F476649

General Info

Members Datasets Scaffolds Average Seq Length
709 385 631 261

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10002750|Ga0075366_100027507
Length 313
Sequence MRTVPDDIESRVGVCAHDIGLRGAGSETARTALQANGRALPAVTRHAHEPMPILDSLRPTPGLRVLVTAGAGGIGAAVARAFHEAGSRVHVCDIDRSALDRMTSEIPGITGSMADASIAADVDLVFDDVQGTLGGLDVLVSNAGISGPTGPIEAIDGTGWERTIAVNLHSQYYFARRAVPLLKQSTAAPCLIAMGSVAGRLGYAFRTPYASSKWAIVGMMKSLAIELGPHGIRVNAILPGTVEGERMRAVIAARAQSIGIDVDAMRQQYLNRISLRRMVGSDDVAALALFLCSPGARNLTGQAISVDGNVEYL

Samples

Sample ID Description Type Environment
1 2511231031 Pseudomonas sp. GM16 Isolate Nodule
2 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
8 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
9 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
10 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
11 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
12 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
13 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
14 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
15 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
16 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
17 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
18 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
19 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
20 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
21 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
22 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
23 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
24 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
25 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
26 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
27 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
28 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
29 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
30 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
31 2643221683 Variovorax sp. Root473 Isolate Unclassified
32 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
33 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
34 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
35 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
36 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
37 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
38 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
39 2738541307 Variovorax sp. GV008 Isolate Unclassified
40 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
41 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
42 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
43 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
44 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
45 2842747753 Variovorax sp. R-72060 Isolate Unclassified
46 2855730933 Achromobacter sp. HZ28 Isolate Nodule
47 2855767633 Achromobacter sp. HZ34 Isolate Nodule
48 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
49 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
50 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
51 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
52 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
53 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
54 2919085039 Luteibacter sp. 1214 Isolate Unclassified
55 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
56 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
57 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
58 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
59 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
60 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
61 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
62 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
63 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
64 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
65 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
66 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
67 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
68 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
69 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
72 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
73 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
74 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
81 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
82 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
83 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
84 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
85 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
86 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
89 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
210 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
363 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
374 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
377 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
378 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
379 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
380 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
381 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
382 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
383 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
384 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
385 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.86
Metatranscriptomes 0
Isolates 11.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 1.97
Rhizoplane 5.22
Rhizosphere 72.92
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001284 3300001989 Bacteria 9444
2 JGI25156J39149_1000693 3300002705 Bacteria 18068
3 JGI25162J39368_1000085 3300002737 Bacteria 107722
4 JGI25163J39215_1000077 3300002771 Bacteria 43838
5 JGI25164J39214_1000063 3300002772 Bacteria 107722
6 JGI25152J39213_1001586 3300002773 Bacteria 9538
7 JGI25151J46595_10000626 3300003187 Bacteria 30738
8 JGI25165J46597_1000160 3300003214 Bacteria 107722
9 JGI25153J46596_10000537 3300003215 Bacteria 23734
10 rootH2_10053359 3300003320 Bacteria 5584
11 rootH2_10208268 3300003320 Bacteria 1106
12 rootH1_10015346 3300003316 Bacteria 8043
13 rootH1_10015346 3300003323 Bacteria 2240
14 rootH1_10024313 3300003323 Bacteria 4312
15 rootH1_10082241 3300003323 Bacteria 4962
16 Ga0055538_1000099 3300003751 Bacteria 70627
17 Ga0055539_1000147 3300003752 Bacteria 70627
18 Ga0055533_1000151 3300003756 Bacteria 70627
19 Ga0055532_1000108 3300003758 Bacteria 88720
20 Ga0055525_1000199 3300003759 Bacteria 70627
21 Ga0055535_1005776 3300003761 Bacteria 2637
22 Ga0055526_1000296 3300003771 Bacteria 41724
23 Ga0055541_1000099 3300003841 Bacteria 70627
24 Ga0065714_10003563 3300005288 Bacteria 9659
25 Ga0065714_10005194 3300005288 Bacteria 4691
26 Ga0065714_10075280 3300005288 Bacteria 2924
27 Ga0070658_10031491 3300005327 Bacteria 4259
28 Ga0070670_100006151 3300005331 Bacteria 10147
29 Ga0068868_100000303 3300005338 Bacteria 33136
30 Ga0070661_100000081 3300005344 Bacteria 75382
31 Ga0070661_100028695 3300005344 Bacteria 4015
32 Ga0070669_100002322 3300005353 Bacteria 13763
33 Ga0070669_100036015 3300005353 Bacteria 3585
34 Ga0070671_100207179 3300005355 Bacteria 1663
35 Ga0070714_100293439 3300005435 Bacteria 1514
36 Ga0070714_100442186 3300005435 Bacteria 1234
37 Ga0070700_100325297 3300005441 Unclassified 1131
38 Ga0070662_100000351 3300005457 Bacteria 27650
39 Ga0070662_100003486 3300005457 Bacteria 9810
40 Ga0070662_100232563 3300005457 Bacteria 1475
41 Ga0070681_10303405 3300005458 Bacteria 1506
42 Ga0070684_100018459 3300005535 Bacteria 5746
43 Ga0068853_100025298 3300005539 Bacteria 4981
44 Ga0068853_100062262 3300005539 Bacteria 3228
45 Ga0068853_100239588 3300005539 Bacteria 1662
46 Ga0070665_100018543 3300005548 Bacteria 6974
47 Ga0068855_100002732 3300005563 Bacteria 21749
48 Ga0070664_100000139 3300005564 Bacteria 49134
49 Ga0070664_100004768 3300005564 Bacteria 10866
50 Ga0070664_100264008 3300005564 Bacteria 1549
51 Ga0068857_100013031 3300005577 Bacteria 7244
52 Ga0068854_100009910 3300005578 Bacteria 6164
53 Ga0068856_100031354 3300005614 Bacteria 5200
54 Ga0068852_100006625 3300005616 Bacteria 8392
55 Ga0068852_100020085 3300005616 Bacteria 5306
56 Ga0068851_10000153 3300005834 Bacteria 36772
57 Ga0068851_10021353 3300005834 Bacteria 3143
58 Ga0068863_100061145 3300005841 Bacteria 3561
59 Ga0068860_100053043 3300005843 Bacteria 3855
60 Ga0068860_100136359 3300005843 Bacteria 2357
61 Ga0070717_10091481 3300006028 Bacteria 2569
62 Ga0075364_10131376 3300006051 Bacteria 1681
63 Ga0075432_10000690 3300006058 Bacteria 10388
64 Ga0075366_10002750 3300006195 Bacteria 9093
65 Ga0075366_10085613 3300006195 Bacteria 1885
66 Ga0075370_10007960 3300006353 Bacteria 5430
67 Ga0105251_10000637 3300009011 Bacteria 32170
68 Ga0105251_10007326 3300009011 Bacteria 6822
69 Ga0105251_10011398 3300009011 Bacteria 5081
70 Ga0105244_10001072 3300009036 Bacteria 22803
71 Ga0105244_10001073 3300009036 Bacteria 22794
72 Ga0105244_10002639 3300009036 Bacteria 13442
73 Ga0105244_10040282 3300009036 Bacteria 2427
74 Ga0105250_10043374 3300009092 Bacteria 1802
75 Ga0105240_10005332 3300009093 Bacteria 19184
76 Ga0105240_10422434 3300009093 Bacteria 1497
77 Ga0105243_10000480 3300009148 Bacteria 40986
78 Ga0105242_10000964 3300009176 Bacteria 22474
79 Ga0105237_10153001 3300009545 Bacteria 2303
80 Ga0105238_10003764 3300009551 Bacteria 15071
81 Ga0105238_10020373 3300009551 Bacteria 6751
82 Ga0105249_11029158 3300009553 Bacteria 893
83 Ga0105246_10012195 3300011119 Bacteria 5356
84 Ga0157373_10010062 3300013100 Bacteria 6969
85 Ga0157373_10266881 3300013100 Bacteria 1212
86 Ga0157371_10000115 3300013102 Bacteria 122316
87 Ga0157371_10000788 3300013102 Bacteria 36497
88 Ga0157371_10129583 3300013102 Bacteria 1794
89 Ga0157371_10215647 3300013102 Bacteria 1378
90 Ga0157370_10002111 3300013104 Bacteria 24281
91 Ga0157370_10113715 3300013104 Bacteria 2529
92 Ga0157370_10165503 3300013104 Bacteria 2056
93 Ga0157369_10000562 3300013105 Bacteria 48790
94 Ga0157369_10001753 3300013105 Bacteria 26296
95 Ga0157369_10514757 3300013105 Bacteria 1238
96 Ga0157374_10211008 3300013296 Bacteria 1904
97 Ga0163162_10000095 3300013306 Bacteria 80739
98 Ga0157372_10006766 3300013307 Bacteria 12188
99 Ga0157372_10164808 3300013307 Bacteria 2563
100 Ga0157375_10001188 3300013308 Bacteria 22474
101 Ga0157375_10006323 3300013308 Bacteria 10319
102 Ga0182008_10000352 3300014497 Bacteria 35836
103 Ga0182008_10002951 3300014497 Bacteria 10470
104 Ga0182008_10037244 3300014497 Bacteria 2433
105 Ga0182006_1000389 3300015261 Bacteria 36185
106 Ga0182007_10004403 3300015262 Bacteria 6388
107 Ga0182005_1000055 3300015265 Bacteria 111824
108 Ga0182005_1008262 3300015265 Bacteria 3075
109 Ga0163161_10015507 3300017792 Bacteria 5313
110 Ga0209760_100039 3300025207 Bacteria 118977
111 Ga0209784_100015 3300025224 Bacteria 482117
112 Ga0209566_100012 3300025225 Bacteria 482281
113 Ga0209674_100027 3300025226 Bacteria 482281
114 Ga0209147_100019 3300025229 Bacteria 482139
115 Ga0209563_100031 3300025230 Bacteria 482281
116 Ga0207427_100001 3300025231 Bacteria 1410763
117 Ga0209437_100003 3300025233 Bacteria 1517827
118 Ga0209437_103142 3300025233 Bacteria 3035
119 Ga0209258_100364 3300025242 Bacteria 60333
120 Ga0207425_1000259 3300025245 Bacteria 39126
121 Ga0209646_1000199 3300025246 Bacteria 71982
122 Ga0209677_100016 3300025253 Bacteria 482117
123 Ga0209759_1000033 3300025256 Bacteria 276117
124 Ga0209129_1000175 3300025258 Bacteria 93817
125 Ga0209233_1000007 3300025261 Bacteria 1411234
126 Ga0209233_1024030 3300025261 Bacteria 1532
127 Ga0209025_1004094 3300025294 Bacteria 13003
128 Ga0209564_1000136 3300025295 Bacteria 185198
129 Ga0209758_1000275 3300025297 Bacteria 102404
130 Ga0209050_1000247 3300025298 Bacteria 116514
131 Ga0207656_10000074 3300025321 Bacteria 36744
132 Ga0207656_10043847 3300025321 Bacteria 1909
133 Ga0207655_1000250 3300025728 Bacteria 86806
134 Ga0207655_1000325 3300025728 Bacteria 70385
135 Ga0207655_1001605 3300025728 Bacteria 20188
136 Ga0207655_1032026 3300025728 Bacteria 2410
137 Ga0207713_1000819 3300025735 Bacteria 28789
138 Ga0207713_1010502 3300025735 Bacteria 5119
139 Ga0207713_1011993 3300025735 Bacteria 4667
140 Ga0207695_10004475 3300025913 Bacteria 19039
141 Ga0207671_10000566 3300025914 Bacteria 49574
142 Ga0207657_10022124 3300025919 Bacteria 5965
143 Ga0207649_10000002 3300025920 Bacteria 498633
144 Ga0207649_10006870 3300025920 Bacteria 6183
145 Ga0207681_10003046 3300025923 Bacteria 10536
146 Ga0207681_10041536 3300025923 Bacteria 3067
147 Ga0207694_10232014 3300025924 Bacteria 1507
148 Ga0207650_10000621 3300025925 Bacteria 28378
149 Ga0207644_10051830 3300025931 Bacteria 2947
150 Ga0207706_10000127 3300025933 Bacteria 81664
151 Ga0207686_10003977 3300025934 Bacteria 7932
152 Ga0207709_10001023 3300025935 Bacteria 20702
153 Ga0207661_10018345 3300025944 Bacteria 5199
154 Ga0207679_10000006 3300025945 Bacteria 498868
155 Ga0207679_10010572 3300025945 Bacteria 5946
156 Ga0207667_10004150 3300025949 Bacteria 17803
157 Ga0207667_10397062 3300025949 Bacteria 1404
158 Ga0207640_10009388 3300025981 Bacteria 5477
159 Ga0207640_10018539 3300025981 Bacteria 4092
160 Ga0207639_10011324 3300026041 Bacteria 6191
161 Ga0207639_10121482 3300026041 Bacteria 2147
162 Ga0207702_10016633 3300026078 Bacteria 6087
163 Ga0207641_10116066 3300026088 Bacteria 2381
164 Ga0207674_10033462 3300026116 Bacteria 5381
165 Ga0207683_10582240 3300026121 Bacteria 1035
166 Ga0207698_10073644 3300026142 Bacteria 2720
167 Ga0209970_1000492 3300027614 Bacteria 6760
168 Ga0207428_10002286 3300027907 Bacteria 19238
169 Ga0268266_10054139 3300028379 Bacteria 3448
170 Ga0268265_10024597 3300028380 Bacteria 4263
171 Ga0307517_10289765 3300028786 Bacteria 926
172 Ga0265338_10030476 3300028800 Bacteria 5313
173 Ga0265328_10063747 3300031239 Bacteria 1354
174 Ga0265327_10000266 3300031251 Bacteria 103308
175 Ga0265327_10001259 3300031251 Bacteria 33543
176 Ga0307408_100169281 3300031548 Bacteria 1743
177 Ga0307516_10013066 3300031730 Bacteria 8879
178 Ga0307412_10016220 3300031911 Bacteria 4432
179 Ga0307412_10178095 3300031911 Bacteria 1596
180 Ga0373954_0007214 3300035118 Bacteria 4855
181 Ga0373956_0167976 3300035119 Bacteria 1035
182 Ga0373924_0137850 3300035410 Bacteria 1063
183 Ga0373935_0343183 3300035692 Bacteria 1063
184 Ga0373937_0000503 3300036401 Bacteria 35778
185 Ga0373925_0040516 3300037068 Bacteria 3449
186 Ga0395899_0051379 3300037312 Bacteria 3059
187 Ga0395899_0170161 3300037312 Bacteria 1534
188 Ga0395900_0014754 3300037418 Bacteria 7964
189 Ga0395900_0356133 3300037418 Bacteria 1436
190 Ga0395900_0690779 3300037418 Bacteria 954
191 Ga0395898_0517389 3300037466 Bacteria 1134
192 Ga0395898_0848856 3300037466 Bacteria 852
193 Ga0395905_0018276 3300037471 Bacteria 6656
194 Ga0395905_0083477 3300037471 Bacteria 2993
195 Ga0395905_0470621 3300037471 Bacteria 1155
196 Ga0436364_1500992 3300037853 Bacteria 965
197 Ga0395901_0169177 3300038443 Bacteria 2293
198 Ga0395901_0255426 3300038443 Bacteria 1825
199 Ga0395901_0769172 3300038443 Bacteria 954
200 Ga0436365_0662455 3300039437 Bacteria 1050
201 Ga0439447_000608 3300041407 Bacteria 13329
202 Ga0439447_033219 3300041407 Bacteria 1287
203 Ga0439465_0096135 3300041413 Bacteria 1018
204 Ga0451789_1213403 3300041443 Bacteria 2476
205 Ga0451798_0026135 3300041458 Bacteria 1541
206 Ga0439432_046290 3300042006 Bacteria 1367
207 Ga0439452_000329 3300042010 Bacteria 29549
208 Ga0450902_000221 3300042137 Bacteria 6741
209 Ga0466969_0055611 3300044656 Bacteria 1935
210 Ga0466966_0010921 3300044684 Bacteria 6031
211 Ga0466961_0135943 3300044693 Bacteria 1540
212 Ga0466963_0053293 3300044694 Bacteria 2686
213 Ga0466968_0000406 3300044735 Bacteria 14242
214 Ga0466959_0019340 3300045049 Bacteria 5008
215 Ga0466967_0010897 3300045976 Bacteria 6850
216 Ga0466967_0155763 3300045976 Bacteria 2140
217 Ga0495617_001372 3300046452 Bacteria 10756
218 Ga0495617_017418 3300046452 Bacteria 2427
219 Ga0495627_000031 3300046453 Bacteria 226981
220 Ga0495627_006756 3300046453 Bacteria 4465
221 Ga0495592_0093928 3300046454 Bacteria 2147
222 Ga0495603_0060554 3300046455 Bacteria 2237
223 Ga0495590_0005411 3300046457 Bacteria 5069
224 Ga0495590_0100824 3300046457 Bacteria 1025
225 Ga0495591_000005 3300046458 Bacteria 394092
226 Ga0495591_000900 3300046458 Bacteria 20775
227 Ga0495591_001235 3300046458 Bacteria 16515
228 Ga0495591_002447 3300046458 Bacteria 10325
229 Ga0495591_003161 3300046458 Bacteria 8690
230 Ga0495629_0000160 3300046459 Bacteria 59328
231 Ga0495629_0001997 3300046459 Bacteria 15850
232 Ga0495629_0013424 3300046459 Bacteria 5909
233 Ga0495638_0001043 3300046460 Bacteria 27399
234 Ga0495638_0003860 3300046460 Bacteria 11627
235 Ga0495638_0014085 3300046460 Bacteria 5416
236 Ga0495638_0034890 3300046460 Bacteria 3210
237 Ga0495638_0159871 3300046460 Bacteria 1300
238 Ga0495638_0182939 3300046460 Bacteria 1194
239 Ga0495651_0077070 3300046462 Bacteria 2524
240 Ga0495653_0000434 3300046463 Bacteria 32947
241 Ga0495653_0001768 3300046463 Bacteria 17039
242 Ga0495653_0010954 3300046463 Bacteria 7425
243 Ga0495653_0101965 3300046463 Bacteria 2078
244 Ga0495650_0000405 3300046471 Bacteria 71148
245 Ga0495650_0001089 3300046471 Bacteria 29820
246 Ga0495650_0002844 3300046471 Bacteria 13245
247 Ga0495650_0003246 3300046471 Bacteria 12065
248 Ga0495650_0062890 3300046471 Bacteria 1482
249 Ga0495580_0087310 3300046472 Bacteria 2172
250 Ga0495582_0051614 3300046473 Bacteria 2267
251 Ga0495582_0101061 3300046473 Bacteria 1614
252 Ga0495605_0000219 3300046474 Bacteria 70638
253 Ga0495605_0007400 3300046474 Bacteria 6231
254 Ga0495605_0022199 3300046474 Bacteria 3354
255 Ga0495605_0097769 3300046474 Bacteria 1352
256 Ga0495639_0046860 3300046475 Bacteria 1957
257 Ga0495639_0050595 3300046475 Bacteria 1888
258 Ga0495662_0124902 3300046476 Bacteria 1264
259 Ga0495664_0037859 3300046477 Bacteria 2847
260 Ga0495584_0004304 3300046491 Bacteria 7674
261 Ga0495584_0034167 3300046491 Bacteria 2573
262 Ga0495585_0000551 3300046492 Bacteria 35441
263 Ga0495585_0002544 3300046492 Bacteria 12938
264 Ga0495585_0008977 3300046492 Bacteria 6024
265 Ga0495585_0020021 3300046492 Bacteria 3849
266 Ga0495596_0000010 3300046500 Bacteria 145028
267 Ga0495596_0000028 3300046500 Bacteria 103710
268 Ga0495596_0000132 3300046500 Bacteria 51646
269 Ga0495596_0043654 3300046500 Bacteria 1767
270 Ga0495596_0075564 3300046500 Bacteria 1308
271 Ga0495607_0003360 3300046501 Bacteria 12271
272 Ga0495607_0022265 3300046501 Bacteria 3981
273 Ga0495607_0025790 3300046501 Bacteria 3653
274 Ga0495607_0027353 3300046501 Bacteria 3527
275 Ga0495607_0169027 3300046501 Bacteria 1105
276 Ga0495583_0000151 3300046506 Bacteria 117627
277 Ga0495583_0000334 3300046506 Bacteria 74547
278 Ga0495583_0002225 3300046506 Bacteria 17145
279 Ga0495583_0003405 3300046506 Bacteria 12156
280 Ga0495583_0003426 3300046506 Bacteria 12088
281 Ga0495606_0001711 3300046507 Bacteria 28286
282 Ga0495606_0002465 3300046507 Bacteria 21444
283 Ga0495606_0007586 3300046507 Bacteria 9658
284 Ga0495606_0024635 3300046507 Bacteria 4330
285 Ga0495606_0027422 3300046507 Bacteria 4040
286 Ga0495606_0116002 3300046507 Bacteria 1609
287 Ga0495606_0123203 3300046507 Bacteria 1549
288 Ga0495608_0000956 3300046511 Bacteria 20362
289 Ga0495608_0020916 3300046511 Bacteria 4494
290 Ga0495610_0000287 3300046512 Bacteria 52829
291 Ga0495610_0003015 3300046512 Bacteria 13495
292 Ga0495610_0012735 3300046512 Bacteria 5038
293 Ga0495610_0085625 3300046512 Bacteria 1437
294 Ga0495610_0121672 3300046512 Bacteria 1143
295 Ga0495616_0221907 3300046513 Unclassified 822
296 Ga0495618_0001015 3300046514 Bacteria 19228
297 Ga0495618_0005918 3300046514 Bacteria 7430
298 Ga0495620_0004145 3300046515 Bacteria 8225
299 Ga0495620_0005836 3300046515 Bacteria 6831
300 Ga0495620_0031070 3300046515 Bacteria 2450
301 Ga0495620_0097742 3300046515 Bacteria 1173
302 Ga0495628_0005536 3300046516 Bacteria 11055
303 Ga0495628_0156031 3300046516 Bacteria 1736
304 Ga0495630_0010794 3300046517 Bacteria 6593
305 Ga0495630_0024678 3300046517 Bacteria 4443
306 Ga0495630_0083747 3300046517 Bacteria 2408
307 Ga0495631_0000117 3300046518 Bacteria 52920
308 Ga0495631_0016675 3300046518 Bacteria 3495
309 Ga0495631_0177538 3300046518 Unclassified 913
310 Ga0495632_0000102 3300046519 Bacteria 87253
311 Ga0495632_0000661 3300046519 Bacteria 31618
312 Ga0495632_0000950 3300046519 Bacteria 25312
313 Ga0495632_0001670 3300046519 Bacteria 18179
314 Ga0495632_0003923 3300046519 Bacteria 10332
315 Ga0495632_0004390 3300046519 Bacteria 9588
316 Ga0495632_0014538 3300046519 Bacteria 4448
317 Ga0495632_0014996 3300046519 Bacteria 4361
318 Ga0495632_0019088 3300046519 Bacteria 3742
319 Ga0495632_0050331 3300046519 Bacteria 2054
320 Ga0495637_0000074 3300046520 Bacteria 80233
321 Ga0495637_0000082 3300046520 Bacteria 73771
322 Ga0495637_0000476 3300046520 Bacteria 29269
323 Ga0495637_0000597 3300046520 Bacteria 25843
324 Ga0495637_0009926 3300046520 Bacteria 4631
325 Ga0495637_0053360 3300046520 Bacteria 1683
326 Ga0495637_0076070 3300046520 Bacteria 1345
327 Ga0495643_0001044 3300046522 Bacteria 28024
328 Ga0495643_0020348 3300046522 Bacteria 3826
329 Ga0495643_0049734 3300046522 Bacteria 2259
330 Ga0495643_0166629 3300046522 Bacteria 1080
331 Ga0495644_0005721 3300046523 Bacteria 4852
332 Ga0495644_0012548 3300046523 Bacteria 3257
333 Ga0495644_0026090 3300046523 Bacteria 2218
334 Ga0495648_0000093 3300046524 Bacteria 111381
335 Ga0495648_0001459 3300046524 Bacteria 23132
336 Ga0495648_0006203 3300046524 Bacteria 9790
337 Ga0495648_0008616 3300046524 Bacteria 8000
338 Ga0495666_0004392 3300046526 Bacteria 7126
339 Ga0495642_0001229 3300046528 Bacteria 11776
340 Ga0495652_0002282 3300046529 Bacteria 20011
341 Ga0495652_0003170 3300046529 Bacteria 16394
342 Ga0495654_0000352 3300046530 Bacteria 39778
343 Ga0495654_0000462 3300046530 Bacteria 33930
344 Ga0495654_0001145 3300046530 Bacteria 18998
345 Ga0495654_0002780 3300046530 Bacteria 11029
346 Ga0495654_0009697 3300046530 Bacteria 5271
347 Ga0495654_0047522 3300046530 Bacteria 2109
348 Ga0495654_0071568 3300046530 Bacteria 1643
349 Ga0495665_0006976 3300046531 Bacteria 6093
350 Ga0495640_0003936 3300046533 Bacteria 11896
351 Ga0495586_0047858 3300046535 Bacteria 2309
352 Ga0495586_0118789 3300046535 Bacteria 1476
353 Ga0495586_0134457 3300046535 Bacteria 1385
354 Ga0495587_0000332 3300046536 Bacteria 33763
355 Ga0495587_0092093 3300046536 Bacteria 1750
356 Ga0495609_0000034 3300046538 Bacteria 201125
357 Ga0495609_0000043 3300046538 Bacteria 166590
358 Ga0495609_0000217 3300046538 Bacteria 57243
359 Ga0495597_0004246 3300046542 Bacteria 7925
360 Ga0495597_0008705 3300046542 Bacteria 5069
361 Ga0495597_0012908 3300046542 Bacteria 4017
362 Ga0495597_0017524 3300046542 Bacteria 3368
363 Ga0495597_0017790 3300046542 Bacteria 3340
364 Ga0495645_0000466 3300046543 Bacteria 27957
365 Ga0495645_0020662 3300046543 Bacteria 4754
366 Ga0495645_0032404 3300046543 Bacteria 3812
367 Ga0495622_0000017 3300046557 Bacteria 176313
368 Ga0495622_0003205 3300046557 Bacteria 7751
369 Ga0495622_0034856 3300046557 Bacteria 2347
370 Ga0495622_0153828 3300046557 Bacteria 1039
371 Ga0495633_0000165 3300046558 Bacteria 86867
372 Ga0495667_0008299 3300046559 Bacteria 7042
373 Ga0495667_0017394 3300046559 Bacteria 4855
374 Ga0495668_0000238 3300046616 Bacteria 78527
375 Ga0495668_0000503 3300046616 Bacteria 48861
376 Ga0495668_0004158 3300046616 Bacteria 10455
377 Ga0495668_0008635 3300046616 Bacteria 6335
378 Ga0495634_0142378 3300046642 Bacteria 1521
379 Ga0495611_0000475 3300046648 Bacteria 23978
380 Ga0495611_0000485 3300046648 Bacteria 23749
381 Ga0495611_0004026 3300046648 Bacteria 6398
382 Ga0495625_0000101 3300046660 Bacteria 139139
383 Ga0495625_0003863 3300046660 Bacteria 14477
384 Ga0495625_0005733 3300046660 Bacteria 11227
385 Ga0495625_0007856 3300046660 Bacteria 9189
386 Ga0495625_0096092 3300046660 Bacteria 2041
387 Ga0495635_0001180 3300046663 Bacteria 17400
388 Ga0495661_0000024 3300046665 Bacteria 188844
389 Ga0495661_0000143 3300046665 Bacteria 83493
390 Ga0495661_0000242 3300046665 Bacteria 62935
391 Ga0495661_0006203 3300046665 Bacteria 8414
392 Ga0495661_0010038 3300046665 Bacteria 6474
393 Ga0495661_0011066 3300046665 Bacteria 6127
394 Ga0495661_0031972 3300046665 Bacteria 3331
395 Ga0495661_0045604 3300046665 Bacteria 2679
396 Ga0495661_0084625 3300046665 Bacteria 1819
397 Ga0495657_0137672 3300046675 Bacteria 1524
398 Ga0495657_0225531 3300046675 Bacteria 1135
399 Ga0495599_0001203 3300046678 Bacteria 14666
400 Ga0495599_0192945 3300046678 Bacteria 1252
401 Ga0495623_0000068 3300046679 Bacteria 63878
402 Ga0495623_0000505 3300046679 Bacteria 25846
403 Ga0495623_0001196 3300046679 Bacteria 17603
404 Ga0495623_0003843 3300046679 Bacteria 9901
405 Ga0495623_0016582 3300046679 Bacteria 4758
406 Ga0495623_0242701 3300046679 Bacteria 1017
407 Ga0495646_0006822 3300046680 Bacteria 7246
408 Ga0495646_0032940 3300046680 Bacteria 3222
409 Ga0495658_0178342 3300046683 Bacteria 1317
410 Ga0495669_0050553 3300046684 Bacteria 1864
411 Ga0495613_0011354 3300046689 Bacteria 6619
412 Ga0495613_0120028 3300046689 Bacteria 1888
413 Ga0495624_0054484 3300046690 Bacteria 2521
414 Ga0495624_0089518 3300046690 Bacteria 1899
415 Ga0495624_0107895 3300046690 Bacteria 1712
416 Ga0495670_0000021 3300046691 Bacteria 104769
417 Ga0495670_0005114 3300046691 Bacteria 6451
418 Ga0495670_0007216 3300046691 Bacteria 5466
419 Ga0495670_0131631 3300046691 Bacteria 1304
420 Ga0495671_0002059 3300046692 Bacteria 12899
421 Ga0495671_0003858 3300046692 Bacteria 9109
422 Ga0495671_0007495 3300046692 Bacteria 6212
423 Ga0495671_0028235 3300046692 Bacteria 2893
424 Ga0495671_0095146 3300046692 Bacteria 1457
425 Ga0495649_0001521 3300046694 Bacteria 17422
426 Ga0495649_0022444 3300046694 Bacteria 3532
427 Ga0495649_0049626 3300046694 Bacteria 2279
428 Ga0495589_0000255 3300046794 Bacteria 43527
429 Ga0495589_0000681 3300046794 Bacteria 22193
430 Ga0495589_0016127 3300046794 Bacteria 3838
431 Ga0495589_0024701 3300046794 Bacteria 3053
432 Ga0495589_0081220 3300046794 Bacteria 1577
433 Ga0495600_0049652 3300046809 Bacteria 2737
434 Ga0495600_0078568 3300046809 Bacteria 2155
435 Ga0495600_0080493 3300046809 Bacteria 2126
436 Ga0495660_0000325 3300046810 Bacteria 42181
437 Ga0495660_0006667 3300046810 Bacteria 6817
438 Ga0495660_0007007 3300046810 Bacteria 6645
439 Ga0495660_0010416 3300046810 Bacteria 5409
440 Ga0495660_0046322 3300046810 Bacteria 2384
441 Ga0495660_0055478 3300046810 Bacteria 2145
442 Ga0495660_0058092 3300046810 Bacteria 2085
443 Ga0495660_0110899 3300046810 Bacteria 1400
444 Ga0495660_0151786 3300046810 Bacteria 1143
445 Ga0495581_0007346 3300047315 Bacteria 6373
446 Ga0495581_0059600 3300047315 Bacteria 2206
447 Ga0495604_0000356 3300047317 Bacteria 40982
448 Ga0495604_0009667 3300047317 Bacteria 7624
449 Ga0495604_0029323 3300047317 Bacteria 4377
450 Ga0495674_0001529 3300047319 Bacteria 22615
451 Ga0495674_0004590 3300047319 Bacteria 13282
452 Ga0495672_0001131 3300047320 Bacteria 27027
453 Ga0495672_0033024 3300047320 Bacteria 3210
454 Ga0495672_0063320 3300047320 Bacteria 2123
455 Ga0495676_0000071 3300047321 Bacteria 76592
456 Ga0495676_0008883 3300047321 Bacteria 9179
457 Ga0495680_0002429 3300047322 Bacteria 19072
458 Ga0495680_0003371 3300047322 Bacteria 15786
459 Ga0495680_0039272 3300047322 Bacteria 3777
460 Ga0495683_0000849 3300047323 Bacteria 21676
461 Ga0495683_0002891 3300047323 Bacteria 10165
462 Ga0495683_0005326 3300047323 Bacteria 7149
463 Ga0495683_0010946 3300047323 Bacteria 4784
464 Ga0495683_0014936 3300047323 Bacteria 4044
465 Ga0495687_000018 3300047443 Bacteria 342973
466 Ga0495675_0000473 3300047444 Bacteria 26369
467 Ga0495675_0002160 3300047444 Bacteria 11720
468 Ga0495675_0002754 3300047444 Bacteria 10534
469 Ga0495675_0011625 3300047444 Bacteria 5527
470 Ga0495675_0022924 3300047444 Bacteria 3979
471 Ga0495675_0051668 3300047444 Bacteria 2610
472 Ga0495679_000064 3300047446 Bacteria 102509
473 Ga0495679_000236 3300047446 Bacteria 45851
474 Ga0495679_001857 3300047446 Bacteria 11385
475 Ga0495673_0002335 3300047469 Bacteria 13494
476 Ga0495673_0002995 3300047469 Bacteria 11381
477 Ga0495673_0003146 3300047469 Bacteria 11052
478 Ga0495673_0003863 3300047469 Bacteria 9660
479 Ga0495673_0003972 3300047469 Bacteria 9457
480 Ga0495673_0005866 3300047469 Bacteria 7340
481 Ga0495673_0007314 3300047469 Bacteria 6370
482 Ga0495673_0020536 3300047469 Bacteria 3285
483 Ga0495673_0054555 3300047469 Bacteria 1737
484 Ga0495673_0064357 3300047469 Bacteria 1560
485 Ga0495681_0000034 3300047470 Bacteria 125396
486 Ga0495681_0001515 3300047470 Bacteria 17345
487 Ga0495681_0002308 3300047470 Bacteria 13717
488 Ga0495681_0004761 3300047470 Bacteria 9198
489 Ga0495681_0017134 3300047470 Bacteria 4035
490 Ga0495681_0023117 3300047470 Bacteria 3308
491 Ga0495684_0082542 3300047471 Bacteria 2438
492 Ga0495686_0001239 3300047472 Bacteria 29105
493 Ga0495686_0030833 3300047472 Bacteria 3480
494 Ga0495686_0134174 3300047472 Bacteria 1465
495 Ga0495686_0158291 3300047472 Bacteria 1325
496 Ga0495593_0000045 3300047673 Bacteria 50149
497 Ga0495593_0027010 3300047673 Bacteria 3164
498 Ga0495593_0031662 3300047673 Bacteria 2887
499 Ga0495593_0123531 3300047673 Bacteria 1316
500 Ga0495602_0001885 3300048088 Bacteria 20999
501 Ga0495602_0004432 3300048088 Bacteria 14658
502 Ga0495602_0049627 3300048088 Bacteria 3756
503 Ga0495602_0218242 3300048088 Bacteria 1441
504 Ga0495614_0003119 3300048089 Bacteria 7386
505 Ga0495614_0061824 3300048089 Bacteria 1609
506 Ga0495626_0000045 3300048091 Bacteria 164931
507 Ga0495626_0000166 3300048091 Bacteria 81272
508 Ga0495626_0000816 3300048091 Bacteria 28047
509 Ga0496100_0026260 3300048903 Bacteria 3569
510 Ga0496102_0001291 3300048905 Bacteria 22509
511 Ga0496102_0005827 3300048905 Bacteria 10481
512 Ga0496103_0017085 3300048906 Bacteria 4338
513 Ga0496104_0333105 3300048907 Bacteria 1431
514 Ga0496105_0016101 3300048908 Bacteria 5964
515 Ga0496106_0002941 3300048909 Bacteria 12680
516 Ga0496107_0073685 3300048910 Bacteria 2484
517 Ga0496107_0405998 3300048910 Bacteria 1013
518 Ga0496108_0432978 3300048911 Bacteria 1149
519 Ga0496110_0454507 3300048913 Unclassified 1167
520 Ga0496114_0000816 3300048917 Bacteria 23339
521 Ga0496115_0228805 3300048918 Bacteria 1534
522 Ga0496115_0333789 3300048918 Bacteria 1238
523 Ga0496116_0000366 3300048919 Bacteria 69492
524 Ga0496116_0003129 3300048919 Bacteria 16611
525 Ga0496117_0000469 3300048920 Bacteria 67036
526 Ga0496117_0000708 3300048920 Bacteria 52863
527 Ga0496117_0003647 3300048920 Bacteria 17731
528 Ga0496117_0118602 3300048920 Bacteria 1631
529 Ga0496118_0000167 3300048921 Bacteria 119146
530 Ga0496118_0026815 3300048921 Bacteria 4896
531 Ga0496118_0029626 3300048921 Bacteria 4586
532 Ga0496118_0201456 3300048921 Bacteria 1178
533 Ga0496119_0067523 3300048922 Bacteria 2109
534 Ga0496121_0000722 3300048924 Bacteria 61133
535 Ga0496121_0025971 3300048924 Bacteria 5539
536 Ga0496121_0029703 3300048924 Bacteria 5043
537 Ga0496121_0035577 3300048924 Bacteria 4460
538 Ga0496121_0220040 3300048924 Bacteria 1338
539 Ga0496122_0000034 3300048925 Bacteria 320661
540 Ga0496122_0001006 3300048925 Bacteria 49938
541 Ga0496122_0001194 3300048925 Bacteria 44317
542 Ga0496122_0029896 3300048925 Bacteria 4580
543 Ga0496123_0000141 3300048926 Bacteria 147111
544 Ga0496123_0000532 3300048926 Bacteria 65557
545 Ga0496123_0000784 3300048926 Bacteria 51269
546 Ga0496123_0080317 3300048926 Bacteria 1988
547 Ga0496124_0000123 3300048927 Bacteria 161106
548 Ga0496124_0052354 3300048927 Bacteria 3468
549 Ga0496124_0070237 3300048927 Bacteria 2905
550 Ga0496124_0285145 3300048927 Bacteria 1202
551 Ga0496125_0001211 3300048928 Bacteria 38785
552 Ga0496125_0002955 3300048928 Bacteria 21369
553 Ga0496125_0004960 3300048928 Bacteria 15051
554 Ga0496125_0069394 3300048928 Bacteria 2766
555 Ga0496125_0105560 3300048928 Bacteria 2059
556 Ga0496125_0149947 3300048928 Bacteria 1604
557 Ga0496126_0477565 3300048929 Bacteria 999
558 Ga0495678_000008 3300049459 Bacteria 445926
559 Ga0495678_000957 3300049459 Bacteria 25009
560 Ga0495678_001067 3300049459 Bacteria 23249
561 Ga0495678_024367 3300049459 Bacteria 2613
562 Ga0495678_060672 3300049459 Bacteria 1422
563 Ga0501031_0012665 3300049568 Bacteria 5507
564 Ga0501031_0050911 3300049568 Bacteria 2697
565 Ga0501032_0006231 3300049569 Bacteria 8778
566 Ga0501033_0003584 3300049570 Bacteria 12688
567 Ga0501033_0040771 3300049570 Bacteria 3466
568 Ga0501034_0006814 3300049571 Bacteria 12219
569 Ga0501034_0031655 3300049571 Bacteria 5373
570 Ga0501034_0446484 3300049571 Bacteria 1211
571 Ga0501036_0001771 3300049572 Bacteria 16761
572 Ga0501037_0004252 3300049573 Bacteria 10376
573 Ga0501038_0000494 3300049574 Bacteria 34711
574 Ga0501038_0244999 3300049574 Bacteria 1422
575 Ga0501043_0000038 3300049579 Bacteria 128656
576 Ga0501043_0001194 3300049579 Bacteria 22852
577 Ga0501043_0329906 3300049579 Bacteria 1162
578 Ga0501046_0000049 3300049580 Bacteria 135088
579 Ga0501046_0002440 3300049580 Bacteria 17427
580 Ga0501047_0000039 3300049581 Bacteria 187849
581 Ga0501047_0004711 3300049581 Bacteria 12827
582 Ga0501047_0065098 3300049581 Bacteria 3514
583 Ga0501048_0000035 3300049582 Bacteria 64516
584 Ga0501073_0014617 3300049589 Bacteria 5704
585 Ga0501035_0030053 3300049822 Bacteria 4954
586 Ga0501035_0082472 3300049822 Bacteria 2837
587 Ga0501044_0004644 3300049823 Bacteria 15368
588 Ga0501044_0012609 3300049823 Bacteria 9154
589 Ga0501044_0086468 3300049823 Bacteria 3167
590 Ga0501045_0001444 3300049824 Bacteria 15788
591 nmdc:mga00v17_184220_c1 3300050491 Bacteria 1347
592 nmdc:mga0k408_52499_c1 3300050493 Bacteria 2363
593 nmdc:mga0k408_5367_c1 3300050493 Bacteria 6813
594 nmdc:mga07m45_40525_c1 3300050496 Bacteria 2606
595 nmdc:mga07m45_77806_c1 3300050496 Bacteria 1892
596 nmdc:mga0n895_66941_c1 3300050512 Bacteria 3556
597 Ga0495601_0011976 3300053077 Bacteria 5196
598 Ga0495612_0006526 3300053078 Bacteria 4793
599 Ga0500635_0118954 3300053080 Bacteria 988
600 Ga0495595_0000132 3300053084 Bacteria 30927
601 Ga0495619_0004062 3300053085 Bacteria 9374
602 Ga0500578_0000282 3300053086 Bacteria 62821
603 Ga0500578_0124117 3300053086 Bacteria 1622
604 Ga0500578_0149621 3300053086 Bacteria 1455
605 Ga0500644_0051563 3300053088 Bacteria 1413
606 Ga0500646_0002851 3300053090 Bacteria 4436
607 Ga0500646_0013202 3300053090 Bacteria 2138
608 Ga0500647_0007604 3300053091 Bacteria 4666
609 Ga0500651_0046365 3300053093 Bacteria 2733
610 Ga0500569_016299 3300053109 Bacteria 1880
611 Ga0500595_042643 3300053119 Bacteria 1450
612 Ga0500607_156492 3300053121 Bacteria 1048
613 Ga0500628_000922 3300053129 Bacteria 5169
614 Ga0500642_0006046 3300053130 Bacteria 3954
615 Ga0500652_001232 3300053131 Bacteria 8133
616 Ga0500652_075867 3300053131 Bacteria 1397
617 Ga0500655_007191 3300053133 Bacteria 2002
618 Ga0500559_0000193 3300053136 Bacteria 49137
619 Ga0500568_0009200 3300053139 Bacteria 4711
620 Ga0500568_0086760 3300053139 Bacteria 1183
621 Ga0500573_0056999 3300053140 Bacteria 2243
622 Ga0500622_0000413 3300053156 Bacteria 40682
623 Ga0500622_0001707 3300053156 Bacteria 17033
624 Ga0500622_0002091 3300053156 Bacteria 14874
625 Ga0500622_0205665 3300053156 Bacteria 892
626 Ga0500636_0218752 3300053177 Bacteria 994
627 Ga0500645_002529 3300053730 Bacteria 8073
628 Ga0500552_011783 3300053733 Bacteria 1105
629 Ga0500587_001150 3300053739 Bacteria 3653
630 Ga0501082_0134862 3300060353 Bacteria 2142
631 Ga0501082_0513149 3300060353 Bacteria 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0178342 Ga0495658_0178342_14_1075 232
2 3300005327 Ga0070658_10031491 Ga0070658_100314912 238
3 3300005344 Ga0070661_100028695 Ga0070661_1000286953 238
4 3300005355 Ga0070671_100207179 Ga0070671_1002071792 238
5 3300005457 Ga0070662_100232563 Ga0070662_1002325632 238
6 3300005458 Ga0070681_10303405 Ga0070681_103034052 238
7 3300005535 Ga0070684_100018459 Ga0070684_1000184593 238
8 3300005539 Ga0068853_100025298 Ga0068853_1000252983 238
9 3300005564 Ga0070664_100004768 Ga0070664_1000047687 238
10 3300005577 Ga0068857_100013031 Ga0068857_1000130315 238
11 3300005614 Ga0068856_100031354 Ga0068856_1000313542 238
12 3300005616 Ga0068852_100020085 Ga0068852_1000200853 238
13 3300005834 Ga0068851_10021353 Ga0068851_100213532 238
14 3300009093 Ga0105240_10422434 Ga0105240_104224342 238
15 3300009551 Ga0105238_10003764 Ga0105238_100037642 238
16 3300013100 Ga0157373_10010062 Ga0157373_100100625 238
17 3300013296 Ga0157374_10211008 Ga0157374_102110082 238
18 3300013307 Ga0157372_10006766 Ga0157372_100067663 238
19 3300025321 Ga0207656_10043847 Ga0207656_100438472 238
20 3300025919 Ga0207657_10022124 Ga0207657_100221244 238
21 3300025920 Ga0207649_10006870 Ga0207649_100068702 238
22 3300025931 Ga0207644_10051830 Ga0207644_100518302 238
23 3300025944 Ga0207661_10018345 Ga0207661_100183452 238
24 3300025945 Ga0207679_10010572 Ga0207679_100105722 238
25 3300025981 Ga0207640_10009388 Ga0207640_100093883 238
26 3300026078 Ga0207702_10016633 Ga0207702_100166333 238
27 3300026116 Ga0207674_10033462 Ga0207674_100334622 238
28 3300026142 Ga0207698_10073644 Ga0207698_100736442 238
29 3300005338 Ga0068868_100000303 Ga0068868_1000003031 239
30 3300005457 Ga0070662_100003486 Ga0070662_1000034867 239
31 3300035118 Ga0373954_0007214 Ga0373954_0007214_323_1063 246
32 3300035119 Ga0373956_0167976 Ga0373956_0167976_50_790 246
33 3300035410 Ga0373924_0137850 Ga0373924_0137850_247_987 246
34 3300035692 Ga0373935_0343183 Ga0373935_0343183_79_819 246
35 3300036401 Ga0373937_0000503 Ga0373937_0000503_26375_27115 246
36 3300046459 Ga0495629_0001997 Ga0495629_0001997_457_1197 246
37 3300046463 Ga0495653_0001768 Ga0495653_0001768_4821_5561 246
38 3300046476 Ga0495662_0124902 Ga0495662_0124902_352_1092 246
39 3300046511 Ga0495608_0000956 Ga0495608_0000956_8590_9330 246
40 3300046514 Ga0495618_0001015 Ga0495618_0001015_6688_7428 246
41 3300046516 Ga0495628_0156031 Ga0495628_0156031_266_1006 246
42 3300046517 Ga0495630_0083747 Ga0495630_0083747_1489_2229 246
43 3300046529 Ga0495652_0003170 Ga0495652_0003170_9216_9956 246
44 3300046533 Ga0495640_0003936 Ga0495640_0003936_10130_10870 246
45 3300046536 Ga0495587_0000332 Ga0495587_0000332_14941_15681 246
46 3300046559 Ga0495667_0008299 Ga0495667_0008299_1107_1847 246
47 3300046663 Ga0495635_0001180 Ga0495635_0001180_14609_15349 246
48 3300046675 Ga0495657_0137672 Ga0495657_0137672_266_1006 246
49 3300046678 Ga0495599_0001203 Ga0495599_0001203_2218_2958 246
50 3300046679 Ga0495623_0000505 Ga0495623_0000505_19161_19901 246
51 3300046680 Ga0495646_0006822 Ga0495646_0006822_1587_2327 246
52 3300046689 Ga0495613_0120028 Ga0495613_0120028_1013_1753 246
53 3300046809 Ga0495600_0080493 Ga0495600_0080493_474_1214 246
54 3300047315 Ga0495581_0059600 Ga0495581_0059600_990_1730 246
55 3300047317 Ga0495604_0000356 Ga0495604_0000356_30329_31069 246
56 3300047319 Ga0495674_0001529 Ga0495674_0001529_20066_20806 246
57 3300047322 Ga0495680_0003371 Ga0495680_0003371_4645_5385 246
58 3300047444 Ga0495675_0002754 Ga0495675_0002754_7748_8488 246
59 3300047471 Ga0495684_0082542 Ga0495684_0082542_290_1030 246
60 3300047673 Ga0495593_0027010 Ga0495593_0027010_1498_2238 246
61 3300048088 Ga0495602_0001885 Ga0495602_0001885_18207_18947 246
62 3300053077 Ga0495601_0011976 Ga0495601_0011976_1806_2546 246
63 3300053078 Ga0495612_0006526 Ga0495612_0006526_175_915 246
64 3300053084 Ga0495595_0000132 Ga0495595_0000132_14838_15578 246
65 3300053085 Ga0495619_0004062 Ga0495619_0004062_6496_7236 246
66 3300046794 Ga0495589_0081220 Ga0495589_0081220_513_1256 247
67 3300009036 Ga0105244_10001072 Ga0105244_1000107220 248
68 3300011119 Ga0105246_10012195 Ga0105246_100121955 248
69 3300013100 Ga0157373_10266881 Ga0157373_102668811 248
70 3300013105 Ga0157369_10000562 Ga0157369_1000056234 248
71 3300046515 Ga0495620_0097742 Ga0495620_0097742_357_1103 248
72 3300046665 Ga0495661_0000242 Ga0495661_0000242_34766_35512 248
73 3300048920 Ga0496117_0000469 Ga0496117_0000469_13520_14266 248
74 3300048921 Ga0496118_0201456 Ga0496118_0201456_407_1153 248
75 3300048928 Ga0496125_0001211 Ga0496125_0001211_20612_21358 248
76 3300048929 Ga0496126_0477565 Ga0496126_0477565_178_924 248
77 3300060353 Ga0501082_0513149 Ga0501082_0513149_172_969 249
78 3300046457 Ga0495590_0005411 Ga0495590_0005411_16_768 250
79 3300046513 Ga0495616_0221907 Ga0495616_0221907_59_811 250
80 3300046542 Ga0495597_0008705 Ga0495597_0008705_16_768 250
81 3300048918 Ga0496115_0228805 Ga0496115_0228805_258_1118 253
82 3300025294 Ga0209025_1004094 Ga0209025_10040947 254
83 3300046463 Ga0495653_0101965 Ga0495653_0101965_68_856 254
84 3300046557 Ga0495622_0153828 Ga0495622_0153828_42_830 254
85 3300039437 Ga0436365_0662455 Ga0436365_0662455_96_866 255
86 3300026121 Ga0207683_10582240 Ga0207683_105822401 257
87 3300005435 Ga0070714_100442186 Ga0070714_1004421862 258
88 iso_pu_bacteria 2511231031 2511413088 258
89 iso_pu_bacteria 2554235341 2555668462 258
90 iso_pu_bacteria 2585428057 2587730926 258
91 iso_pu_bacteria 2585428058 2587736039 258
92 iso_pu_bacteria 2585428062 2587756349 258
93 iso_pu_bacteria 2588253510 2588295810 258
94 iso_pu_bacteria 2599185160 2599355459 258
95 iso_pu_bacteria 2599185161 2599360702 258
96 iso_pu_bacteria 2599185162 2599367024 258
97 iso_pu_bacteria 2599185163 2599373814 258
98 iso_pu_bacteria 2599185164 2599380565 258
99 iso_pu_bacteria 2599185165 2599387012 258
100 iso_pu_bacteria 2599185166 2599392672 258
101 iso_pu_bacteria 2599185167 2599396659 258
102 iso_pu_bacteria 2599185168 2599404439 258
103 iso_pu_bacteria 2599185179 2599453281 258
104 iso_pu_bacteria 2599185181 2599462293 258
105 iso_pu_bacteria 2599185182 2599466648 258
106 iso_pu_bacteria 2599185186 2599490615 258
107 iso_pu_bacteria 2599185190 2599514613 258
108 iso_pu_bacteria 2599185191 2599517456 258
109 iso_pu_bacteria 2599185290 2599894122 258
110 iso_pu_bacteria 2599185356 2600214915 258
111 iso_pu_bacteria 2600255296 2601691312 258
112 iso_pu_bacteria 2600255313 2601774380 258
113 iso_pu_bacteria 2619619299 2621301126 258
114 iso_pu_bacteria 2643221592 2643971050 258
115 iso_pu_bacteria 2643221603 2644031016 258
116 iso_pu_bacteria 2643221625 2644144213 258
117 iso_pu_bacteria 2643221648 2644275235 258
118 iso_pu_bacteria 2643221683 2644467753 258
119 iso_pu_bacteria 2667528171 2671098079 258
120 iso_pu_bacteria 2721755607 2723247611 258
121 iso_pu_bacteria 2721755755 2723844538 258
122 iso_pu_bacteria 2738541265 2738670249 258
123 iso_pu_bacteria 2738541271 2738687791 258
124 iso_pu_bacteria 2738541282 2738748642 258
125 iso_pu_bacteria 2738541303 2738857684 258
126 iso_pu_bacteria 2738541307 2738883028 258
127 iso_pu_bacteria 2738543016 2739263774 258
128 iso_pu_bacteria 2773857672 2774129550 258
129 iso_pu_bacteria 2816332298 2817489520 258
130 iso_pu_bacteria 2818991464 2819703146 258
131 iso_pu_bacteria 2834028612 2834029434 258
132 iso_pu_bacteria 2855730933 2855731816 258
133 iso_pu_bacteria 2855767633 2855768522 258
134 iso_pu_bacteria 2857542790 2857547176 258
135 iso_pu_bacteria 2857576091 2857576503 258
136 iso_pu_bacteria 2881665667 2881672774 258
137 iso_pu_bacteria 2912963787 2912965892 258
138 iso_pu_bacteria 2917070673 2917072230 258
139 iso_pu_bacteria 2919085039 2919085879 258
140 iso_pu_bacteria 2931390751 2931392443 258
141 iso_pu_bacteria 2935353572 2935354399 258
142 iso_pu_bacteria 2935648319 2935656676 258
143 iso_pu_bacteria 2935656913 2935665486 258
144 iso_pu_bacteria 2935984226 2935989232 258
145 iso_pu_bacteria 2936011229 2936019539 258
146 iso_pu_bacteria 2936019824 2936028167 258
147 iso_pu_bacteria 2936028420 2936037040 258
148 iso_pu_bacteria 2936046547 2936055012 258
149 iso_pu_bacteria 2939651529 2939653632 258
150 iso_pu_bacteria 2945909444 2945909466 258
151 iso_pu_bacteria 2945961074 2945961760 258
152 iso_pu_bacteria 2945984333 2945988554 258
153 iso_pu_bacteria 2947233263 2947236256 258
154 iso_pu_bacteria 3007619802 3007624793 258
155 iso_pu_bacteria 637000220 637318821 258
156 iso_pu_bacteria 642555113 642620540 258
157 iso_pu_bacteria 8016583857 8016584200 258
158 iso_pu_bacteria 8019769354 8019770993 258
159 iso_pu_bacteria 8054285046 8054286806 258
160 iso_pu_bacteria 8055817908 8055819474 258
161 iso_pu_bacteria 8056161164 8056164767 258
162 iso_pu_bacteria 8056177738 8056178648 258
163 iso_pu_bacteria 8056673599 8056677250 258
164 iso_pu_bacteria 8057798959 8057803744 258
165 3300046690 Ga0495624_0054484 Ga0495624_0054484_773_1555 259
166 3300001989 JGI24739J22299_10001284 JGI24739J22299_100012844 262
167 3300002705 JGI25156J39149_1000693 JGI25156J39149_100069315 262
168 3300002737 JGI25162J39368_1000085 JGI25162J39368_100008534 262
169 3300002771 JGI25163J39215_1000077 JGI25163J39215_100007739 262
170 3300002772 JGI25164J39214_1000063 JGI25164J39214_100006334 262
171 3300002773 JGI25152J39213_1001586 JGI25152J39213_10015864 262
172 3300003187 JGI25151J46595_10000626 JGI25151J46595_100006264 262
173 3300003214 JGI25165J46597_1000160 JGI25165J46597_100016034 262
174 3300003215 JGI25153J46596_10000537 JGI25153J46596_100005372 262
175 3300003320 rootH2_10053359 rootH2_100533595 262
176 3300003320 rootH2_10208268 rootH2_102082681 262
177 3300003323 rootH1_10015346 rootH1_100153462 262
178 3300003323 rootH1_10024313 rootH1_100243133 262
179 3300003323 rootH1_10082241 rootH1_100822413 262
180 3300003751 Ga0055538_1000099 Ga0055538_100009975 262
181 3300003752 Ga0055539_1000147 Ga0055539_100014775 262
182 3300003756 Ga0055533_1000151 Ga0055533_100015111 262
183 3300003758 Ga0055532_1000108 Ga0055532_100010874 262
184 3300003759 Ga0055525_1000199 Ga0055525_100019975 262
185 3300003761 Ga0055535_1005776 Ga0055535_10057762 262
186 3300003771 Ga0055526_1000296 Ga0055526_100029631 262
187 3300003841 Ga0055541_1000099 Ga0055541_100009912 262
188 3300005288 Ga0065714_10003563 Ga0065714_100035634 262
189 3300005288 Ga0065714_10005194 Ga0065714_100051944 262
190 3300005288 Ga0065714_10075280 Ga0065714_100752803 262
191 3300005331 Ga0070670_100006151 Ga0070670_1000061513 262
192 3300005344 Ga0070661_100000081 Ga0070661_1000000814 262
193 3300005353 Ga0070669_100002322 Ga0070669_1000023224 262
194 3300005353 Ga0070669_100036015 Ga0070669_1000360153 262
195 3300005435 Ga0070714_100293439 Ga0070714_1002934392 262
196 3300005441 Ga0070700_100325297 Ga0070700_1003252971 262
197 3300005457 Ga0070662_100000351 Ga0070662_10000035113 262
198 3300005539 Ga0068853_100062262 Ga0068853_1000622622 262
199 3300005539 Ga0068853_100239588 Ga0068853_1002395881 262
200 3300005548 Ga0070665_100018543 Ga0070665_1000185433 262
201 3300005563 Ga0068855_100002732 Ga0068855_1000027325 262
202 3300005564 Ga0070664_100000139 Ga0070664_10000013922 262
203 3300005564 Ga0070664_100264008 Ga0070664_1002640081 262
204 3300005578 Ga0068854_100009910 Ga0068854_1000099102 262
205 3300005616 Ga0068852_100006625 Ga0068852_1000066257 262
206 3300005834 Ga0068851_10000153 Ga0068851_1000015336 262
207 3300005841 Ga0068863_100061145 Ga0068863_1000611452 262
208 3300005843 Ga0068860_100053043 Ga0068860_1000530432 262
209 3300005843 Ga0068860_100136359 Ga0068860_1001363592 262
210 3300006028 Ga0070717_10091481 Ga0070717_100914812 262
211 3300006051 Ga0075364_10131376 Ga0075364_101313762 262
212 3300006058 Ga0075432_10000690 Ga0075432_100006906 262
213 3300006195 Ga0075366_10002750 Ga0075366_100027507 262
214 3300006195 Ga0075366_10085613 Ga0075366_100856132 262
215 3300006353 Ga0075370_10007960 Ga0075370_100079603 262
216 3300009011 Ga0105251_10000637 Ga0105251_1000063717 262
217 3300009011 Ga0105251_10007326 Ga0105251_100073268 262
218 3300009011 Ga0105251_10011398 Ga0105251_100113983 262
219 3300009036 Ga0105244_10001073 Ga0105244_100010736 262
220 3300009036 Ga0105244_10002639 Ga0105244_100026393 262
221 3300009036 Ga0105244_10040282 Ga0105244_100402822 262
222 3300009092 Ga0105250_10043374 Ga0105250_100433742 262
223 3300009093 Ga0105240_10005332 Ga0105240_100053328 262
224 3300009148 Ga0105243_10000480 Ga0105243_1000048013 262
225 3300009176 Ga0105242_10000964 Ga0105242_1000096426 262
226 3300009545 Ga0105237_10153001 Ga0105237_101530012 262
227 3300009551 Ga0105238_10020373 Ga0105238_100203733 262
228 3300009553 Ga0105249_11029158 Ga0105249_110291581 262
229 3300013102 Ga0157371_10000115 Ga0157371_1000011572 262
230 3300013102 Ga0157371_10000788 Ga0157371_100007888 262
231 3300013102 Ga0157371_10129583 Ga0157371_101295832 262
232 3300013102 Ga0157371_10215647 Ga0157371_102156472 262
233 3300013104 Ga0157370_10002111 Ga0157370_1000211114 262
234 3300013104 Ga0157370_10113715 Ga0157370_101137152 262
235 3300013104 Ga0157370_10165503 Ga0157370_101655032 262
236 3300013105 Ga0157369_10001753 Ga0157369_1000175327 262
237 3300013105 Ga0157369_10514757 Ga0157369_105147572 262
238 3300013306 Ga0163162_10000095 Ga0163162_1000009553 262
239 3300013307 Ga0157372_10164808 Ga0157372_101648082 262
240 3300013308 Ga0157375_10001188 Ga0157375_1000118823 262
241 3300013308 Ga0157375_10006323 Ga0157375_100063234 262
242 3300014497 Ga0182008_10000352 Ga0182008_1000035233 262
243 3300014497 Ga0182008_10002951 Ga0182008_100029516 262
244 3300014497 Ga0182008_10037244 Ga0182008_100372442 262
245 3300015261 Ga0182006_1000389 Ga0182006_10003894 262
246 3300015262 Ga0182007_10004403 Ga0182007_100044032 262
247 3300015265 Ga0182005_1000055 Ga0182005_100005582 262
248 3300015265 Ga0182005_1008262 Ga0182005_10082622 262
249 3300017792 Ga0163161_10015507 Ga0163161_100155074 262
250 3300025207 Ga0209760_100039 Ga0209760_10003946 262
251 3300025224 Ga0209784_100015 Ga0209784_100015350 262
252 3300025225 Ga0209566_100012 Ga0209566_100012350 262
253 3300025226 Ga0209674_100027 Ga0209674_100027350 262
254 3300025229 Ga0209147_100019 Ga0209147_100019350 262
255 3300025230 Ga0209563_100031 Ga0209563_100031350 262
256 3300025231 Ga0207427_100001 Ga0207427_100001720 262
257 3300025233 Ga0209437_100003 Ga0209437_100003652 262
258 3300025233 Ga0209437_103142 Ga0209437_1031422 262
259 3300025242 Ga0209258_100364 Ga0209258_1003649 262
260 3300025245 Ga0207425_1000259 Ga0207425_100025932 262
261 3300025246 Ga0209646_1000199 Ga0209646_100019926 262
262 3300025253 Ga0209677_100016 Ga0209677_100016350 262
263 3300025256 Ga0209759_1000033 Ga0209759_100003334 262
264 3300025258 Ga0209129_1000175 Ga0209129_100017548 262
265 3300025261 Ga0209233_1000007 Ga0209233_1000007720 262
266 3300025261 Ga0209233_1024030 Ga0209233_10240302 262
267 3300025295 Ga0209564_1000136 Ga0209564_1000136118 262
268 3300025297 Ga0209758_1000275 Ga0209758_100027567 262
269 3300025298 Ga0209050_1000247 Ga0209050_100024765 262
270 3300025321 Ga0207656_10000074 Ga0207656_1000007436 262
271 3300025728 Ga0207655_1000250 Ga0207655_100025031 262
272 3300025728 Ga0207655_1000325 Ga0207655_100032533 262
273 3300025728 Ga0207655_1001605 Ga0207655_10016056 262
274 3300025728 Ga0207655_1032026 Ga0207655_10320262 262
275 3300025735 Ga0207713_1000819 Ga0207713_100081915 262
276 3300025735 Ga0207713_1010502 Ga0207713_10105024 262
277 3300025735 Ga0207713_1011993 Ga0207713_10119935 262
278 3300025913 Ga0207695_10004475 Ga0207695_100044757 262
279 3300025914 Ga0207671_10000566 Ga0207671_1000056650 262
280 3300025920 Ga0207649_10000002 Ga0207649_10000002180 262
281 3300025923 Ga0207681_10003046 Ga0207681_100030464 262
282 3300025923 Ga0207681_10041536 Ga0207681_100415363 262
283 3300025924 Ga0207694_10232014 Ga0207694_102320143 262
284 3300025925 Ga0207650_10000621 Ga0207650_1000062114 262
285 3300025933 Ga0207706_10000127 Ga0207706_1000012755 262
286 3300025934 Ga0207686_10003977 Ga0207686_100039775 262
287 3300025935 Ga0207709_10001023 Ga0207709_1000102314 262
288 3300025945 Ga0207679_10000006 Ga0207679_10000006311 262
289 3300025949 Ga0207667_10004150 Ga0207667_100041509 262
290 3300025949 Ga0207667_10397062 Ga0207667_103970622 262
291 3300025981 Ga0207640_10018539 Ga0207640_100185393 262
292 3300026041 Ga0207639_10011324 Ga0207639_100113246 262
293 3300026041 Ga0207639_10121482 Ga0207639_101214822 262
294 3300026088 Ga0207641_10116066 Ga0207641_101160661 262
295 3300027614 Ga0209970_1000492 Ga0209970_10004922 262
296 3300027907 Ga0207428_10002286 Ga0207428_100022863 262
297 3300028379 Ga0268266_10054139 Ga0268266_100541392 262
298 3300028380 Ga0268265_10024597 Ga0268265_100245973 262
299 3300028786 Ga0307517_10289765 Ga0307517_102897651 262
300 3300028800 Ga0265338_10030476 Ga0265338_100304763 262
301 3300031239 Ga0265328_10063747 Ga0265328_100637472 262
302 3300031251 Ga0265327_10000266 Ga0265327_10000266101 262
303 3300031251 Ga0265327_10001259 Ga0265327_1000125922 262
304 3300031548 Ga0307408_100169281 Ga0307408_1001692812 262
305 3300031730 Ga0307516_10013066 Ga0307516_100130662 262
306 3300031911 Ga0307412_10016220 Ga0307412_100162202 262
307 3300031911 Ga0307412_10178095 Ga0307412_101780952 262
308 3300037068 Ga0373925_0040516 Ga0373925_0040516_2306_3118 262
309 3300037312 Ga0395899_0051379 Ga0395899_0051379_19_810 262
310 3300037312 Ga0395899_0170161 Ga0395899_0170161_353_1144 262
311 3300037418 Ga0395900_0014754 Ga0395900_0014754_5789_6577 262
312 3300037418 Ga0395900_0356133 Ga0395900_0356133_196_984 262
313 3300037418 Ga0395900_0690779 Ga0395900_0690779_140_931 262
314 3300037466 Ga0395898_0517389 Ga0395898_0517389_24_815 262
315 3300037466 Ga0395898_0848856 Ga0395898_0848856_24_815 262
316 3300037471 Ga0395905_0018276 Ga0395905_0018276_866_1657 262
317 3300037471 Ga0395905_0083477 Ga0395905_0083477_510_1298 262
318 3300037471 Ga0395905_0470621 Ga0395905_0470621_140_931 262
319 3300037853 Ga0436364_1500992 Ga0436364_1500992_66_863 262
320 3300038443 Ga0395901_0169177 Ga0395901_0169177_1206_1994 262
321 3300038443 Ga0395901_0255426 Ga0395901_0255426_459_1247 262
322 3300038443 Ga0395901_0769172 Ga0395901_0769172_24_815 262
323 3300041407 Ga0439447_000608 Ga0439447_000608_4397_5185 262
324 3300041407 Ga0439447_033219 Ga0439447_033219_460_1251 262
325 3300041413 Ga0439465_0096135 Ga0439465_0096135_127_915 262
326 3300041443 Ga0451789_1213403 Ga0451789_1213403_619_1410 262
327 3300041458 Ga0451798_0026135 Ga0451798_0026135_352_1143 262
328 3300042006 Ga0439432_046290 Ga0439432_046290_117_905 262
329 3300042010 Ga0439452_000329 Ga0439452_000329_17341_18129 262
330 3300042137 Ga0450902_000221 Ga0450902_000221_2631_3419 262
331 3300044656 Ga0466969_0055611 Ga0466969_0055611_1009_1800 262
332 3300044684 Ga0466966_0010921 Ga0466966_0010921_2798_3598 262
333 3300044693 Ga0466961_0135943 Ga0466961_0135943_22_822 262
334 3300044694 Ga0466963_0053293 Ga0466963_0053293_905_1696 262
335 3300044735 Ga0466968_0000406 Ga0466968_0000406_7986_8801 262
336 3300045049 Ga0466959_0019340 Ga0466959_0019340_2010_2810 262
337 3300045976 Ga0466967_0010897 Ga0466967_0010897_5013_5804 262
338 3300045976 Ga0466967_0155763 Ga0466967_0155763_1137_1952 262
339 3300046452 Ga0495617_001372 Ga0495617_001372_4346_5134 262
340 3300046452 Ga0495617_017418 Ga0495617_017418_519_1307 262
341 3300046453 Ga0495627_000031 Ga0495627_000031_147501_148289 262
342 3300046453 Ga0495627_006756 Ga0495627_006756_1017_1808 262
343 3300046454 Ga0495592_0093928 Ga0495592_0093928_569_1360 262
344 3300046455 Ga0495603_0060554 Ga0495603_0060554_97_885 262
345 3300046457 Ga0495590_0100824 Ga0495590_0100824_78_866 262
346 3300046458 Ga0495591_000005 Ga0495591_000005_319768_320556 262
347 3300046458 Ga0495591_000900 Ga0495591_000900_9861_10649 262
348 3300046458 Ga0495591_001235 Ga0495591_001235_754_1545 262
349 3300046458 Ga0495591_002447 Ga0495591_002447_1163_1951 262
350 3300046458 Ga0495591_003161 Ga0495591_003161_6412_7272 262
351 3300046459 Ga0495629_0000160 Ga0495629_0000160_26348_27139 262
352 3300046459 Ga0495629_0013424 Ga0495629_0013424_1082_1873 262
353 3300046460 Ga0495638_0001043 Ga0495638_0001043_19185_19976 262
354 3300046460 Ga0495638_0003860 Ga0495638_0003860_7497_8285 262
355 3300046460 Ga0495638_0014085 Ga0495638_0014085_1055_1846 262
356 3300046460 Ga0495638_0034890 Ga0495638_0034890_235_1026 262
357 3300046460 Ga0495638_0159871 Ga0495638_0159871_30_818 262
358 3300046460 Ga0495638_0182939 Ga0495638_0182939_224_1012 262
359 3300046462 Ga0495651_0077070 Ga0495651_0077070_1521_2312 262
360 3300046463 Ga0495653_0000434 Ga0495653_0000434_16733_17521 262
361 3300046463 Ga0495653_0010954 Ga0495653_0010954_636_1424 262
362 3300046471 Ga0495650_0000405 Ga0495650_0000405_22829_23617 262
363 3300046471 Ga0495650_0001089 Ga0495650_0001089_15165_15956 262
364 3300046471 Ga0495650_0002844 Ga0495650_0002844_12070_12858 262
365 3300046471 Ga0495650_0003246 Ga0495650_0003246_723_1511 262
366 3300046471 Ga0495650_0062890 Ga0495650_0062890_255_1046 262
367 3300046472 Ga0495580_0087310 Ga0495580_0087310_431_1222 262
368 3300046473 Ga0495582_0051614 Ga0495582_0051614_1076_1867 262
369 3300046473 Ga0495582_0101061 Ga0495582_0101061_500_1291 262
370 3300046474 Ga0495605_0000219 Ga0495605_0000219_16245_17033 262
371 3300046474 Ga0495605_0007400 Ga0495605_0007400_1614_2405 262
372 3300046474 Ga0495605_0022199 Ga0495605_0022199_1977_2765 262
373 3300046474 Ga0495605_0097769 Ga0495605_0097769_243_1031 262
374 3300046475 Ga0495639_0046860 Ga0495639_0046860_730_1521 262
375 3300046475 Ga0495639_0050595 Ga0495639_0050595_999_1787 262
376 3300046477 Ga0495664_0037859 Ga0495664_0037859_854_1645 262
377 3300046491 Ga0495584_0004304 Ga0495584_0004304_760_1548 262
378 3300046491 Ga0495584_0034167 Ga0495584_0034167_269_1129 262
379 3300046492 Ga0495585_0000551 Ga0495585_0000551_31600_32391 262
380 3300046492 Ga0495585_0002544 Ga0495585_0002544_8432_9220 262
381 3300046492 Ga0495585_0008977 Ga0495585_0008977_373_1161 262
382 3300046492 Ga0495585_0020021 Ga0495585_0020021_1366_2154 262
383 3300046500 Ga0495596_0000010 Ga0495596_0000010_71209_71997 262
384 3300046500 Ga0495596_0000028 Ga0495596_0000028_82657_83445 262
385 3300046500 Ga0495596_0000132 Ga0495596_0000132_3496_4284 262
386 3300046500 Ga0495596_0043654 Ga0495596_0043654_300_1091 262
387 3300046500 Ga0495596_0075564 Ga0495596_0075564_330_1118 262
388 3300046501 Ga0495607_0003360 Ga0495607_0003360_3719_4507 262
389 3300046501 Ga0495607_0022265 Ga0495607_0022265_1291_2079 262
390 3300046501 Ga0495607_0025790 Ga0495607_0025790_2684_3472 262
391 3300046501 Ga0495607_0027353 Ga0495607_0027353_1126_1914 262
392 3300046501 Ga0495607_0169027 Ga0495607_0169027_14_802 262
393 3300046506 Ga0495583_0000151 Ga0495583_0000151_41996_42784 262
394 3300046506 Ga0495583_0000334 Ga0495583_0000334_31689_32477 262
395 3300046506 Ga0495583_0002225 Ga0495583_0002225_7104_7892 262
396 3300046506 Ga0495583_0003405 Ga0495583_0003405_91_879 262
397 3300046506 Ga0495583_0003426 Ga0495583_0003426_5674_6462 262
398 3300046507 Ga0495606_0001711 Ga0495606_0001711_5569_6357 262
399 3300046507 Ga0495606_0002465 Ga0495606_0002465_339_1127 262
400 3300046507 Ga0495606_0007586 Ga0495606_0007586_7182_7970 262
401 3300046507 Ga0495606_0024635 Ga0495606_0024635_2428_3219 262
402 3300046507 Ga0495606_0027422 Ga0495606_0027422_1742_2533 262
403 3300046507 Ga0495606_0116002 Ga0495606_0116002_793_1584 262
404 3300046507 Ga0495606_0123203 Ga0495606_0123203_513_1304 262
405 3300046511 Ga0495608_0020916 Ga0495608_0020916_3545_4336 262
406 3300046512 Ga0495610_0000287 Ga0495610_0000287_24920_25708 262
407 3300046512 Ga0495610_0003015 Ga0495610_0003015_9166_9954 262
408 3300046512 Ga0495610_0012735 Ga0495610_0012735_1576_2364 262
409 3300046512 Ga0495610_0085625 Ga0495610_0085625_380_1168 262
410 3300046512 Ga0495610_0121672 Ga0495610_0121672_148_936 262
411 3300046514 Ga0495618_0005918 Ga0495618_0005918_1150_1941 262
412 3300046515 Ga0495620_0004145 Ga0495620_0004145_1519_2307 262
413 3300046515 Ga0495620_0005836 Ga0495620_0005836_1614_2402 262
414 3300046515 Ga0495620_0031070 Ga0495620_0031070_1073_1861 262
415 3300046516 Ga0495628_0005536 Ga0495628_0005536_8718_9509 262
416 3300046517 Ga0495630_0010794 Ga0495630_0010794_2558_3346 262
417 3300046517 Ga0495630_0024678 Ga0495630_0024678_3388_4179 262
418 3300046518 Ga0495631_0000117 Ga0495631_0000117_32790_33578 262
419 3300046518 Ga0495631_0016675 Ga0495631_0016675_922_1710 262
420 3300046518 Ga0495631_0177538 Ga0495631_0177538_50_838 262
421 3300046519 Ga0495632_0000102 Ga0495632_0000102_54634_55425 262
422 3300046519 Ga0495632_0000661 Ga0495632_0000661_9772_10560 262
423 3300046519 Ga0495632_0000950 Ga0495632_0000950_23054_23845 262
424 3300046519 Ga0495632_0001670 Ga0495632_0001670_8372_9160 262
425 3300046519 Ga0495632_0003923 Ga0495632_0003923_7140_7931 262
426 3300046519 Ga0495632_0004390 Ga0495632_0004390_4137_4925 262
427 3300046519 Ga0495632_0014538 Ga0495632_0014538_1620_2408 262
428 3300046519 Ga0495632_0014996 Ga0495632_0014996_3370_4158 262
429 3300046519 Ga0495632_0019088 Ga0495632_0019088_1827_2618 262
430 3300046519 Ga0495632_0050331 Ga0495632_0050331_373_1161 262
431 3300046520 Ga0495637_0000074 Ga0495637_0000074_61406_62197 262
432 3300046520 Ga0495637_0000082 Ga0495637_0000082_31217_32005 262
433 3300046520 Ga0495637_0000476 Ga0495637_0000476_13705_14493 262
434 3300046520 Ga0495637_0000597 Ga0495637_0000597_17801_18589 262
435 3300046520 Ga0495637_0009926 Ga0495637_0009926_1974_2762 262
436 3300046520 Ga0495637_0053360 Ga0495637_0053360_177_965 262
437 3300046520 Ga0495637_0076070 Ga0495637_0076070_412_1200 262
438 3300046522 Ga0495643_0001044 Ga0495643_0001044_22509_23297 262
439 3300046522 Ga0495643_0020348 Ga0495643_0020348_1179_1967 262
440 3300046522 Ga0495643_0049734 Ga0495643_0049734_388_1176 262
441 3300046522 Ga0495643_0166629 Ga0495643_0166629_120_911 262
442 3300046523 Ga0495644_0005721 Ga0495644_0005721_1078_1866 262
443 3300046523 Ga0495644_0012548 Ga0495644_0012548_84_872 262
444 3300046523 Ga0495644_0026090 Ga0495644_0026090_791_1579 262
445 3300046524 Ga0495648_0000093 Ga0495648_0000093_59131_59922 262
446 3300046524 Ga0495648_0001459 Ga0495648_0001459_16354_17142 262
447 3300046524 Ga0495648_0006203 Ga0495648_0006203_7132_7920 262
448 3300046524 Ga0495648_0008616 Ga0495648_0008616_1042_1830 262
449 3300046526 Ga0495666_0004392 Ga0495666_0004392_2839_3630 262
450 3300046528 Ga0495642_0001229 Ga0495642_0001229_755_1546 262
451 3300046529 Ga0495652_0002282 Ga0495652_0002282_8627_9418 262
452 3300046530 Ga0495654_0000352 Ga0495654_0000352_6674_7462 262
453 3300046530 Ga0495654_0000462 Ga0495654_0000462_29254_30042 262
454 3300046530 Ga0495654_0001145 Ga0495654_0001145_8424_9212 262
455 3300046530 Ga0495654_0002780 Ga0495654_0002780_2616_3404 262
456 3300046530 Ga0495654_0009697 Ga0495654_0009697_1048_1836 262
457 3300046530 Ga0495654_0047522 Ga0495654_0047522_1138_1929 262
458 3300046530 Ga0495654_0071568 Ga0495654_0071568_335_1126 262
459 3300046531 Ga0495665_0006976 Ga0495665_0006976_5024_5815 262
460 3300046535 Ga0495586_0047858 Ga0495586_0047858_1235_2026 262
461 3300046535 Ga0495586_0118789 Ga0495586_0118789_405_1196 262
462 3300046535 Ga0495586_0134457 Ga0495586_0134457_577_1368 262
463 3300046536 Ga0495587_0092093 Ga0495587_0092093_111_902 262
464 3300046538 Ga0495609_0000034 Ga0495609_0000034_92780_93568 262
465 3300046538 Ga0495609_0000043 Ga0495609_0000043_134336_135124 262
466 3300046538 Ga0495609_0000217 Ga0495609_0000217_36226_37014 262
467 3300046542 Ga0495597_0004246 Ga0495597_0004246_6007_6795 262
468 3300046542 Ga0495597_0012908 Ga0495597_0012908_2433_3224 262
469 3300046542 Ga0495597_0017524 Ga0495597_0017524_1552_2340 262
470 3300046542 Ga0495597_0017790 Ga0495597_0017790_1943_2734 262
471 3300046543 Ga0495645_0000466 Ga0495645_0000466_728_1519 262
472 3300046543 Ga0495645_0020662 Ga0495645_0020662_3663_4454 262
473 3300046543 Ga0495645_0032404 Ga0495645_0032404_1548_2339 262
474 3300046557 Ga0495622_0000017 Ga0495622_0000017_136279_137070 262
475 3300046557 Ga0495622_0003205 Ga0495622_0003205_5260_6048 262
476 3300046557 Ga0495622_0034856 Ga0495622_0034856_517_1305 262
477 3300046558 Ga0495633_0000165 Ga0495633_0000165_75466_76254 262
478 3300046559 Ga0495667_0017394 Ga0495667_0017394_709_1500 262
479 3300046616 Ga0495668_0000238 Ga0495668_0000238_13461_14249 262
480 3300046616 Ga0495668_0000503 Ga0495668_0000503_33701_34489 262
481 3300046616 Ga0495668_0004158 Ga0495668_0004158_5878_6669 262
482 3300046616 Ga0495668_0008635 Ga0495668_0008635_3691_4479 262
483 3300046642 Ga0495634_0142378 Ga0495634_0142378_528_1319 262
484 3300046648 Ga0495611_0000475 Ga0495611_0000475_21942_22733 262
485 3300046648 Ga0495611_0000485 Ga0495611_0000485_8218_9006 262
486 3300046648 Ga0495611_0004026 Ga0495611_0004026_2568_3356 262
487 3300046660 Ga0495625_0000101 Ga0495625_0000101_77789_78577 262
488 3300046660 Ga0495625_0003863 Ga0495625_0003863_6869_7660 262
489 3300046660 Ga0495625_0005733 Ga0495625_0005733_5711_6499 262
490 3300046660 Ga0495625_0007856 Ga0495625_0007856_924_1712 262
491 3300046660 Ga0495625_0096092 Ga0495625_0096092_787_1575 262
492 3300046665 Ga0495661_0000024 Ga0495661_0000024_126971_127759 262
493 3300046665 Ga0495661_0000143 Ga0495661_0000143_7148_7936 262
494 3300046665 Ga0495661_0006203 Ga0495661_0006203_5669_6457 262
495 3300046665 Ga0495661_0010038 Ga0495661_0010038_230_1021 262
496 3300046665 Ga0495661_0011066 Ga0495661_0011066_3697_4485 262
497 3300046665 Ga0495661_0031972 Ga0495661_0031972_2392_3183 262
498 3300046665 Ga0495661_0045604 Ga0495661_0045604_779_1570 262
499 3300046665 Ga0495661_0084625 Ga0495661_0084625_476_1264 262
500 3300046675 Ga0495657_0225531 Ga0495657_0225531_229_1020 262
501 3300046678 Ga0495599_0192945 Ga0495599_0192945_224_1015 262
502 3300046679 Ga0495623_0000068 Ga0495623_0000068_19939_20727 262
503 3300046679 Ga0495623_0001196 Ga0495623_0001196_367_1158 262
504 3300046679 Ga0495623_0003843 Ga0495623_0003843_2886_3677 262
505 3300046679 Ga0495623_0016582 Ga0495623_0016582_3242_4033 262
506 3300046679 Ga0495623_0242701 Ga0495623_0242701_192_983 262
507 3300046680 Ga0495646_0032940 Ga0495646_0032940_73_864 262
508 3300046684 Ga0495669_0050553 Ga0495669_0050553_385_1176 262
509 3300046689 Ga0495613_0011354 Ga0495613_0011354_2242_3030 262
510 3300046690 Ga0495624_0089518 Ga0495624_0089518_668_1456 262
511 3300046690 Ga0495624_0107895 Ga0495624_0107895_391_1182 262
512 3300046691 Ga0495670_0000021 Ga0495670_0000021_45696_46484 262
513 3300046691 Ga0495670_0005114 Ga0495670_0005114_615_1403 262
514 3300046691 Ga0495670_0007216 Ga0495670_0007216_1109_1897 262
515 3300046691 Ga0495670_0131631 Ga0495670_0131631_344_1135 262
516 3300046692 Ga0495671_0002059 Ga0495671_0002059_6784_7572 262
517 3300046692 Ga0495671_0003858 Ga0495671_0003858_1825_2616 262
518 3300046692 Ga0495671_0007495 Ga0495671_0007495_4565_5353 262
519 3300046692 Ga0495671_0028235 Ga0495671_0028235_1378_2169 262
520 3300046692 Ga0495671_0095146 Ga0495671_0095146_235_1023 262
521 3300046694 Ga0495649_0001521 Ga0495649_0001521_1598_2389 262
522 3300046694 Ga0495649_0022444 Ga0495649_0022444_1178_1969 262
523 3300046694 Ga0495649_0049626 Ga0495649_0049626_639_1430 262
524 3300046794 Ga0495589_0000255 Ga0495589_0000255_37128_37916 262
525 3300046794 Ga0495589_0000681 Ga0495589_0000681_13610_14398 262
526 3300046794 Ga0495589_0016127 Ga0495589_0016127_3000_3788 262
527 3300046794 Ga0495589_0024701 Ga0495589_0024701_1576_2364 262
528 3300046809 Ga0495600_0049652 Ga0495600_0049652_566_1354 262
529 3300046809 Ga0495600_0078568 Ga0495600_0078568_896_1687 262
530 3300046810 Ga0495660_0000325 Ga0495660_0000325_8725_9513 262
531 3300046810 Ga0495660_0006667 Ga0495660_0006667_2457_3245 262
532 3300046810 Ga0495660_0007007 Ga0495660_0007007_1428_2216 262
533 3300046810 Ga0495660_0010416 Ga0495660_0010416_1112_1900 262
534 3300046810 Ga0495660_0046322 Ga0495660_0046322_483_1271 262
535 3300046810 Ga0495660_0055478 Ga0495660_0055478_476_1264 262
536 3300046810 Ga0495660_0058092 Ga0495660_0058092_1208_1999 262
537 3300046810 Ga0495660_0110899 Ga0495660_0110899_486_1277 262
538 3300046810 Ga0495660_0151786 Ga0495660_0151786_158_949 262
539 3300047315 Ga0495581_0007346 Ga0495581_0007346_4866_5657 262
540 3300047317 Ga0495604_0009667 Ga0495604_0009667_371_1162 262
541 3300047317 Ga0495604_0029323 Ga0495604_0029323_856_1647 262
542 3300047319 Ga0495674_0004590 Ga0495674_0004590_9682_10473 262
543 3300047320 Ga0495672_0001131 Ga0495672_0001131_25263_26051 262
544 3300047320 Ga0495672_0033024 Ga0495672_0033024_1530_2318 262
545 3300047320 Ga0495672_0063320 Ga0495672_0063320_1048_1836 262
546 3300047321 Ga0495676_0000071 Ga0495676_0000071_31510_32298 262
547 3300047321 Ga0495676_0008883 Ga0495676_0008883_6441_7232 262
548 3300047322 Ga0495680_0002429 Ga0495680_0002429_15620_16411 262
549 3300047322 Ga0495680_0039272 Ga0495680_0039272_1103_1891 262
550 3300047323 Ga0495683_0000849 Ga0495683_0000849_19549_20337 262
551 3300047323 Ga0495683_0002891 Ga0495683_0002891_6227_7015 262
552 3300047323 Ga0495683_0005326 Ga0495683_0005326_3710_4498 262
553 3300047323 Ga0495683_0010946 Ga0495683_0010946_1017_1805 262
554 3300047323 Ga0495683_0014936 Ga0495683_0014936_240_1031 262
555 3300047443 Ga0495687_000018 Ga0495687_000018_123352_124143 262
556 3300047444 Ga0495675_0000473 Ga0495675_0000473_19404_20192 262
557 3300047444 Ga0495675_0002160 Ga0495675_0002160_3492_4280 262
558 3300047444 Ga0495675_0011625 Ga0495675_0011625_2903_3694 262
559 3300047444 Ga0495675_0022924 Ga0495675_0022924_1982_2773 262
560 3300047444 Ga0495675_0051668 Ga0495675_0051668_298_1089 262
561 3300047446 Ga0495679_000064 Ga0495679_000064_78622_79410 262
562 3300047446 Ga0495679_000236 Ga0495679_000236_11199_11987 262
563 3300047446 Ga0495679_001857 Ga0495679_001857_7581_8372 262
564 3300047469 Ga0495673_0002335 Ga0495673_0002335_9288_10079 262
565 3300047469 Ga0495673_0002995 Ga0495673_0002995_7323_8111 262
566 3300047469 Ga0495673_0003146 Ga0495673_0003146_8763_9551 262
567 3300047469 Ga0495673_0003863 Ga0495673_0003863_1379_2170 262
568 3300047469 Ga0495673_0003972 Ga0495673_0003972_7264_8052 262
569 3300047469 Ga0495673_0005866 Ga0495673_0005866_5259_6047 262
570 3300047469 Ga0495673_0007314 Ga0495673_0007314_4663_5451 262
571 3300047469 Ga0495673_0020536 Ga0495673_0020536_650_1438 262
572 3300047469 Ga0495673_0054555 Ga0495673_0054555_194_982 262
573 3300047469 Ga0495673_0064357 Ga0495673_0064357_197_985 262
574 3300047470 Ga0495681_0000034 Ga0495681_0000034_114593_115381 262
575 3300047470 Ga0495681_0001515 Ga0495681_0001515_13125_13913 262
576 3300047470 Ga0495681_0002308 Ga0495681_0002308_11463_12251 262
577 3300047470 Ga0495681_0004761 Ga0495681_0004761_4442_5233 262
578 3300047470 Ga0495681_0017134 Ga0495681_0017134_2073_2864 262
579 3300047470 Ga0495681_0023117 Ga0495681_0023117_1595_2383 262
580 3300047472 Ga0495686_0001239 Ga0495686_0001239_3101_3892 262
581 3300047472 Ga0495686_0030833 Ga0495686_0030833_1570_2361 262
582 3300047472 Ga0495686_0134174 Ga0495686_0134174_588_1376 262
583 3300047472 Ga0495686_0158291 Ga0495686_0158291_140_931 262
584 3300047673 Ga0495593_0000045 Ga0495593_0000045_31206_31994 262
585 3300047673 Ga0495593_0031662 Ga0495593_0031662_191_982 262
586 3300047673 Ga0495593_0123531 Ga0495593_0123531_228_1019 262
587 3300048088 Ga0495602_0004432 Ga0495602_0004432_10095_10886 262
588 3300048088 Ga0495602_0049627 Ga0495602_0049627_2321_3112 262
589 3300048088 Ga0495602_0218242 Ga0495602_0218242_449_1240 262
590 3300048089 Ga0495614_0003119 Ga0495614_0003119_2195_2986 262
591 3300048089 Ga0495614_0061824 Ga0495614_0061824_669_1460 262
592 3300048091 Ga0495626_0000045 Ga0495626_0000045_31134_31922 262
593 3300048091 Ga0495626_0000166 Ga0495626_0000166_14543_15331 262
594 3300048091 Ga0495626_0000816 Ga0495626_0000816_5221_6009 262
595 3300048903 Ga0496100_0026260 Ga0496100_0026260_178_969 262
596 3300048905 Ga0496102_0001291 Ga0496102_0001291_11093_11884 262
597 3300048905 Ga0496102_0005827 Ga0496102_0005827_2518_3309 262
598 3300048906 Ga0496103_0017085 Ga0496103_0017085_1367_2158 262
599 3300048907 Ga0496104_0333105 Ga0496104_0333105_89_901 262
600 3300048908 Ga0496105_0016101 Ga0496105_0016101_330_1121 262
601 3300048909 Ga0496106_0002941 Ga0496106_0002941_10639_11430 262
602 3300048910 Ga0496107_0073685 Ga0496107_0073685_709_1497 262
603 3300048910 Ga0496107_0405998 Ga0496107_0405998_178_969 262
604 3300048911 Ga0496108_0432978 Ga0496108_0432978_220_1011 262
605 3300048913 Ga0496110_0454507 Ga0496110_0454507_124_915 262
606 3300048917 Ga0496114_0000816 Ga0496114_0000816_10839_11630 262
607 3300048918 Ga0496115_0333789 Ga0496115_0333789_65_853 262
608 3300048919 Ga0496116_0000366 Ga0496116_0000366_31631_32419 262
609 3300048919 Ga0496116_0003129 Ga0496116_0003129_12634_13425 262
610 3300048920 Ga0496117_0000708 Ga0496117_0000708_20509_21297 262
611 3300048920 Ga0496117_0003647 Ga0496117_0003647_556_1347 262
612 3300048920 Ga0496117_0118602 Ga0496117_0118602_771_1559 262
613 3300048921 Ga0496118_0000167 Ga0496118_0000167_88255_89046 262
614 3300048921 Ga0496118_0026815 Ga0496118_0026815_1521_2312 262
615 3300048921 Ga0496118_0029626 Ga0496118_0029626_3199_3987 262
616 3300048922 Ga0496119_0067523 Ga0496119_0067523_201_992 262
617 3300048924 Ga0496121_0000722 Ga0496121_0000722_28622_29410 262
618 3300048924 Ga0496121_0025971 Ga0496121_0025971_2313_3104 262
619 3300048924 Ga0496121_0029703 Ga0496121_0029703_3097_3888 262
620 3300048924 Ga0496121_0035577 Ga0496121_0035577_475_1266 262
621 3300048924 Ga0496121_0220040 Ga0496121_0220040_506_1297 262
622 3300048925 Ga0496122_0000034 Ga0496122_0000034_204157_204948 262
623 3300048925 Ga0496122_0001006 Ga0496122_0001006_27828_28616 262
624 3300048925 Ga0496122_0001194 Ga0496122_0001194_30571_31362 262
625 3300048925 Ga0496122_0029896 Ga0496122_0029896_3131_3922 262
626 3300048926 Ga0496123_0000141 Ga0496123_0000141_144706_145497 262
627 3300048926 Ga0496123_0000532 Ga0496123_0000532_51811_52602 262
628 3300048926 Ga0496123_0000784 Ga0496123_0000784_28433_29221 262
629 3300048926 Ga0496123_0080317 Ga0496123_0080317_842_1633 262
630 3300048927 Ga0496124_0000123 Ga0496124_0000123_126617_127408 262
631 3300048927 Ga0496124_0052354 Ga0496124_0052354_2655_3446 262
632 3300048927 Ga0496124_0070237 Ga0496124_0070237_1973_2764 262
633 3300048927 Ga0496124_0285145 Ga0496124_0285145_97_888 262
634 3300048928 Ga0496125_0002955 Ga0496125_0002955_7878_8669 262
635 3300048928 Ga0496125_0004960 Ga0496125_0004960_1748_2539 262
636 3300048928 Ga0496125_0069394 Ga0496125_0069394_1445_2236 262
637 3300048928 Ga0496125_0105560 Ga0496125_0105560_183_974 262
638 3300048928 Ga0496125_0149947 Ga0496125_0149947_437_1225 262
639 3300049459 Ga0495678_000008 Ga0495678_000008_69568_70359 262
640 3300049459 Ga0495678_000957 Ga0495678_000957_9514_10302 262
641 3300049459 Ga0495678_001067 Ga0495678_001067_3261_4049 262
642 3300049459 Ga0495678_024367 Ga0495678_024367_1622_2410 262
643 3300049459 Ga0495678_060672 Ga0495678_060672_400_1191 262
644 3300049568 Ga0501031_0012665 Ga0501031_0012665_405_1196 262
645 3300049568 Ga0501031_0050911 Ga0501031_0050911_347_1138 262
646 3300049569 Ga0501032_0006231 Ga0501032_0006231_7103_7894 262
647 3300049570 Ga0501033_0003584 Ga0501033_0003584_2284_3075 262
648 3300049570 Ga0501033_0040771 Ga0501033_0040771_1516_2307 262
649 3300049571 Ga0501034_0006814 Ga0501034_0006814_9273_10064 262
650 3300049571 Ga0501034_0031655 Ga0501034_0031655_2413_3204 262
651 3300049571 Ga0501034_0446484 Ga0501034_0446484_151_942 262
652 3300049572 Ga0501036_0001771 Ga0501036_0001771_4073_4864 262
653 3300049573 Ga0501037_0004252 Ga0501037_0004252_3776_4567 262
654 3300049574 Ga0501038_0000494 Ga0501038_0000494_27424_28215 262
655 3300049574 Ga0501038_0244999 Ga0501038_0244999_70_861 262
656 3300049579 Ga0501043_0000038 Ga0501043_0000038_120495_121289 262
657 3300049579 Ga0501043_0001194 Ga0501043_0001194_11912_12703 262
658 3300049579 Ga0501043_0329906 Ga0501043_0329906_24_815 262
659 3300049580 Ga0501046_0000049 Ga0501046_0000049_7391_8185 262
660 3300049580 Ga0501046_0002440 Ga0501046_0002440_11802_12593 262
661 3300049581 Ga0501047_0000039 Ga0501047_0000039_179688_180482 262
662 3300049581 Ga0501047_0004711 Ga0501047_0004711_8758_9549 262
663 3300049581 Ga0501047_0065098 Ga0501047_0065098_315_1106 262
664 3300049582 Ga0501048_0000035 Ga0501048_0000035_1784_2578 262
665 3300049589 Ga0501073_0014617 Ga0501073_0014617_2664_3461 262
666 3300049822 Ga0501035_0030053 Ga0501035_0030053_1602_2393 262
667 3300049822 Ga0501035_0082472 Ga0501035_0082472_1034_1825 262
668 3300049823 Ga0501044_0004644 Ga0501044_0004644_2360_3151 262
669 3300049823 Ga0501044_0012609 Ga0501044_0012609_2385_3176 262
670 3300049823 Ga0501044_0086468 Ga0501044_0086468_1660_2454 262
671 3300049824 Ga0501045_0001444 Ga0501045_0001444_7277_8071 262
672 3300050491 nmdc:mga00v17_184220_c1 nmdc:mga00v17_184220_c1_273_1061 262
673 3300050493 nmdc:mga0k408_52499_c1 nmdc:mga0k408_52499_c1_1043_1834 262
674 3300050493 nmdc:mga0k408_5367_c1 nmdc:mga0k408_5367_c1_2388_3329 262
675 3300050496 nmdc:mga07m45_40525_c1 nmdc:mga07m45_40525_c1_1015_1956 262
676 3300050496 nmdc:mga07m45_77806_c1 nmdc:mga07m45_77806_c1_718_1509 262
677 3300050512 nmdc:mga0n895_66941_c1 nmdc:mga0n895_66941_c1_2339_3130 262
678 3300053080 Ga0500635_0118954 Ga0500635_0118954_54_845 262
679 3300053086 Ga0500578_0000282 Ga0500578_0000282_32229_33020 262
680 3300053086 Ga0500578_0124117 Ga0500578_0124117_459_1250 262
681 3300053086 Ga0500578_0149621 Ga0500578_0149621_528_1319 262
682 3300053088 Ga0500644_0051563 Ga0500644_0051563_423_1214 262
683 3300053090 Ga0500646_0002851 Ga0500646_0002851_458_1249 262
684 3300053090 Ga0500646_0013202 Ga0500646_0013202_65_871 262
685 3300053091 Ga0500647_0007604 Ga0500647_0007604_578_1366 262
686 3300053093 Ga0500651_0046365 Ga0500651_0046365_427_1218 262
687 3300053109 Ga0500569_016299 Ga0500569_016299_170_961 262
688 3300053119 Ga0500595_042643 Ga0500595_042643_451_1239 262
689 3300053121 Ga0500607_156492 Ga0500607_156492_191_982 262
690 3300053129 Ga0500628_000922 Ga0500628_000922_1550_2341 262
691 3300053130 Ga0500642_0006046 Ga0500642_0006046_2813_3604 262
692 3300053131 Ga0500652_001232 Ga0500652_001232_3224_4015 262
693 3300053131 Ga0500652_075867 Ga0500652_075867_571_1362 262
694 3300053133 Ga0500655_007191 Ga0500655_007191_1064_1855 262
695 3300053136 Ga0500559_0000193 Ga0500559_0000193_29833_30624 262
696 3300053139 Ga0500568_0009200 Ga0500568_0009200_3441_4232 262
697 3300053139 Ga0500568_0086760 Ga0500568_0086760_255_1046 262
698 3300053140 Ga0500573_0056999 Ga0500573_0056999_677_1477 262
699 3300053156 Ga0500622_0000413 Ga0500622_0000413_10084_10875 262
700 3300053156 Ga0500622_0001707 Ga0500622_0001707_15043_15834 262
701 3300053156 Ga0500622_0002091 Ga0500622_0002091_2098_2886 262
702 3300053156 Ga0500622_0205665 Ga0500622_0205665_82_873 262
703 3300053177 Ga0500636_0218752 Ga0500636_0218752_45_836 262
704 3300053730 Ga0500645_002529 Ga0500645_002529_4652_5443 262
705 3300053733 Ga0500552_011783 Ga0500552_011783_229_1017 262
706 3300053739 Ga0500587_001150 Ga0500587_001150_946_1737 262
707 3300060353 Ga0501082_0134862 Ga0501082_0134862_1012_1809 262
708 iso_pu_bacteria 2842747753 2842752918 262
709 iso_pu_bacteria 2900577576 2900580467 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

64

255

0.94

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

138

258

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

69

310

0.92

PF23441

62

313

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9434 11 259
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9432 8 257
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9425 11 262
6t65-assembly1.cif.gz_B crsytal structure of acinetobacter baumannii fabg inhibitor complex at 2.35 a resolution 0.9401 13 262
5cej-assembly1.cif.gz_A the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.50a resolution 0.9387 11 258
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 11 257 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 1 192 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9344 11 257 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9332 11 261 3.40.50.720
af_A0A1D6Q3A1_14_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9324 10 121 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A435WSP9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9642 14 130
AF-A0A535TRS1-F1-model_v4 SDR family oxidoreductase 0.9599 11 128
AF-A0A6I5VG95-F1-model_v4 SDR family oxidoreductase 0.9418 7 262 GO:0016616
AF-A0A832MUH5-F1-model_v4 SDR family oxidoreductase 0.9417 5 192 GO:0016491
AF-A0A1F4BCM0-F1-model_v4 3-oxoacyl-ACP reductase 0.94 11 189 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map