213_10015864 | 262 |
| 172 | 3300003187 | JGI25151J46595_10000626 | JGI25151J46595_100006264 | 262 |
| 173 | 3300003214 | JGI25165J46597_1000160 | JGI25165J46597_100016034 | 262 |
| 174 | 3300003215 | JGI25153J46596_10000537 | JGI25153J46596_100005372 | 262 |
| 175 | 3300003320 | rootH2_10053359 | rootH2_100533595 | 262 |
| 176 | 3300003320 | rootH2_10208268 | rootH2_102082681 | 262 |
| 177 | 3300003323 | rootH1_10015346 | rootH1_100153462 | 262 |
| 178 | 3300003323 | rootH1_10024313 | rootH1_100243133 | 262 |
| 179 | 3300003323 | rootH1_10082241 | rootH1_100822413 | 262 |
| 180 | 3300003751 | Ga0055538_1000099 | Ga0055538_100009975 | 262 |
| 181 | 3300003752 | Ga0055539_1000147 | Ga0055539_100014775 | 262 |
| 182 | 3300003756 | Ga0055533_1000151 | Ga0055533_100015111 | 262 |
| 183 | 3300003758 | Ga0055532_1000108 | Ga0055532_100010874 | 262 |
| 184 | 3300003759 | Ga0055525_1000199 | Ga0055525_100019975 | 262 |
| 185 | 3300003761 | Ga0055535_1005776 | Ga0055535_10057762 | 262 |
| 186 | 3300003771 | Ga0055526_1000296 | Ga0055526_100029631 | 262 |
| 187 | 3300003841 | Ga0055541_1000099 | Ga0055541_100009912 | 262 |
| 188 | 3300005288 | Ga0065714_10003563 | Ga0065714_100035634 | 262 |
| 189 | 3300005288 | Ga0065714_10005194 | Ga0065714_100051944 | 262 |
| 190 | 3300005288 | Ga0065714_10075280 | Ga0065714_100752803 | 262 |
| 191 | 3300005331 | Ga0070670_100006151 | Ga0070670_1000061513 | 262 |
| 192 | 3300005344 | Ga0070661_100000081 | Ga0070661_1000000814 | 262 |
| 193 | 3300005353 | Ga0070669_100002322 | Ga0070669_1000023224 | 262 |
| 194 | 3300005353 | Ga0070669_100036015 | Ga0070669_1000360153 | 262 |
| 195 | 3300005435 | Ga0070714_100293439 | Ga0070714_1002934392 | 262 |
| 196 | 3300005441 | Ga0070700_100325297 | Ga0070700_1003252971 | 262 |
| 197 | 3300005457 | Ga0070662_100000351 | Ga0070662_10000035113 | 262 |
| 198 | 3300005539 | Ga0068853_100062262 | Ga0068853_1000622622 | 262 |
| 199 | 3300005539 | Ga0068853_100239588 | Ga0068853_1002395881 | 262 |
| 200 | 3300005548 | Ga0070665_100018543 | Ga0070665_1000185433 | 262 |
| 201 | 3300005563 | Ga0068855_100002732 | Ga0068855_1000027325 | 262 |
| 202 | 3300005564 | Ga0070664_100000139 | Ga0070664_10000013922 | 262 |
| 203 | 3300005564 | Ga0070664_100264008 | Ga0070664_1002640081 | 262 |
| 204 | 3300005578 | Ga0068854_100009910 | Ga0068854_1000099102 | 262 |
| 205 | 3300005616 | Ga0068852_100006625 | Ga0068852_1000066257 | 262 |
| 206 | 3300005834 | Ga0068851_10000153 | Ga0068851_1000015336 | 262 |
| 207 | 3300005841 | Ga0068863_100061145 | Ga0068863_1000611452 | 262 |
| 208 | 3300005843 | Ga0068860_100053043 | Ga0068860_1000530432 | 262 |
| 209 | 3300005843 | Ga0068860_100136359 | Ga0068860_1001363592 | 262 |
| 210 | 3300006028 | Ga0070717_10091481 | Ga0070717_100914812 | 262 |
| 211 | 3300006051 | Ga0075364_10131376 | Ga0075364_101313762 | 262 |
| 212 | 3300006058 | Ga0075432_10000690 | Ga0075432_100006906 | 262 |
| 213 | 3300006195 | Ga0075366_10002750 | Ga0075366_100027507 | 262 |
| 214 | 3300006195 | Ga0075366_10085613 | Ga0075366_100856132 | 262 |
| 215 | 3300006353 | Ga0075370_10007960 | Ga0075370_100079603 | 262 |
| 216 | 3300009011 | Ga0105251_10000637 | Ga0105251_1000063717 | 262 |
| 217 | 3300009011 | Ga0105251_10007326 | Ga0105251_100073268 | 262 |
| 218 | 3300009011 | Ga0105251_10011398 | Ga0105251_100113983 | 262 |
| 219 | 3300009036 | Ga0105244_10001073 | Ga0105244_100010736 | 262 |
| 220 | 3300009036 | Ga0105244_10002639 | Ga0105244_100026393 | 262 |
| 221 | 3300009036 | Ga0105244_10040282 | Ga0105244_100402822 | 262 |
| 222 | 3300009092 | Ga0105250_10043374 | Ga0105250_100433742 | 262 |
| 223 | 3300009093 | Ga0105240_10005332 | Ga0105240_100053328 | 262 |
| 224 | 3300009148 | Ga0105243_10000480 | Ga0105243_1000048013 | 262 |
| 225 | 3300009176 | Ga0105242_10000964 | Ga0105242_1000096426 | 262 |
| 226 | 3300009545 | Ga0105237_10153001 | Ga0105237_101530012 | 262 |
| 227 | 3300009551 | Ga0105238_10020373 | Ga0105238_100203733 | 262 |
| 228 | 3300009553 | Ga0105249_11029158 | Ga0105249_110291581 | 262 |
| 229 | 3300013102 | Ga0157371_10000115 | Ga0157371_1000011572 | 262 |
| 230 | 3300013102 | Ga0157371_10000788 | Ga0157371_100007888 | 262 |
| 231 | 3300013102 | Ga0157371_10129583 | Ga0157371_101295832 | 262 |
| 232 | 3300013102 | Ga0157371_10215647 | Ga0157371_102156472 | 262 |
| 233 | 3300013104 | Ga0157370_10002111 | Ga0157370_1000211114 | 262 |
| 234 | 3300013104 | Ga0157370_10113715 | Ga0157370_101137152 | 262 |
| 235 | 3300013104 | Ga0157370_10165503 | Ga0157370_101655032 | 262 |
| 236 | 3300013105 | Ga0157369_10001753 | Ga0157369_1000175327 | 262 |
| 237 | 3300013105 | Ga0157369_10514757 | Ga0157369_105147572 | 262 |
| 238 | 3300013306 | Ga0163162_10000095 | Ga0163162_1000009553 | 262 |
| 239 | 3300013307 | Ga0157372_10164808 | Ga0157372_101648082 | 262 |
| 240 | 3300013308 | Ga0157375_10001188 | Ga0157375_1000118823 | 262 |
| 241 | 3300013308 | Ga0157375_10006323 | Ga0157375_100063234 | 262 |
| 242 | 3300014497 | Ga0182008_10000352 | Ga0182008_1000035233 | 262 |
| 243 | 3300014497 | Ga0182008_10002951 | Ga0182008_100029516 | 262 |
| 244 | 3300014497 | Ga0182008_10037244 | Ga0182008_100372442 | 262 |
| 245 | 3300015261 | Ga0182006_1000389 | Ga0182006_10003894 | 262 |
| 246 | 3300015262 | Ga0182007_10004403 | Ga0182007_100044032 | 262 |
| 247 | 3300015265 | Ga0182005_1000055 | Ga0182005_100005582 | 262 |
| 248 | 3300015265 | Ga0182005_1008262 | Ga0182005_10082622 | 262 |
| 249 | 3300017792 | Ga0163161_10015507 | Ga0163161_100155074 | 262 |
| 250 | 3300025207 | Ga0209760_100039 | Ga0209760_10003946 | 262 |
| 251 | 3300025224 | Ga0209784_100015 | Ga0209784_100015350 | 262 |
| 252 | 3300025225 | Ga0209566_100012 | Ga0209566_100012350 | 262 |
| 253 | 3300025226 | Ga0209674_100027 | Ga0209674_100027350 | 262 |
| 254 | 3300025229 | Ga0209147_100019 | Ga0209147_100019350 | 262 |
| 255 | 3300025230 | Ga0209563_100031 | Ga0209563_100031350 | 262 |
| 256 | 3300025231 | Ga0207427_100001 | Ga0207427_100001720 | 262 |
| 257 | 3300025233 | Ga0209437_100003 | Ga0209437_100003652 | 262 |
| 258 | 3300025233 | Ga0209437_103142 | Ga0209437_1031422 | 262 |
| 259 | 3300025242 | Ga0209258_100364 | Ga0209258_1003649 | 262 |
| 260 | 3300025245 | Ga0207425_1000259 | Ga0207425_100025932 | 262 |
| 261 | 3300025246 | Ga0209646_1000199 | Ga0209646_100019926 | 262 |
| 262 | 3300025253 | Ga0209677_100016 | Ga0209677_100016350 | 262 |
| 263 | 3300025256 | Ga0209759_1000033 | Ga0209759_100003334 | 262 |
| 264 | 3300025258 | Ga0209129_1000175 | Ga0209129_100017548 | 262 |
| 265 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007720 | 262 |
| 266 | 3300025261 | Ga0209233_1024030 | Ga0209233_10240302 | 262 |
| 267 | 3300025295 | Ga0209564_1000136 | Ga0209564_1000136118 | 262 |
| 268 | 3300025297 | Ga0209758_1000275 | Ga0209758_100027567 | 262 |
| 269 | 3300025298 | Ga0209050_1000247 | Ga0209050_100024765 | 262 |
| 270 | 3300025321 | Ga0207656_10000074 | Ga0207656_1000007436 | 262 |
| 271 | 3300025728 | Ga0207655_1000250 | Ga0207655_100025031 | 262 |
| 272 | 3300025728 | Ga0207655_1000325 | Ga0207655_100032533 | 262 |
| 273 | 3300025728 | Ga0207655_1001605 | Ga0207655_10016056 | 262 |
| 274 | 3300025728 | Ga0207655_1032026 | Ga0207655_10320262 | 262 |
| 275 | 3300025735 | Ga0207713_1000819 | Ga0207713_100081915 | 262 |
| 276 | 3300025735 | Ga0207713_1010502 | Ga0207713_10105024 | 262 |
| 277 | 3300025735 | Ga0207713_1011993 | Ga0207713_10119935 | 262 |
| 278 | 3300025913 | Ga0207695_10004475 | Ga0207695_100044757 | 262 |
| 279 | 3300025914 | Ga0207671_10000566 | Ga0207671_1000056650 | 262 |
| 280 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002180 | 262 |
| 281 | 3300025923 | Ga0207681_10003046 | Ga0207681_100030464 | 262 |
| 282 | 3300025923 | Ga0207681_10041536 | Ga0207681_100415363 | 262 |
| 283 | 3300025924 | Ga0207694_10232014 | Ga0207694_102320143 | 262 |
| 284 | 3300025925 | Ga0207650_10000621 | Ga0207650_1000062114 | 262 |
| 285 | 3300025933 | Ga0207706_10000127 | Ga0207706_1000012755 | 262 |
| 286 | 3300025934 | Ga0207686_10003977 | Ga0207686_100039775 | 262 |
| 287 | 3300025935 | Ga0207709_10001023 | Ga0207709_1000102314 | 262 |
| 288 | 3300025945 | Ga0207679_10000006 | Ga0207679_10000006311 | 262 |
| 289 | 3300025949 | Ga0207667_10004150 | Ga0207667_100041509 | 262 |
| 290 | 3300025949 | Ga0207667_10397062 | Ga0207667_103970622 | 262 |
| 291 | 3300025981 | Ga0207640_10018539 | Ga0207640_100185393 | 262 |
| 292 | 3300026041 | Ga0207639_10011324 | Ga0207639_100113246 | 262 |
| 293 | 3300026041 | Ga0207639_10121482 | Ga0207639_101214822 | 262 |
| 294 | 3300026088 | Ga0207641_10116066 | Ga0207641_101160661 | 262 |
| 295 | 3300027614 | Ga0209970_1000492 | Ga0209970_10004922 | 262 |
| 296 | 3300027907 | Ga0207428_10002286 | Ga0207428_100022863 | 262 |
| 297 | 3300028379 | Ga0268266_10054139 | Ga0268266_100541392 | 262 |
| 298 | 3300028380 | Ga0268265_10024597 | Ga0268265_100245973 | 262 |
| 299 | 3300028786 | Ga0307517_10289765 | Ga0307517_102897651 | 262 |
| 300 | 3300028800 | Ga0265338_10030476 | Ga0265338_100304763 | 262 |
| 301 | 3300031239 | Ga0265328_10063747 | Ga0265328_100637472 | 262 |
| 302 | 3300031251 | Ga0265327_10000266 | Ga0265327_10000266101 | 262 |
| 303 | 3300031251 | Ga0265327_10001259 | Ga0265327_1000125922 | 262 |
| 304 | 3300031548 | Ga0307408_100169281 | Ga0307408_1001692812 | 262 |
| 305 | 3300031730 | Ga0307516_10013066 | Ga0307516_100130662 | 262 |
| 306 | 3300031911 | Ga0307412_10016220 | Ga0307412_100162202 | 262 |
| 307 | 3300031911 | Ga0307412_10178095 | Ga0307412_101780952 | 262 |
| 308 | 3300037068 | Ga0373925_0040516 | Ga0373925_0040516_2306_3118 | 262 |
| 309 | 3300037312 | Ga0395899_0051379 | Ga0395899_0051379_19_810 | 262 |
| 310 | 3300037312 | Ga0395899_0170161 | Ga0395899_0170161_353_1144 | 262 |
| 311 | 3300037418 | Ga0395900_0014754 | Ga0395900_0014754_5789_6577 | 262 |
| 312 | 3300037418 | Ga0395900_0356133 | Ga0395900_0356133_196_984 | 262 |
| 313 | 3300037418 | Ga0395900_0690779 | Ga0395900_0690779_140_931 | 262 |
| 314 | 3300037466 | Ga0395898_0517389 | Ga0395898_0517389_24_815 | 262 |
| 315 | 3300037466 | Ga0395898_0848856 | Ga0395898_0848856_24_815 | 262 |
| 316 | 3300037471 | Ga0395905_0018276 | Ga0395905_0018276_866_1657 | 262 |
| 317 | 3300037471 | Ga0395905_0083477 | Ga0395905_0083477_510_1298 | 262 |
| 318 | 3300037471 | Ga0395905_0470621 | Ga0395905_0470621_140_931 | 262 |
| 319 | 3300037853 | Ga0436364_1500992 | Ga0436364_1500992_66_863 | 262 |
| 320 | 3300038443 | Ga0395901_0169177 | Ga0395901_0169177_1206_1994 | 262 |
| 321 | 3300038443 | Ga0395901_0255426 | Ga0395901_0255426_459_1247 | 262 |
| 322 | 3300038443 | Ga0395901_0769172 | Ga0395901_0769172_24_815 | 262 |
| 323 | 3300041407 | Ga0439447_000608 | Ga0439447_000608_4397_5185 | 262 |
| 324 | 3300041407 | Ga0439447_033219 | Ga0439447_033219_460_1251 | 262 |
| 325 | 3300041413 | Ga0439465_0096135 | Ga0439465_0096135_127_915 | 262 |
| 326 | 3300041443 | Ga0451789_1213403 | Ga0451789_1213403_619_1410 | 262 |
| 327 | 3300041458 | Ga0451798_0026135 | Ga0451798_0026135_352_1143 | 262 |
| 328 | 3300042006 | Ga0439432_046290 | Ga0439432_046290_117_905 | 262 |
| 329 | 3300042010 | Ga0439452_000329 | Ga0439452_000329_17341_18129 | 262 |
| 330 | 3300042137 | Ga0450902_000221 | Ga0450902_000221_2631_3419 | 262 |
| 331 | 3300044656 | Ga0466969_0055611 | Ga0466969_0055611_1009_1800 | 262 |
| 332 | 3300044684 | Ga0466966_0010921 | Ga0466966_0010921_2798_3598 | 262 |
| 333 | 3300044693 | Ga0466961_0135943 | Ga0466961_0135943_22_822 | 262 |
| 334 | 3300044694 | Ga0466963_0053293 | Ga0466963_0053293_905_1696 | 262 |
| 335 | 3300044735 | Ga0466968_0000406 | Ga0466968_0000406_7986_8801 | 262 |
| 336 | 3300045049 | Ga0466959_0019340 | Ga0466959_0019340_2010_2810 | 262 |
| 337 | 3300045976 | Ga0466967_0010897 | Ga0466967_0010897_5013_5804 | 262 |
| 338 | 3300045976 | Ga0466967_0155763 | Ga0466967_0155763_1137_1952 | 262 |
| 339 | 3300046452 | Ga0495617_001372 | Ga0495617_001372_4346_5134 | 262 |
| 340 | 3300046452 | Ga0495617_017418 | Ga0495617_017418_519_1307 | 262 |
| 341 | 3300046453 | Ga0495627_000031 | Ga0495627_000031_147501_148289 | 262 |
| 342 | 3300046453 | Ga0495627_006756 | Ga0495627_006756_1017_1808 | 262 |
| 343 | 3300046454 | Ga0495592_0093928 | Ga0495592_0093928_569_1360 | 262 |
| 344 | 3300046455 | Ga0495603_0060554 | Ga0495603_0060554_97_885 | 262 |
| 345 | 3300046457 | Ga0495590_0100824 | Ga0495590_0100824_78_866 | 262 |
| 346 | 3300046458 | Ga0495591_000005 | Ga0495591_000005_319768_320556 | 262 |
| 347 | 3300046458 | Ga0495591_000900 | Ga0495591_000900_9861_10649 | 262 |
| 348 | 3300046458 | Ga0495591_001235 | Ga0495591_001235_754_1545 | 262 |
| 349 | 3300046458 | Ga0495591_002447 | Ga0495591_002447_1163_1951 | 262 |
| 350 | 3300046458 | Ga0495591_003161 | Ga0495591_003161_6412_7272 | 262 |
| 351 | 3300046459 | Ga0495629_0000160 | Ga0495629_0000160_26348_27139 | 262 |
| 352 | 3300046459 | Ga0495629_0013424 | Ga0495629_0013424_1082_1873 | 262 |
| 353 | 3300046460 | Ga0495638_0001043 | Ga0495638_0001043_19185_19976 | 262 |
| 354 | 3300046460 | Ga0495638_0003860 | Ga0495638_0003860_7497_8285 | 262 |
| 355 | 3300046460 | Ga0495638_0014085 | Ga0495638_0014085_1055_1846 | 262 |
| 356 | 3300046460 | Ga0495638_0034890 | Ga0495638_0034890_235_1026 | 262 |
| 357 | 3300046460 | Ga0495638_0159871 | Ga0495638_0159871_30_818 | 262 |
| 358 | 3300046460 | Ga0495638_0182939 | Ga0495638_0182939_224_1012 | 262 |
| 359 | 3300046462 | Ga0495651_0077070 | Ga0495651_0077070_1521_2312 | 262 |
| 360 | 3300046463 | Ga0495653_0000434 | Ga0495653_0000434_16733_17521 | 262 |
| 361 | 3300046463 | Ga0495653_0010954 | Ga0495653_0010954_636_1424 | 262 |
| 362 | 3300046471 | Ga0495650_0000405 | Ga0495650_0000405_22829_23617 | 262 |
| 363 | 3300046471 | Ga0495650_0001089 | Ga0495650_0001089_15165_15956 | 262 |
| 364 | 3300046471 | Ga0495650_0002844 | Ga0495650_0002844_12070_12858 | 262 |
| 365 | 3300046471 | Ga0495650_0003246 | Ga0495650_0003246_723_1511 | 262 |
| 366 | 3300046471 | Ga0495650_0062890 | Ga0495650_0062890_255_1046 | 262 |
| 367 | 3300046472 | Ga0495580_0087310 | Ga0495580_0087310_431_1222 | 262 |
| 368 | 3300046473 | Ga0495582_0051614 | Ga0495582_0051614_1076_1867 | 262 |
| 369 | 3300046473 | Ga0495582_0101061 | Ga0495582_0101061_500_1291 | 262 |
| 370 | 3300046474 | Ga0495605_0000219 | Ga0495605_0000219_16245_17033 | 262 |
| 371 | 3300046474 | Ga0495605_0007400 | Ga0495605_0007400_1614_2405 | 262 |
| 372 | 3300046474 | Ga0495605_0022199 | Ga0495605_0022199_1977_2765 | 262 |
| 373 | 3300046474 | Ga0495605_0097769 | Ga0495605_0097769_243_1031 | 262 |
| 374 | 3300046475 | Ga0495639_0046860 | Ga0495639_0046860_730_1521 | 262 |
| 375 | 3300046475 | Ga0495639_0050595 | Ga0495639_0050595_999_1787 | 262 |
| 376 | 3300046477 | Ga0495664_0037859 | Ga0495664_0037859_854_1645 | 262 |
| 377 | 3300046491 | Ga0495584_0004304 | Ga0495584_0004304_760_1548 | 262 |
| 378 | 3300046491 | Ga0495584_0034167 | Ga0495584_0034167_269_1129 | 262 |
| 379 | 3300046492 | Ga0495585_0000551 | Ga0495585_0000551_31600_32391 | 262 |
| 380 | 3300046492 | Ga0495585_0002544 | Ga0495585_0002544_8432_9220 | 262 |
| 381 | 3300046492 | Ga0495585_0008977 | Ga0495585_0008977_373_1161 | 262 |
| 382 | 3300046492 | Ga0495585_0020021 | Ga0495585_0020021_1366_2154 | 262 |
| 383 | 3300046500 | Ga0495596_0000010 | Ga0495596_0000010_71209_71997 | 262 |
| 384 | 3300046500 | Ga0495596_0000028 | Ga0495596_0000028_82657_83445 | 262 |
| 385 | 3300046500 | Ga0495596_0000132 | Ga0495596_0000132_3496_4284 | 262 |
| 386 | 3300046500 | Ga0495596_0043654 | Ga0495596_0043654_300_1091 | 262 |
| 387 | 3300046500 | Ga0495596_0075564 | Ga0495596_0075564_330_1118 | 262 |
| 388 | 3300046501 | Ga0495607_0003360 | Ga0495607_0003360_3719_4507 | 262 |
| 389 | 3300046501 | Ga0495607_0022265 | Ga0495607_0022265_1291_2079 | 262 |
| 390 | 3300046501 | Ga0495607_0025790 | Ga0495607_0025790_2684_3472 | 262 |
| 391 | 3300046501 | Ga0495607_0027353 | Ga0495607_0027353_1126_1914 | 262 |
| 392 | 3300046501 | Ga0495607_0169027 | Ga0495607_0169027_14_802 | 262 |
| 393 | 3300046506 | Ga0495583_0000151 | Ga0495583_0000151_41996_42784 | 262 |
| 394 | 3300046506 | Ga0495583_0000334 | Ga0495583_0000334_31689_32477 | 262 |
| 395 | 3300046506 | Ga0495583_0002225 | Ga0495583_0002225_7104_7892 | 262 |
| 396 | 3300046506 | Ga0495583_0003405 | Ga0495583_0003405_91_879 | 262 |
| 397 | 3300046506 | Ga0495583_0003426 | Ga0495583_0003426_5674_6462 | 262 |
| 398 | 3300046507 | Ga0495606_0001711 | Ga0495606_0001711_5569_6357 | 262 |
| 399 | 3300046507 | Ga0495606_0002465 | Ga0495606_0002465_339_1127 | 262 |
| 400 | 3300046507 | Ga0495606_0007586 | Ga0495606_0007586_7182_7970 | 262 |
| 401 | 3300046507 | Ga0495606_0024635 | Ga0495606_0024635_2428_3219 | 262 |
| 402 | 3300046507 | Ga0495606_0027422 | Ga0495606_0027422_1742_2533 | 262 |
| 403 | 3300046507 | Ga0495606_0116002 | Ga0495606_0116002_793_1584 | 262 |
| 404 | 3300046507 | Ga0495606_0123203 | Ga0495606_0123203_513_1304 | 262 |
| 405 | 3300046511 | Ga0495608_0020916 | Ga0495608_0020916_3545_4336 | 262 |
| 406 | 3300046512 | Ga0495610_0000287 | Ga0495610_0000287_24920_25708 | 262 |
| 407 | 3300046512 | Ga0495610_0003015 | Ga0495610_0003015_9166_9954 | 262 |
| 408 | 3300046512 | Ga0495610_0012735 | Ga0495610_0012735_1576_2364 | 262 |
| 409 | 3300046512 | Ga0495610_0085625 | Ga0495610_0085625_380_1168 | 262 |
| 410 | 3300046512 | Ga0495610_0121672 | Ga0495610_0121672_148_936 | 262 |
| 411 | 3300046514 | Ga0495618_0005918 | Ga0495618_0005918_1150_1941 | 262 |
| 412 | 3300046515 | Ga0495620_0004145 | Ga0495620_0004145_1519_2307 | 262 |
| 413 | 3300046515 | Ga0495620_0005836 | Ga0495620_0005836_1614_2402 | 262 |
| 414 | 3300046515 | Ga0495620_0031070 | Ga0495620_0031070_1073_1861 | 262 |
| 415 | 3300046516 | Ga0495628_0005536 | Ga0495628_0005536_8718_9509 | 262 |
| 416 | 3300046517 | Ga0495630_0010794 | Ga0495630_0010794_2558_3346 | 262 |
| 417 | 3300046517 | Ga0495630_0024678 | Ga0495630_0024678_3388_4179 | 262 |
| 418 | 3300046518 | Ga0495631_0000117 | Ga0495631_0000117_32790_33578 | 262 |
| 419 | 3300046518 | Ga0495631_0016675 | Ga0495631_0016675_922_1710 | 262 |
| 420 | 3300046518 | Ga0495631_0177538 | Ga0495631_0177538_50_838 | 262 |
| 421 | 3300046519 | Ga0495632_0000102 | Ga0495632_0000102_54634_55425 | 262 |
| 422 | 3300046519 | Ga0495632_0000661 | Ga0495632_0000661_9772_10560 | 262 |
| 423 | 3300046519 | Ga0495632_0000950 | Ga0495632_0000950_23054_23845 | 262 |
| 424 | 3300046519 | Ga0495632_0001670 | Ga0495632_0001670_8372_9160 | 262 |
| 425 | 3300046519 | Ga0495632_0003923 | Ga0495632_0003923_7140_7931 | 262 |
| 426 | 3300046519 | Ga0495632_0004390 | Ga0495632_0004390_4137_4925 | 262 |
| 427 | 3300046519 | Ga0495632_0014538 | Ga0495632_0014538_1620_2408 | 262 |
| 428 | 3300046519 | Ga0495632_0014996 | Ga0495632_0014996_3370_4158 | 262 |
| 429 | 3300046519 | Ga0495632_0019088 | Ga0495632_0019088_1827_2618 | 262 |
| 430 | 3300046519 | Ga0495632_0050331 | Ga0495632_0050331_373_1161 | 262 |
| 431 | 3300046520 | Ga0495637_0000074 | Ga0495637_0000074_61406_62197 | 262 |
| 432 | 3300046520 | Ga0495637_0000082 | Ga0495637_0000082_31217_32005 | 262 |
| 433 | 3300046520 | Ga0495637_0000476 | Ga0495637_0000476_13705_14493 | 262 |
| 434 | 3300046520 | Ga0495637_0000597 | Ga0495637_0000597_17801_18589 | 262 |
| 435 | 3300046520 | Ga0495637_0009926 | Ga0495637_0009926_1974_2762 | 262 |
| 436 | 3300046520 | Ga0495637_0053360 | Ga0495637_0053360_177_965 | 262 |
| 437 | 3300046520 | Ga0495637_0076070 | Ga0495637_0076070_412_1200 | 262 |
| 438 | 3300046522 | Ga0495643_0001044 | Ga0495643_0001044_22509_23297 | 262 |
| 439 | 3300046522 | Ga0495643_0020348 | Ga0495643_0020348_1179_1967 | 262 |
| 440 | 3300046522 | Ga0495643_0049734 | Ga0495643_0049734_388_1176 | 262 |
| 441 | 3300046522 | Ga0495643_0166629 | Ga0495643_0166629_120_911 | 262 |
| 442 | 3300046523 | Ga0495644_0005721 | Ga0495644_0005721_1078_1866 | 262 |
| 443 | 3300046523 | Ga0495644_0012548 | Ga0495644_0012548_84_872 | 262 |
| 444 | 3300046523 | Ga0495644_0026090 | Ga0495644_0026090_791_1579 | 262 |
| 445 | 3300046524 | Ga0495648_0000093 | Ga0495648_0000093_59131_59922 | 262 |
| 446 | 3300046524 | Ga0495648_0001459 | Ga0495648_0001459_16354_17142 | 262 |
| 447 | 3300046524 | Ga0495648_0006203 | Ga0495648_0006203_7132_7920 | 262 |
| 448 | 3300046524 | Ga0495648_0008616 | Ga0495648_0008616_1042_1830 | 262 |
| 449 | 3300046526 | Ga0495666_0004392 | Ga0495666_0004392_2839_3630 | 262 |
| 450 | 3300046528 | Ga0495642_0001229 | Ga0495642_0001229_755_1546 | 262 |
| 451 | 3300046529 | Ga0495652_0002282 | Ga0495652_0002282_8627_9418 | 262 |
| 452 | 3300046530 | Ga0495654_0000352 | Ga0495654_0000352_6674_7462 | 262 |
| 453 | 3300046530 | Ga0495654_0000462 | Ga0495654_0000462_29254_30042 | 262 |
| 454 | 3300046530 | Ga0495654_0001145 | Ga0495654_0001145_8424_9212 | 262 |
| 455 | 3300046530 | Ga0495654_0002780 | Ga0495654_0002780_2616_3404 | 262 |
| 456 | 3300046530 | Ga0495654_0009697 | Ga0495654_0009697_1048_1836 | 262 |
| 457 | 3300046530 | Ga0495654_0047522 | Ga0495654_0047522_1138_1929 | 262 |
| 458 | 3300046530 | Ga0495654_0071568 | Ga0495654_0071568_335_1126 | 262 |
| 459 | 3300046531 | Ga0495665_0006976 | Ga0495665_0006976_5024_5815 | 262 |
| 460 | 3300046535 | Ga0495586_0047858 | Ga0495586_0047858_1235_2026 | 262 |
| 461 | 3300046535 | Ga0495586_0118789 | Ga0495586_0118789_405_1196 | 262 |
| 462 | 3300046535 | Ga0495586_0134457 | Ga0495586_0134457_577_1368 | 262 |
| 463 | 3300046536 | Ga0495587_0092093 | Ga0495587_0092093_111_902 | 262 |
| 464 | 3300046538 | Ga0495609_0000034 | Ga0495609_0000034_92780_93568 | 262 |
| 465 | 3300046538 | Ga0495609_0000043 | Ga0495609_0000043_134336_135124 | 262 |
| 466 | 3300046538 | Ga0495609_0000217 | Ga0495609_0000217_36226_37014 | 262 |
| 467 | 3300046542 | Ga0495597_0004246 | Ga0495597_0004246_6007_6795 | 262 |
| 468 | 3300046542 | Ga0495597_0012908 | Ga0495597_0012908_2433_3224 | 262 |
| 469 | 3300046542 | Ga0495597_0017524 | Ga0495597_0017524_1552_2340 | 262 |
| 470 | 3300046542 | Ga0495597_0017790 | Ga0495597_0017790_1943_2734 | 262 |
| 471 | 3300046543 | Ga0495645_0000466 | Ga0495645_0000466_728_1519 | 262 |
| 472 | 3300046543 | Ga0495645_0020662 | Ga0495645_0020662_3663_4454 | 262 |
| 473 | 3300046543 | Ga0495645_0032404 | Ga0495645_0032404_1548_2339 | 262 |
| 474 | 3300046557 | Ga0495622_0000017 | Ga0495622_0000017_136279_137070 | 262 |
| 475 | 3300046557 | Ga0495622_0003205 | Ga0495622_0003205_5260_6048 | 262 |
| 476 | 3300046557 | Ga0495622_0034856 | Ga0495622_0034856_517_1305 | 262 |
| 477 | 3300046558 | Ga0495633_0000165 | Ga0495633_0000165_75466_76254 | 262 |
| 478 | 3300046559 | Ga0495667_0017394 | Ga0495667_0017394_709_1500 | 262 |
| 479 | 3300046616 | Ga0495668_0000238 | Ga0495668_0000238_13461_14249 | 262 |
| 480 | 3300046616 | Ga0495668_0000503 | Ga0495668_0000503_33701_34489 | 262 |
| 481 | 3300046616 | Ga0495668_0004158 | Ga0495668_0004158_5878_6669 | 262 |
| 482 | 3300046616 | Ga0495668_0008635 | Ga0495668_0008635_3691_4479 | 262 |
| 483 | 3300046642 | Ga0495634_0142378 | Ga0495634_0142378_528_1319 | 262 |
| 484 | 3300046648 | Ga0495611_0000475 | Ga0495611_0000475_21942_22733 | 262 |
| 485 | 3300046648 | Ga0495611_0000485 | Ga0495611_0000485_8218_9006 | 262 |
| 486 | 3300046648 | Ga0495611_0004026 | Ga0495611_0004026_2568_3356 | 262 |
| 487 | 3300046660 | Ga0495625_0000101 | Ga0495625_0000101_77789_78577 | 262 |
| 488 | 3300046660 | Ga0495625_0003863 | Ga0495625_0003863_6869_7660 | 262 |
| 489 | 3300046660 | Ga0495625_0005733 | Ga0495625_0005733_5711_6499 | 262 |
| 490 | 3300046660 | Ga0495625_0007856 | Ga0495625_0007856_924_1712 | 262 |
| 491 | 3300046660 | Ga0495625_0096092 | Ga0495625_0096092_787_1575 | 262 |
| 492 | 3300046665 | Ga0495661_0000024 | Ga0495661_0000024_126971_127759 | 262 |
| 493 | 3300046665 | Ga0495661_0000143 | Ga0495661_0000143_7148_7936 | 262 |
| 494 | 3300046665 | Ga0495661_0006203 | Ga0495661_0006203_5669_6457 | 262 |
| 495 | 3300046665 | Ga0495661_0010038 | Ga0495661_0010038_230_1021 | 262 |
| 496 | 3300046665 | Ga0495661_0011066 | Ga0495661_0011066_3697_4485 | 262 |
| 497 | 3300046665 | Ga0495661_0031972 | Ga0495661_0031972_2392_3183 | 262 |
| 498 | 3300046665 | Ga0495661_0045604 | Ga0495661_0045604_779_1570 | 262 |
| 499 | 3300046665 | Ga0495661_0084625 | Ga0495661_0084625_476_1264 | 262 |
| 500 | 3300046675 | Ga0495657_0225531 | Ga0495657_0225531_229_1020 | 262 |
| 501 | 3300046678 | Ga0495599_0192945 | Ga0495599_0192945_224_1015 | 262 |
| 502 | 3300046679 | Ga0495623_0000068 | Ga0495623_0000068_19939_20727 | 262 |
| 503 | 3300046679 | Ga0495623_0001196 | Ga0495623_0001196_367_1158 | 262 |
| 504 | 3300046679 | Ga0495623_0003843 | Ga0495623_0003843_2886_3677 | 262 |
| 505 | 3300046679 | Ga0495623_0016582 | Ga0495623_0016582_3242_4033 | 262 |
| 506 | 3300046679 | Ga0495623_0242701 | Ga0495623_0242701_192_983 | 262 |
| 507 | 3300046680 | Ga0495646_0032940 | Ga0495646_0032940_73_864 | 262 |
| 508 | 3300046684 | Ga0495669_0050553 | Ga0495669_0050553_385_1176 | 262 |
| 509 | 3300046689 | Ga0495613_0011354 | Ga0495613_0011354_2242_3030 | 262 |
| 510 | 3300046690 | Ga0495624_0089518 | Ga0495624_0089518_668_1456 | 262 |
| 511 | 3300046690 | Ga0495624_0107895 | Ga0495624_0107895_391_1182 | 262 |
| 512 | 3300046691 | Ga0495670_0000021 | Ga0495670_0000021_45696_46484 | 262 |
| 513 | 3300046691 | Ga0495670_0005114 | Ga0495670_0005114_615_1403 | 262 |
| 514 | 3300046691 | Ga0495670_0007216 | Ga0495670_0007216_1109_1897 | 262 |
| 515 | 3300046691 | Ga0495670_0131631 | Ga0495670_0131631_344_1135 | 262 |
| 516 | 3300046692 | Ga0495671_0002059 | Ga0495671_0002059_6784_7572 | 262 |
| 517 | 3300046692 | Ga0495671_0003858 | Ga0495671_0003858_1825_2616 | 262 |
| 518 | 3300046692 | Ga0495671_0007495 | Ga0495671_0007495_4565_5353 | 262 |
| 519 | 3300046692 | Ga0495671_0028235 | Ga0495671_0028235_1378_2169 | 262 |
| 520 | 3300046692 | Ga0495671_0095146 | Ga0495671_0095146_235_1023 | 262 |
| 521 | 3300046694 | Ga0495649_0001521 | Ga0495649_0001521_1598_2389 | 262 |
| 522 | 3300046694 | Ga0495649_0022444 | Ga0495649_0022444_1178_1969 | 262 |
| 523 | 3300046694 | Ga0495649_0049626 | Ga0495649_0049626_639_1430 | 262 |
| 524 | 3300046794 | Ga0495589_0000255 | Ga0495589_0000255_37128_37916 | 262 |
| 525 | 3300046794 | Ga0495589_0000681 | Ga0495589_0000681_13610_14398 | 262 |
| 526 | 3300046794 | Ga0495589_0016127 | Ga0495589_0016127_3000_3788 | 262 |
| 527 | 3300046794 | Ga0495589_0024701 | Ga0495589_0024701_1576_2364 | 262 |
| 528 | 3300046809 | Ga0495600_0049652 | Ga0495600_0049652_566_1354 | 262 |
| 529 | 3300046809 | Ga0495600_0078568 | Ga0495600_0078568_896_1687 | 262 |
| 530 | 3300046810 | Ga0495660_0000325 | Ga0495660_0000325_8725_9513 | 262 |
| 531 | 3300046810 | Ga0495660_0006667 | Ga0495660_0006667_2457_3245 | 262 |
| 532 | 3300046810 | Ga0495660_0007007 | Ga0495660_0007007_1428_2216 | 262 |
| 533 | 3300046810 | Ga0495660_0010416 | Ga0495660_0010416_1112_1900 | 262 |
| 534 | 3300046810 | Ga0495660_0046322 | Ga0495660_0046322_483_1271 | 262 |
| 535 | 3300046810 | Ga0495660_0055478 | Ga0495660_0055478_476_1264 | 262 |
| 536 | 3300046810 | Ga0495660_0058092 | Ga0495660_0058092_1208_1999 | 262 |
| 537 | 3300046810 | Ga0495660_0110899 | Ga0495660_0110899_486_1277 | 262 |
| 538 | 3300046810 | Ga0495660_0151786 | Ga0495660_0151786_158_949 | 262 |
| 539 | 3300047315 | Ga0495581_0007346 | Ga0495581_0007346_4866_5657 | 262 |
| 540 | 3300047317 | Ga0495604_0009667 | Ga0495604_0009667_371_1162 | 262 |
| 541 | 3300047317 | Ga0495604_0029323 | Ga0495604_0029323_856_1647 | 262 |
| 542 | 3300047319 | Ga0495674_0004590 | Ga0495674_0004590_9682_10473 | 262 |
| 543 | 3300047320 | Ga0495672_0001131 | Ga0495672_0001131_25263_26051 | 262 |
| 544 | 3300047320 | Ga0495672_0033024 | Ga0495672_0033024_1530_2318 | 262 |
| 545 | 3300047320 | Ga0495672_0063320 | Ga0495672_0063320_1048_1836 | 262 |
| 546 | 3300047321 | Ga0495676_0000071 | Ga0495676_0000071_31510_32298 | 262 |
| 547 | 3300047321 | Ga0495676_0008883 | Ga0495676_0008883_6441_7232 | 262 |
| 548 | 3300047322 | Ga0495680_0002429 | Ga0495680_0002429_15620_16411 | 262 |
| 549 | 3300047322 | Ga0495680_0039272 | Ga0495680_0039272_1103_1891 | 262 |
| 550 | 3300047323 | Ga0495683_0000849 | Ga0495683_0000849_19549_20337 | 262 |
| 551 | 3300047323 | Ga0495683_0002891 | Ga0495683_0002891_6227_7015 | 262 |
| 552 | 3300047323 | Ga0495683_0005326 | Ga0495683_0005326_3710_4498 | 262 |
| 553 | 3300047323 | Ga0495683_0010946 | Ga0495683_0010946_1017_1805 | 262 |
| 554 | 3300047323 | Ga0495683_0014936 | Ga0495683_0014936_240_1031 | 262 |
| 555 | 3300047443 | Ga0495687_000018 | Ga0495687_000018_123352_124143 | 262 |
| 556 | 3300047444 | Ga0495675_0000473 | Ga0495675_0000473_19404_20192 | 262 |
| 557 | 3300047444 | Ga0495675_0002160 | Ga0495675_0002160_3492_4280 | 262 |
| 558 | 3300047444 | Ga0495675_0011625 | Ga0495675_0011625_2903_3694 | 262 |
| 559 | 3300047444 | Ga0495675_0022924 | Ga0495675_0022924_1982_2773 | 262 |
| 560 | 3300047444 | Ga0495675_0051668 | Ga0495675_0051668_298_1089 | 262 |
| 561 | 3300047446 | Ga0495679_000064 | Ga0495679_000064_78622_79410 | 262 |
| 562 | 3300047446 | Ga0495679_000236 | Ga0495679_000236_11199_11987 | 262 |
| 563 | 3300047446 | Ga0495679_001857 | Ga0495679_001857_7581_8372 | 262 |
| 564 | 3300047469 | Ga0495673_0002335 | Ga0495673_0002335_9288_10079 | 262 |
| 565 | 3300047469 | Ga0495673_0002995 | Ga0495673_0002995_7323_8111 | 262 |
| 566 | 3300047469 | Ga0495673_0003146 | Ga0495673_0003146_8763_9551 | 262 |
| 567 | 3300047469 | Ga0495673_0003863 | Ga0495673_0003863_1379_2170 | 262 |
| 568 | 3300047469 | Ga0495673_0003972 | Ga0495673_0003972_7264_8052 | 262 |
| 569 | 3300047469 | Ga0495673_0005866 | Ga0495673_0005866_5259_6047 | 262 |
| 570 | 3300047469 | Ga0495673_0007314 | Ga0495673_0007314_4663_5451 | 262 |
| 571 | 3300047469 | Ga0495673_0020536 | Ga0495673_0020536_650_1438 | 262 |
| 572 | 3300047469 | Ga0495673_0054555 | Ga0495673_0054555_194_982 | 262 |
| 573 | 3300047469 | Ga0495673_0064357 | Ga0495673_0064357_197_985 | 262 |
| 574 | 3300047470 | Ga0495681_0000034 | Ga0495681_0000034_114593_115381 | 262 |
| 575 | 3300047470 | Ga0495681_0001515 | Ga0495681_0001515_13125_13913 | 262 |
| 576 | 3300047470 | Ga0495681_0002308 | Ga0495681_0002308_11463_12251 | 262 |
| 577 | 3300047470 | Ga0495681_0004761 | Ga0495681_0004761_4442_5233 | 262 |
| 578 | 3300047470 | Ga0495681_0017134 | Ga0495681_0017134_2073_2864 | 262 |
| 579 | 3300047470 | Ga0495681_0023117 | Ga0495681_0023117_1595_2383 | 262 |
| 580 | 3300047472 | Ga0495686_0001239 | Ga0495686_0001239_3101_3892 | 262 |
| 581 | 3300047472 | Ga0495686_0030833 | Ga0495686_0030833_1570_2361 | 262 |
| 582 | 3300047472 | Ga0495686_0134174 | Ga0495686_0134174_588_1376 | 262 |
| 583 | 3300047472 | Ga0495686_0158291 | Ga0495686_0158291_140_931 | 262 |
| 584 | 3300047673 | Ga0495593_0000045 | Ga0495593_0000045_31206_31994 | 262 |
| 585 | 3300047673 | Ga0495593_0031662 | Ga0495593_0031662_191_982 | 262 |
| 586 | 3300047673 | Ga0495593_0123531 | Ga0495593_0123531_228_1019 | 262 |
| 587 | 3300048088 | Ga0495602_0004432 | Ga0495602_0004432_10095_10886 | 262 |
| 588 | 3300048088 | Ga0495602_0049627 | Ga0495602_0049627_2321_3112 | 262 |
| 589 | 3300048088 | Ga0495602_0218242 | Ga0495602_0218242_449_1240 | 262 |
| 590 | 3300048089 | Ga0495614_0003119 | Ga0495614_0003119_2195_2986 | 262 |
| 591 | 3300048089 | Ga0495614_0061824 | Ga0495614_0061824_669_1460 | 262 |
| 592 | 3300048091 | Ga0495626_0000045 | Ga0495626_0000045_31134_31922 | 262 |
| 593 | 3300048091 | Ga0495626_0000166 | Ga0495626_0000166_14543_15331 | 262 |
| 594 | 3300048091 | Ga0495626_0000816 | Ga0495626_0000816_5221_6009 | 262 |
| 595 | 3300048903 | Ga0496100_0026260 | Ga0496100_0026260_178_969 | 262 |
| 596 | 3300048905 | Ga0496102_0001291 | Ga0496102_0001291_11093_11884 | 262 |
| 597 | 3300048905 | Ga0496102_0005827 | Ga0496102_0005827_2518_3309 | 262 |
| 598 | 3300048906 | Ga0496103_0017085 | Ga0496103_0017085_1367_2158 | 262 |
| 599 | 3300048907 | Ga0496104_0333105 | Ga0496104_0333105_89_901 | 262 |
| 600 | 3300048908 | Ga0496105_0016101 | Ga0496105_0016101_330_1121 | 262 |
| 601 | 3300048909 | Ga0496106_0002941 | Ga0496106_0002941_10639_11430 | 262 |
| 602 | 3300048910 | Ga0496107_0073685 | Ga0496107_0073685_709_1497 | 262 |
| 603 | 3300048910 | Ga0496107_0405998 | Ga0496107_0405998_178_969 | 262 |
| 604 | 3300048911 | Ga0496108_0432978 | Ga0496108_0432978_220_1011 | 262 |
| 605 | 3300048913 | Ga0496110_0454507 | Ga0496110_0454507_124_915 | 262 |
| 606 | 3300048917 | Ga0496114_0000816 | Ga0496114_0000816_10839_11630 | 262 |
| 607 | 3300048918 | Ga0496115_0333789 | Ga0496115_0333789_65_853 | 262 |
| 608 | 3300048919 | Ga0496116_0000366 | Ga0496116_0000366_31631_32419 | 262 |
| 609 | 3300048919 | Ga0496116_0003129 | Ga0496116_0003129_12634_13425 | 262 |
| 610 | 3300048920 | Ga0496117_0000708 | Ga0496117_0000708_20509_21297 | 262 |
| 611 | 3300048920 | Ga0496117_0003647 | Ga0496117_0003647_556_1347 | 262 |
| 612 | 3300048920 | Ga0496117_0118602 | Ga0496117_0118602_771_1559 | 262 |
| 613 | 3300048921 | Ga0496118_0000167 | Ga0496118_0000167_88255_89046 | 262 |
| 614 | 3300048921 | Ga0496118_0026815 | Ga0496118_0026815_1521_2312 | 262 |
| 615 | 3300048921 | Ga0496118_0029626 | Ga0496118_0029626_3199_3987 | 262 |
| 616 | 3300048922 | Ga0496119_0067523 | Ga0496119_0067523_201_992 | 262 |
| 617 | 3300048924 | Ga0496121_0000722 | Ga0496121_0000722_28622_29410 | 262 |
| 618 | 3300048924 | Ga0496121_0025971 | Ga0496121_0025971_2313_3104 | 262 |
| 619 | 3300048924 | Ga0496121_0029703 | Ga0496121_0029703_3097_3888 | 262 |
| 620 | 3300048924 | Ga0496121_0035577 | Ga0496121_0035577_475_1266 | 262 |
| 621 | 3300048924 | Ga0496121_0220040 | Ga0496121_0220040_506_1297 | 262 |
| 622 | 3300048925 | Ga0496122_0000034 | Ga0496122_0000034_204157_204948 | 262 |
| 623 | 3300048925 | Ga0496122_0001006 | Ga0496122_0001006_27828_28616 | 262 |
| 624 | 3300048925 | Ga0496122_0001194 | Ga0496122_0001194_30571_31362 | 262 |
| 625 | 3300048925 | Ga0496122_0029896 | Ga0496122_0029896_3131_3922 | 262 |
| 626 | 3300048926 | Ga0496123_0000141 | Ga0496123_0000141_144706_145497 | 262 |
| 627 | 3300048926 | Ga0496123_0000532 | Ga0496123_0000532_51811_52602 | 262 |
| 628 | 3300048926 | Ga0496123_0000784 | Ga0496123_0000784_28433_29221 | 262 |
| 629 | 3300048926 | Ga0496123_0080317 | Ga0496123_0080317_842_1633 | 262 |
| 630 | 3300048927 | Ga0496124_0000123 | Ga0496124_0000123_126617_127408 | 262 |
| 631 | 3300048927 | Ga0496124_0052354 | Ga0496124_0052354_2655_3446 | 262 |
| 632 | 3300048927 | Ga0496124_0070237 | Ga0496124_0070237_1973_2764 | 262 |
| 633 | 3300048927 | Ga0496124_0285145 | Ga0496124_0285145_97_888 | 262 |
| 634 | 3300048928 | Ga0496125_0002955 | Ga0496125_0002955_7878_8669 | 262 |
| 635 | 3300048928 | Ga0496125_0004960 | Ga0496125_0004960_1748_2539 | 262 |
| 636 | 3300048928 | Ga0496125_0069394 | Ga0496125_0069394_1445_2236 | 262 |
| 637 | 3300048928 | Ga0496125_0105560 | Ga0496125_0105560_183_974 | 262 |
| 638 | 3300048928 | Ga0496125_0149947 | Ga0496125_0149947_437_1225 | 262 |
| 639 | 3300049459 | Ga0495678_000008 | Ga0495678_000008_69568_70359 | 262 |
| 640 | 3300049459 | Ga0495678_000957 | Ga0495678_000957_9514_10302 | 262 |
| 641 | 3300049459 | Ga0495678_001067 | Ga0495678_001067_3261_4049 | 262 |
| 642 | 3300049459 | Ga0495678_024367 | Ga0495678_024367_1622_2410 | 262 |
| 643 | 3300049459 | Ga0495678_060672 | Ga0495678_060672_400_1191 | 262 |
| 644 | 3300049568 | Ga0501031_0012665 | Ga0501031_0012665_405_1196 | 262 |
| 645 | 3300049568 | Ga0501031_0050911 | Ga0501031_0050911_347_1138 | 262 |
| 646 | 3300049569 | Ga0501032_0006231 | Ga0501032_0006231_7103_7894 | 262 |
| 647 | 3300049570 | Ga0501033_0003584 | Ga0501033_0003584_2284_3075 | 262 |
| 648 | 3300049570 | Ga0501033_0040771 | Ga0501033_0040771_1516_2307 | 262 |
| 649 | 3300049571 | Ga0501034_0006814 | Ga0501034_0006814_9273_10064 | 262 |
| 650 | 3300049571 | Ga0501034_0031655 | Ga0501034_0031655_2413_3204 | 262 |
| 651 | 3300049571 | Ga0501034_0446484 | Ga0501034_0446484_151_942 | 262 |
| 652 | 3300049572 | Ga0501036_0001771 | Ga0501036_0001771_4073_4864 | 262 |
| 653 | 3300049573 | Ga0501037_0004252 | Ga0501037_0004252_3776_4567 | 262 |
| 654 | 3300049574 | Ga0501038_0000494 | Ga0501038_0000494_27424_28215 | 262 |
| 655 | 3300049574 | Ga0501038_0244999 | Ga0501038_0244999_70_861 | 262 |
| 656 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_120495_121289 | 262 |
| 657 | 3300049579 | Ga0501043_0001194 | Ga0501043_0001194_11912_12703 | 262 |
| 658 | 3300049579 | Ga0501043_0329906 | Ga0501043_0329906_24_815 | 262 |
| 659 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_7391_8185 | 262 |
| 660 | 3300049580 | Ga0501046_0002440 | Ga0501046_0002440_11802_12593 | 262 |
| 661 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_179688_180482 | 262 |
| 662 | 3300049581 | Ga0501047_0004711 | Ga0501047_0004711_8758_9549 | 262 |
| 663 | 3300049581 | Ga0501047_0065098 | Ga0501047_0065098_315_1106 | 262 |
| 664 | 3300049582 | Ga0501048_0000035 | Ga0501048_0000035_1784_2578 | 262 |
| 665 | 3300049589 | Ga0501073_0014617 | Ga0501073_0014617_2664_3461 | 262 |
| 666 | 3300049822 | Ga0501035_0030053 | Ga0501035_0030053_1602_2393 | 262 |
| 667 | 3300049822 | Ga0501035_0082472 | Ga0501035_0082472_1034_1825 | 262 |
| 668 | 3300049823 | Ga0501044_0004644 | Ga0501044_0004644_2360_3151 | 262 |
| 669 | 3300049823 | Ga0501044_0012609 | Ga0501044_0012609_2385_3176 | 262 |
| 670 | 3300049823 | Ga0501044_0086468 | Ga0501044_0086468_1660_2454 | 262 |
| 671 | 3300049824 | Ga0501045_0001444 | Ga0501045_0001444_7277_8071 | 262 |
| 672 | 3300050491 | nmdc:mga00v17_184220_c1 | nmdc:mga00v17_184220_c1_273_1061 | 262 |
| 673 | 3300050493 | nmdc:mga0k408_52499_c1 | nmdc:mga0k408_52499_c1_1043_1834 | 262 |
| 674 | 3300050493 | nmdc:mga0k408_5367_c1 | nmdc:mga0k408_5367_c1_2388_3329 | 262 |
| 675 | 3300050496 | nmdc:mga07m45_40525_c1 | nmdc:mga07m45_40525_c1_1015_1956 | 262 |
| 676 | 3300050496 | nmdc:mga07m45_77806_c1 | nmdc:mga07m45_77806_c1_718_1509 | 262 |
| 677 | 3300050512 | nmdc:mga0n895_66941_c1 | nmdc:mga0n895_66941_c1_2339_3130 | 262 |
| 678 | 3300053080 | Ga0500635_0118954 | Ga0500635_0118954_54_845 | 262 |
| 679 | 3300053086 | Ga0500578_0000282 | Ga0500578_0000282_32229_33020 | 262 |
| 680 | 3300053086 | Ga0500578_0124117 | Ga0500578_0124117_459_1250 | 262 |
| 681 | 3300053086 | Ga0500578_0149621 | Ga0500578_0149621_528_1319 | 262 |
| 682 | 3300053088 | Ga0500644_0051563 | Ga0500644_0051563_423_1214 | 262 |
| 683 | 3300053090 | Ga0500646_0002851 | Ga0500646_0002851_458_1249 | 262 |
| 684 | 3300053090 | Ga0500646_0013202 | Ga0500646_0013202_65_871 | 262 |
| 685 | 3300053091 | Ga0500647_0007604 | Ga0500647_0007604_578_1366 | 262 |
| 686 | 3300053093 | Ga0500651_0046365 | Ga0500651_0046365_427_1218 | 262 |
| 687 | 3300053109 | Ga0500569_016299 | Ga0500569_016299_170_961 | 262 |
| 688 | 3300053119 | Ga0500595_042643 | Ga0500595_042643_451_1239 | 262 |
| 689 | 3300053121 | Ga0500607_156492 | Ga0500607_156492_191_982 | 262 |
| 690 | 3300053129 | Ga0500628_000922 | Ga0500628_000922_1550_2341 | 262 |
| 691 | 3300053130 | Ga0500642_0006046 | Ga0500642_0006046_2813_3604 | 262 |
| 692 | 3300053131 | Ga0500652_001232 | Ga0500652_001232_3224_4015 | 262 |
| 693 | 3300053131 | Ga0500652_075867 | Ga0500652_075867_571_1362 | 262 |
| 694 | 3300053133 | Ga0500655_007191 | Ga0500655_007191_1064_1855 | 262 |
| 695 | 3300053136 | Ga0500559_0000193 | Ga0500559_0000193_29833_30624 | 262 |
| 696 | 3300053139 | Ga0500568_0009200 | Ga0500568_0009200_3441_4232 | 262 |
| 697 | 3300053139 | Ga0500568_0086760 | Ga0500568_0086760_255_1046 | 262 |
| 698 | 3300053140 | Ga0500573_0056999 | Ga0500573_0056999_677_1477 | 262 |
| 699 | 3300053156 | Ga0500622_0000413 | Ga0500622_0000413_10084_10875 | 262 |
| 700 | 3300053156 | Ga0500622_0001707 | Ga0500622_0001707_15043_15834 | 262 |
| 701 | 3300053156 | Ga0500622_0002091 | Ga0500622_0002091_2098_2886 | 262 |
| 702 | 3300053156 | Ga0500622_0205665 | Ga0500622_0205665_82_873 | 262 |
| 703 | 3300053177 | Ga0500636_0218752 | Ga0500636_0218752_45_836 | 262 |
| 704 | 3300053730 | Ga0500645_002529 | Ga0500645_002529_4652_5443 | 262 |
| 705 | 3300053733 | Ga0500552_011783 | Ga0500552_011783_229_1017 | 262 |
| 706 | 3300053739 | Ga0500587_001150 | Ga0500587_001150_946_1737 | 262 |
| 707 | 3300060353 | Ga0501082_0134862 | Ga0501082_0134862_1012_1809 | 262 |
| 708 | iso_pu_bacteria | 2842747753 | 2842752918 | 262 |
| 709 | iso_pu_bacteria | 2900577576 | 2900580467 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d1y-assembly1.cif.gz_B | crystal structure of tt0321 from thermus thermophilus hb8 | 0.9434 | 11 | 259 |
| 4fgs-assembly1.cif.gz_D | crystal structure of a probable dehydrogenase protein | 0.9432 | 8 | 257 |
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9425 | 11 | 262 |
| 6t65-assembly1.cif.gz_B | crsytal structure of acinetobacter baumannii fabg inhibitor complex at 2.35 a resolution | 0.9401 | 13 | 262 |
| 5cej-assembly1.cif.gz_A | the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.50a resolution | 0.9387 | 11 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9378 | 11 | 257 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9353 | 1 | 192 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9344 | 11 | 257 | 3.40.50.720 |
| 5k9zA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9332 | 11 | 261 | 3.40.50.720 |
| af_A0A1D6Q3A1_14_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9324 | 10 | 121 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435WSP9-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9642 | 14 | 130 |
|
| AF-A0A535TRS1-F1-model_v4 | SDR family oxidoreductase | 0.9599 | 11 | 128 |
|
| AF-A0A6I5VG95-F1-model_v4 | SDR family oxidoreductase | 0.9418 | 7 | 262 |
GO:0016616
|
| AF-A0A832MUH5-F1-model_v4 | SDR family oxidoreductase | 0.9417 | 5 | 192 |
GO:0016491
|
| AF-A0A1F4BCM0-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.94 | 11 | 189 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar