F476637

General Info

Members Datasets Scaffolds Average Seq Length
709 397 669 329

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100222581|Ga0070673_1002225812
Length 361
Sequence MGNEHSDAGPPQGGLRPPRGEASTRSDGALGATLPRFAAVGAGRMGRGIAIAFAYAGHRISIVDLRPRSDEAWQKLRGEAEAEIEASLAGLAQLGVIDAAQVGAIAXRVAFVDXXSAPAALAAAELVFEGVPETLEAKRDAFEHINRHCREDAILTSTTSSILVTQLAALVHRPERFLNMHWLNPAYVIPVVELSCHPGTDPAVLERTKALMEAIGKLPVVCGASPGYIVPRLQALVMNEAARMIEEGAATAEEIDKATRYGLGLRFAALGVVEFIDFGGCDILHHASREMAASIDRARYTTPAIVDRMVEEGRLGLKSGSGFYEYEGRDVGAYRRDVLSRTLGMLKHAGLWQPPAAETRE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543013 Variovorax sp. BT01 Isolate Unclassified
13 2738543019 Variovorax sp. GV040 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842747753 Variovorax sp. R-72060 Isolate Unclassified
19 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2885211737 Variovorax sp. 553 Isolate Unclassified
22 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
25 2904456579 Variovorax sp. 2002 Isolate Unclassified
26 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
27 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
28 2928037797 Variovorax sp. 1126 Isolate Unclassified
29 2928044640 Variovorax sp. 1128 Isolate Unclassified
30 2928051484 Variovorax sp. 1133 Isolate Unclassified
31 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
34 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
35 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
36 2929520902 Variovorax beijingensis 502 Isolate Unclassified
37 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
40 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
83 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
170 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
232 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
233 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
252 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
266 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
267 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
268 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
269 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
270 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
271 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
272 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
273 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
274 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
283 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
352 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
381 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
382 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
383 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
387 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
391 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 0.14
Isolates 5.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.25
Nodule 0.42
Rhizoplane 1.83
Rhizosphere 63.05
Stem 0
Stem Tuber 0
Unclassified 9.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003501 3300002773 Bacteria 5328
2 JGI25150J39212_1001724 3300002774 Bacteria 5866
3 JGI25159J45721_1005177 3300002987 Bacteria 4130
4 JGI25151J46595_10000884 3300003187 Bacteria 23605
5 JGI25151J46595_10001131 3300003187 Bacteria 19391
6 JGI25151J46595_10001895 3300003187 Bacteria 13315
7 JGI25151J46595_10013620 3300003187 Bacteria 3653
8 JGI25153J46596_10007574 3300003215 Bacteria 5313
9 rootH1_10012321 3300003316 Bacteria 3928
10 rootL2_10051089 3300003322 Bacteria 3242
11 rootL2_10055748 3300003322 Bacteria 4787
12 JGI25160J50197_1005251 3300003354 Bacteria 5421
13 JGI25160J50197_1006869 3300003354 Bacteria 4545
14 JGI25161J50226_1002022 3300003374 Bacteria 5534
15 JGI25161J50226_1003243 3300003374 Bacteria 3800
16 Ga0006562J51391_1101148 3300003578 Bacteria 4594
17 Ga0055542_1000009 3300003762 Bacteria 416550
18 Ga0055529_1001127 3300003763 Bacteria 11441
19 Ga0055526_1011021 3300003771 Bacteria 4130
20 Ga0055526_1016946 3300003771 Bacteria 2814
21 Ga0055537_1000011 3300003773 Bacteria 137556
22 Ga0055537_1004264 3300003773 Bacteria 4130
23 Ga0055524_1007760 3300003775 Bacteria 4525
24 Ga0055524_1008910 3300003775 Bacteria 4130
25 Ga0055536_1001862 3300003781 Bacteria 12307
26 Ga0055536_1010873 3300003781 Bacteria 3555
27 Ga0055534_1000020 3300003784 Bacteria 137562
28 Ga0055534_1005003 3300003784 Bacteria 3672
29 Ga0055534_1005481 3300003784 Bacteria 3386
30 Ga0055534_1007068 3300003784 Bacteria 2731
31 Ga0055528_1009260 3300003790 Bacteria 4130
32 Ga0055530_10001397 3300003791 Bacteria 17854
33 Ga0055530_10021165 3300003791 Bacteria 1924
34 Ga0055540_1001207 3300003792 Bacteria 15899
35 Ga0055540_1003435 3300003792 Bacteria 7656
36 Ga0055540_1005079 3300003792 Bacteria 5681
37 Ga0055540_1008609 3300003792 Bacteria 3653
38 Ga0055540_1009163 3300003792 Bacteria 3460
39 Ga0055540_1009576 3300003792 Bacteria 3331
40 Ga0055531_10000265 3300003794 Bacteria 54568
41 Ga0055531_10005088 3300003794 Bacteria 7776
42 Ga0055531_10008108 3300003794 Bacteria 5598
43 Ga0055531_10014627 3300003794 Bacteria 3520
44 Ga0055543_1002918 3300004625 Bacteria 5351
45 Ga0055543_1021689 3300004625 Bacteria 1170
46 Ga0065165_1007487 3300005262 Bacteria 5351
47 Ga0065712_10182771 3300005290 Bacteria 1184
48 Ga0070658_10025112 3300005327 Bacteria 4777
49 Ga0070658_10074970 3300005327 Bacteria 2775
50 Ga0070683_100026669 3300005329 Bacteria 5206
51 Ga0070683_100044470 3300005329 Bacteria 4095
52 Ga0070690_100013882 3300005330 Bacteria 4774
53 Ga0070670_100005546 3300005331 Bacteria 10644
54 Ga0070670_100027243 3300005331 Bacteria 4916
55 Ga0070670_100067111 3300005331 Bacteria 3079
56 Ga0070670_100092173 3300005331 Bacteria 2605
57 Ga0070677_10003382 3300005333 Bacteria 5140
58 Ga0070666_10278498 3300005335 Bacteria 1189
59 Ga0068868_100043119 3300005338 Bacteria 3524
60 Ga0068868_100126454 3300005338 Bacteria 2089
61 Ga0070660_100192020 3300005339 Bacteria 1654
62 Ga0070691_10020416 3300005341 Bacteria 3061
63 Ga0070661_100029916 3300005344 Bacteria 3933
64 Ga0070661_100062601 3300005344 Bacteria 2731
65 Ga0070668_100256562 3300005347 Bacteria 1453
66 Ga0070675_100000635 3300005354 Bacteria 24215
67 Ga0070675_100090507 3300005354 Bacteria 2563
68 Ga0070675_100393866 3300005354 Bacteria 1235
69 Ga0070671_100002597 3300005355 Bacteria 13989
70 Ga0070671_100019600 3300005355 Bacteria 5508
71 Ga0070671_100022133 3300005355 Bacteria 5192
72 Ga0070671_100144940 3300005355 Bacteria 2004
73 Ga0070674_100026543 3300005356 Bacteria 3785
74 Ga0070673_100013219 3300005364 Bacteria 5699
75 Ga0070673_100222581 3300005364 Bacteria 1634
76 Ga0070659_100024749 3300005366 Bacteria 4604
77 Ga0070667_100080705 3300005367 Bacteria 2783
78 Ga0070710_10251981 3300005437 Unclassified 1135
79 Ga0070701_10168430 3300005438 Bacteria 1274
80 Ga0070700_100090546 3300005441 Bacteria 1995
81 Ga0070694_100132862 3300005444 Bacteria 1800
82 Ga0070708_100296071 3300005445 Bacteria 1524
83 Ga0070663_100064345 3300005455 Bacteria 2651
84 Ga0070678_100047822 3300005456 Bacteria 3076
85 Ga0070678_100347254 3300005456 Bacteria 1275
86 Ga0070662_100025092 3300005457 Bacteria 4113
87 Ga0070662_100094013 3300005457 Bacteria 2256
88 Ga0070662_100397587 3300005457 Bacteria 1137
89 Ga0070681_10000175 3300005458 Bacteria 48999
90 Ga0068867_100000428 3300005459 Bacteria 28160
91 Ga0068867_100003674 3300005459 Bacteria 10796
92 Ga0068867_100074154 3300005459 Bacteria 2550
93 Ga0068867_100178470 3300005459 Bacteria 1687
94 Ga0068867_100408142 3300005459 Bacteria 1147
95 Ga0070706_100001519 3300005467 Bacteria 24333
96 Ga0070698_100058761 3300005471 Bacteria 3887
97 Ga0070698_100076768 3300005471 Bacteria 3342
98 Ga0070698_100270777 3300005471 Bacteria 1630
99 Ga0070699_100059744 3300005518 Bacteria 3302
100 Ga0070679_100035754 3300005530 Bacteria 4928
101 Ga0070679_100050863 3300005530 Bacteria 4128
102 Ga0070684_100011605 3300005535 Bacteria 7022
103 Ga0070684_100014195 3300005535 Bacteria 6444
104 Ga0070684_100039922 3300005535 Bacteria 4039
105 Ga0068853_100043050 3300005539 Bacteria 3862
106 Ga0068853_100089057 3300005539 Bacteria 2710
107 Ga0068853_100206188 3300005539 Bacteria 1790
108 Ga0068853_100256398 3300005539 Bacteria 1607
109 Ga0068853_100503382 3300005539 Bacteria 1144
110 Ga0070672_100000188 3300005543 Bacteria 34174
111 Ga0070672_100035212 3300005543 Bacteria 3805
112 Ga0070672_100251445 3300005543 Bacteria 1489
113 Ga0070686_100015078 3300005544 Bacteria 4468
114 Ga0070686_100083439 3300005544 Bacteria 2121
115 Ga0070696_100061847 3300005546 Bacteria 2620
116 Ga0070696_100160656 3300005546 Bacteria 1655
117 Ga0070693_100017897 3300005547 Bacteria 3693
118 Ga0070693_100175929 3300005547 Bacteria 1374
119 Ga0070665_100011217 3300005548 Bacteria 9061
120 Ga0070665_100077624 3300005548 Bacteria 3328
121 Ga0070664_100063811 3300005564 Bacteria 3141
122 Ga0068857_100039725 3300005577 Bacteria 4170
123 Ga0068857_100040500 3300005577 Bacteria 4131
124 Ga0068857_100145308 3300005577 Bacteria 2146
125 Ga0068857_100245987 3300005577 Bacteria 1638
126 Ga0068854_100202421 3300005578 Bacteria 1561
127 Ga0068856_100019589 3300005614 Bacteria 6568
128 Ga0068856_100083507 3300005614 Bacteria 3172
129 Ga0068859_100038576 3300005617 Bacteria 4792
130 Ga0068859_100119353 3300005617 Bacteria 2703
131 Ga0068859_100156473 3300005617 Bacteria 2356
132 Ga0068864_100016644 3300005618 Bacteria 6125
133 Ga0068864_100048182 3300005618 Bacteria 3662
134 Ga0068861_100003931 3300005719 Bacteria 9935
135 Ga0068861_100173692 3300005719 Bacteria 1788
136 Ga0068851_10013256 3300005834 Bacteria 3900
137 Ga0068851_10054130 3300005834 Bacteria 2043
138 Ga0068870_10022385 3300005840 Bacteria 3105
139 Ga0068863_100246047 3300005841 Bacteria 1727
140 Ga0068858_100013451 3300005842 Bacteria 7721
141 Ga0068858_100026462 3300005842 Bacteria 5388
142 Ga0068860_100003712 3300005843 Bacteria 15704
143 Ga0068860_100007838 3300005843 Bacteria 10660
144 Ga0068862_100009256 3300005844 Bacteria 8156
145 Ga0068862_100010258 3300005844 Bacteria 7731
146 Ga0068862_100026748 3300005844 Bacteria 4851
147 Ga0081539_10000233 3300005985 Bacteria 130647
148 Ga0075365_10307452 3300006038 Bacteria 1116
149 Ga0075363_100004888 3300006048 Bacteria 5921
150 Ga0075363_100005543 3300006048 Bacteria 5628
151 Ga0075363_100033782 3300006048 Bacteria 2667
152 Ga0075363_100039517 3300006048 Bacteria 2483
153 Ga0075364_10002462 3300006051 Bacteria 10367
154 Ga0075362_10019257 3300006177 Bacteria 2836
155 Ga0075362_10031834 3300006177 Bacteria 2285
156 Ga0075362_10042693 3300006177 Bacteria 2005
157 Ga0075367_10009261 3300006178 Bacteria 5139
158 Ga0075367_10021564 3300006178 Bacteria 3602
159 Ga0075369_10025866 3300006186 Bacteria 2443
160 Ga0075366_10004246 3300006195 Bacteria 7681
161 Ga0075366_10010842 3300006195 Bacteria 5128
162 Ga0075366_10012754 3300006195 Bacteria 4774
163 Ga0075366_10017232 3300006195 Bacteria 4155
164 Ga0075366_10020508 3300006195 Bacteria 3835
165 Ga0075366_10022934 3300006195 Bacteria 3635
166 Ga0075366_10025548 3300006195 Bacteria 3451
167 Ga0075366_10050650 3300006195 Bacteria 2466
168 Ga0075366_10071144 3300006195 Bacteria 2072
169 Ga0075366_10076056 3300006195 Bacteria 2003
170 Ga0097621_100011749 3300006237 Bacteria 6466
171 Ga0097621_100014096 3300006237 Bacteria 5975
172 Ga0097621_100029031 3300006237 Bacteria 4365
173 Ga0075370_10007645 3300006353 Bacteria 5515
174 Ga0075370_10016681 3300006353 Bacteria 3954
175 Ga0075370_10045153 3300006353 Bacteria 2491
176 Ga0075370_10047720 3300006353 Bacteria 2425
177 Ga0068871_100051422 3300006358 Bacteria 3336
178 Ga0068871_100478267 3300006358 Bacteria 1120
179 Ga0075428_100018493 3300006844 Bacteria 7705
180 Ga0075430_100001924 3300006846 Bacteria 17039
181 Ga0075431_100000645 3300006847 Bacteria 29557
182 Ga0075431_100245020 3300006847 Bacteria 1822
183 Ga0075429_100000476 3300006880 Bacteria 29908
184 Ga0068865_100000919 3300006881 Bacteria 16683
185 Ga0075436_100009711 3300006914 Bacteria 6583
186 Ga0097620_100038576 3300006931 Bacteria 4792
187 Ga0097620_100119344 3300006931 Bacteria 2703
188 Ga0097620_100156475 3300006931 Bacteria 2356
189 Ga0099826_10000432 3300006948 Bacteria 19961
190 Ga0105244_10001781 3300009036 Bacteria 16898
191 Ga0105244_10061924 3300009036 Bacteria 1882
192 Ga0105240_10077802 3300009093 Bacteria 4086
193 Ga0105240_10144453 3300009093 Bacteria 2841
194 Ga0111539_10405974 3300009094 Bacteria 1587
195 Ga0111539_10498442 3300009094 Bacteria 1418
196 Ga0105245_10109324 3300009098 Bacteria 2569
197 Ga0105245_10436644 3300009098 Bacteria 1315
198 Ga0114129_10002793 3300009147 Bacteria 24352
199 Ga0105243_10002000 3300009148 Bacteria 17343
200 Ga0105243_10005462 3300009148 Bacteria 9916
201 Ga0105243_10024964 3300009148 Bacteria 4564
202 Ga0105243_10086372 3300009148 Bacteria 2573
203 Ga0105243_10386886 3300009148 Bacteria 1295
204 Ga0105241_10083373 3300009174 Bacteria 2508
205 Ga0105248_10205018 3300009177 Bacteria 2222
206 Ga0105248_10337097 3300009177 Bacteria 1698
207 Ga0105249_10035064 3300009553 Bacteria 4548
208 Ga0105249_10134229 3300009553 Bacteria 2367
209 Ga0105239_10033940 3300010375 Bacteria 5602
210 Ga0105246_10142335 3300011119 Bacteria 1805
211 Ga0157373_10007987 3300013100 Bacteria 7867
212 Ga0157373_10072148 3300013100 Bacteria 2437
213 Ga0157371_10057838 3300013102 Bacteria 2750
214 Ga0157370_10004758 3300013104 Bacteria 15452
215 Ga0157369_10020698 3300013105 Bacteria 7355
216 Ga0157369_10021810 3300013105 Bacteria 7161
217 Ga0157369_10055285 3300013105 Bacteria 4285
218 Ga0157369_10085647 3300013105 Bacteria 3367
219 Ga0157374_10051039 3300013296 Bacteria 3848
220 Ga0157378_10005326 3300013297 Bacteria 11291
221 Ga0157378_10094159 3300013297 Bacteria 2728
222 Ga0157372_10009605 3300013307 Bacteria 10280
223 Ga0157372_10037609 3300013307 Bacteria 5340
224 Ga0157372_10116622 3300013307 Bacteria 3062
225 Ga0157375_10049857 3300013308 Bacteria 4104
226 Ga0157375_10067681 3300013308 Bacteria 3569
227 Ga0157375_10251976 3300013308 Bacteria 1926
228 Ga0157380_10068813 3300014326 Bacteria 2855
229 Ga0182008_10002890 3300014497 Bacteria 10629
230 Ga0182008_10054927 3300014497 Bacteria 1970
231 Ga0182008_10060742 3300014497 Bacteria 1863
232 Ga0157379_10069093 3300014968 Bacteria 3159
233 Ga0157379_10084937 3300014968 Bacteria 2836
234 Ga0157376_10035508 3300014969 Bacteria 4032
235 Ga0157376_10119404 3300014969 Bacteria 2334
236 Ga0182006_1005774 3300015261 Bacteria 5837
237 Ga0182006_1043948 3300015261 Bacteria 1744
238 Ga0182007_10000298 3300015262 Bacteria 32177
239 Ga0182005_1021497 3300015265 Bacteria 1770
240 Ga0182005_1025023 3300015265 Bacteria 1629
241 Ga0183362_10001 3300015683 Bacteria 2046624
242 Ga0163161_10000042 3300017792 Bacteria 135368
243 Ga0163161_10018527 3300017792 Bacteria 4878
244 Ga0163161_10088969 3300017792 Bacteria 2283
245 Ga0209436_107422 3300025208 Bacteria 2293
246 Ga0209436_108296 3300025208 Bacteria 2082
247 Ga0209672_104501 3300025228 Bacteria 2576
248 Ga0209147_100373 3300025229 Bacteria 31414
249 Ga0209258_100009 3300025242 Bacteria 996276
250 Ga0207425_1000590 3300025245 Bacteria 21180
251 Ga0207425_1005361 3300025245 Bacteria 3667
252 Ga0209148_1000007 3300025254 Bacteria 1592273
253 Ga0209129_1000013 3300025258 Bacteria 524874
254 Ga0209129_1000415 3300025258 Bacteria 33012
255 Ga0209565_1000058 3300025263 Bacteria 194126
256 Ga0209565_1000197 3300025263 Bacteria 71850
257 Ga0209565_1004258 3300025263 Bacteria 4420
258 Ga0209455_1000534 3300025272 Bacteria 26400
259 Ga0209673_1000053 3300025273 Bacteria 279449
260 Ga0209673_1000245 3300025273 Bacteria 103315
261 Ga0209673_1000535 3300025273 Bacteria 62272
262 Ga0209673_1005273 3300025273 Bacteria 6564
263 Ga0209130_1000163 3300025284 Bacteria 98074
264 Ga0209130_1001170 3300025284 Bacteria 18856
265 Ga0209130_1002376 3300025284 Bacteria 9542
266 Ga0209675_1000010 3300025291 Bacteria 541927
267 Ga0209675_1000440 3300025291 Bacteria 32862
268 Ga0209675_1001994 3300025291 Bacteria 10957
269 Ga0209675_1003630 3300025291 Bacteria 7240
270 Ga0209676_1000108 3300025292 Bacteria 221168
271 Ga0209676_1000653 3300025292 Bacteria 49661
272 Ga0209676_1001003 3300025292 Bacteria 33089
273 Ga0209676_1010636 3300025292 Bacteria 3801
274 Ga0209676_1018846 3300025292 Bacteria 2394
275 Ga0209025_1000103 3300025294 Bacteria 228054
276 Ga0209025_1000129 3300025294 Bacteria 198847
277 Ga0209025_1000169 3300025294 Bacteria 161428
278 Ga0209025_1015590 3300025294 Bacteria 4565
279 Ga0209564_1000171 3300025295 Bacteria 155716
280 Ga0209564_1000517 3300025295 Bacteria 63233
281 Ga0209758_1000067 3300025297 Bacteria 288575
282 Ga0209050_1000002 3300025298 Bacteria 1792849
283 Ga0209050_1001558 3300025298 Bacteria 23912
284 Ga0209050_1006217 3300025298 Bacteria 7164
285 Ga0209256_1000077 3300025299 Bacteria 230410
286 Ga0209256_1000121 3300025299 Bacteria 167299
287 Ga0207426_1000101 3300025302 Bacteria 262096
288 Ga0207426_1000129 3300025302 Bacteria 210930
289 Ga0209051_1000002 3300025303 Bacteria 1631846
290 Ga0209051_1000145 3300025303 Bacteria 134807
291 Ga0209051_1000252 3300025303 Bacteria 90654
292 Ga0209051_1000289 3300025303 Bacteria 80415
293 Ga0209051_1000501 3300025303 Bacteria 49660
294 Ga0209051_1002533 3300025303 Bacteria 12921
295 Ga0209051_1013408 3300025303 Bacteria 3902
296 Ga0209257_1000002 3300025304 Bacteria 1767052
297 Ga0209257_1000012 3300025304 Bacteria 1111138
298 Ga0209257_1001684 3300025304 Bacteria 24845
299 Ga0209257_1003753 3300025304 Bacteria 12550
300 Ga0209257_1037010 3300025304 Bacteria 1492
301 Ga0207697_10040075 3300025315 Bacteria 1923
302 Ga0207656_10035733 3300025321 Bacteria 2082
303 Ga0207656_10055860 3300025321 Bacteria 1720
304 Ga0207655_1001616 3300025728 Bacteria 20066
305 Ga0207688_10075285 3300025901 Bacteria 1921
306 Ga0207645_10004557 3300025907 Bacteria 10230
307 Ga0207645_10068841 3300025907 Bacteria 2264
308 Ga0207645_10098456 3300025907 Bacteria 1885
309 Ga0207643_10068410 3300025908 Bacteria 2040
310 Ga0207705_10012949 3300025909 Bacteria 6019
311 Ga0207705_10105784 3300025909 Bacteria 2075
312 Ga0207684_10006075 3300025910 Bacteria 11049
313 Ga0207707_10000660 3300025912 Bacteria 34202
314 Ga0207671_10014895 3300025914 Bacteria 6116
315 Ga0207657_10047837 3300025919 Bacteria 3737
316 Ga0207649_10007994 3300025920 Bacteria 5754
317 Ga0207652_10060917 3300025921 Bacteria 3258
318 Ga0207681_10013857 3300025923 Bacteria 4995
319 Ga0207650_10000748 3300025925 Bacteria 25074
320 Ga0207650_10056300 3300025925 Bacteria 2921
321 Ga0207659_10037765 3300025926 Bacteria 3355
322 Ga0207659_10046168 3300025926 Bacteria 3075
323 Ga0207659_10371671 3300025926 Bacteria 1190
324 Ga0207644_10013153 3300025931 Bacteria 5510
325 Ga0207644_10022994 3300025931 Bacteria 4264
326 Ga0207644_10023506 3300025931 Bacteria 4223
327 Ga0207644_10168745 3300025931 Bacteria 1707
328 Ga0207690_10006705 3300025932 Bacteria 6822
329 Ga0207706_10020413 3300025933 Bacteria 5956
330 Ga0207709_10000375 3300025935 Bacteria 44662
331 Ga0207709_10009694 3300025935 Bacteria 5306
332 Ga0207669_10012504 3300025937 Bacteria 4177
333 Ga0207704_10009150 3300025938 Bacteria 4766
334 Ga0207691_10001187 3300025940 Bacteria 25907
335 Ga0207691_10092780 3300025940 Bacteria 2704
336 Ga0207689_10154801 3300025942 Bacteria 1890
337 Ga0207661_10139377 3300025944 Bacteria 2086
338 Ga0207679_10013185 3300025945 Bacteria 5414
339 Ga0207679_10036634 3300025945 Bacteria 3480
340 Ga0207679_10043476 3300025945 Bacteria 3235
341 Ga0207651_10007651 3300025960 Bacteria 5767
342 Ga0207658_10043181 3300025986 Bacteria 3276
343 Ga0207677_10009993 3300026023 Bacteria 5355
344 Ga0207677_10100834 3300026023 Bacteria 2124
345 Ga0207703_10091068 3300026035 Bacteria 2564
346 Ga0207639_10093316 3300026041 Bacteria 2414
347 Ga0207678_10064746 3300026067 Bacteria 3141
348 Ga0207708_10018408 3300026075 Bacteria 5260
349 Ga0207702_10010757 3300026078 Bacteria 7638
350 Ga0207702_10057881 3300026078 Bacteria 3296
351 Ga0207648_10001166 3300026089 Bacteria 29390
352 Ga0207648_10001269 3300026089 Bacteria 28173
353 Ga0207648_10040126 3300026089 Bacteria 4114
354 Ga0207648_10399206 3300026089 Bacteria 1246
355 Ga0207676_10007264 3300026095 Bacteria 7848
356 Ga0207676_10045713 3300026095 Bacteria 3384
357 Ga0207674_10012160 3300026116 Bacteria 9636
358 Ga0207674_10025299 3300026116 Bacteria 6334
359 Ga0207674_10071507 3300026116 Bacteria 3485
360 Ga0207674_10152689 3300026116 Bacteria 2266
361 Ga0207675_100000838 3300026118 Bacteria 30617
362 Ga0207675_100127126 3300026118 Bacteria 2415
363 Ga0207683_10004545 3300026121 Bacteria 11957
364 Ga0207683_10026834 3300026121 Bacteria 4975
365 Ga0207683_10038469 3300026121 Bacteria 4170
366 Ga0209282_1001250 3300027666 Bacteria 13759
367 Ga0209813_10054337 3300027866 Bacteria 1262
368 Ga0207428_10137288 3300027907 Bacteria 1869
369 Ga0268266_10013898 3300028379 Bacteria 6932
370 Ga0268266_10393223 3300028379 Bacteria 1310
371 Ga0268265_10005821 3300028380 Bacteria 8407
372 Ga0268265_10070045 3300028380 Bacteria 2726
373 Ga0268264_10014746 3300028381 Bacteria 6421
374 Ga0268264_10045871 3300028381 Bacteria 3630
375 Ga0307517_10000196 3300028786 Bacteria 102384
376 Ga0307517_10004307 3300028786 Bacteria 21926
377 Ga0307515_10000014 3300028794 Bacteria 562358
378 Ga0307515_10000424 3300028794 Bacteria 101910
379 Ga0307515_10002595 3300028794 Bacteria 38945
380 Ga0307515_10034279 3300028794 Bacteria 8320
381 Ga0307515_10310832 3300028794 Bacteria 1251
382 Ga0316179_1007438 3300030734 Bacteria 3062
383 Ga0316178_1036479 3300030735 Bacteria 1232
384 Ga0316183_1021428 3300030742 Bacteria 2821
385 Ga0316183_1120317 3300030742 Bacteria 1748
386 Ga0265327_10000806 3300031251 Bacteria 47753
387 Ga0307513_10069162 3300031456 Bacteria 3695
388 Ga0307509_10001286 3300031507 Bacteria 42598
389 Ga0307509_10025821 3300031507 Bacteria 6560
390 Ga0307509_10219003 3300031507 Bacteria 1719
391 Ga0307509_10248800 3300031507 Bacteria 1563
392 Ga0307408_100023580 3300031548 Bacteria 4193
393 Ga0307408_100186067 3300031548 Bacteria 1669
394 Ga0307408_100205828 3300031548 Bacteria 1596
395 Ga0307508_10015309 3300031616 Bacteria 6988
396 Ga0307508_10126918 3300031616 Bacteria 2154
397 Ga0307514_10040739 3300031649 Bacteria 3660
398 Ga0307516_10166161 3300031730 Bacteria 1951
399 Ga0307516_10166543 3300031730 Bacteria 1948
400 Ga0307405_10006212 3300031731 Bacteria 5856
401 Ga0307405_10007635 3300031731 Bacteria 5428
402 Ga0307405_10025741 3300031731 Bacteria 3382
403 Ga0307405_10089630 3300031731 Bacteria 2032
404 Ga0307405_10116992 3300031731 Bacteria 1816
405 Ga0307405_10159118 3300031731 Bacteria 1597
406 Ga0307405_10238908 3300031731 Bacteria 1344
407 Ga0307405_10318018 3300031731 Bacteria 1188
408 Ga0307410_10359624 3300031852 Bacteria 1165
409 Ga0307406_10334179 3300031901 Bacteria 1177
410 Ga0307412_10032318 3300031911 Bacteria 3314
411 Ga0307412_10054656 3300031911 Bacteria 2651
412 Ga0307412_10081552 3300031911 Bacteria 2237
413 Ga0307412_10091615 3300031911 Bacteria 2128
414 Ga0307409_100118691 3300031995 Bacteria 2235
415 Ga0307416_100053538 3300032002 Bacteria 3238
416 Ga0307416_100055750 3300032002 Bacteria 3185
417 Ga0307416_100073436 3300032002 Bacteria 2852
418 Ga0307416_100125974 3300032002 Bacteria 2294
419 Ga0307416_100419473 3300032002 Bacteria 1382
420 Ga0307411_10039636 3300032005 Bacteria 2982
421 Ga0307411_10074470 3300032005 Bacteria 2314
422 Ga0307415_100003121 3300032126 Bacteria 8393
423 Ga0307415_100142940 3300032126 Bacteria 1830
424 Ga0307510_10002924 3300033180 Bacteria 19645
425 Ga0307510_10161888 3300033180 Bacteria 1833
426 Ga0373948_0022584 3300034817 Unclassified 1214
427 Ga0373938_0007684 3300034957 Bacteria 1904
428 Ga0373960_0035775 3300035121 Bacteria 1411
429 Ga0373943_0025212 3300035170 Bacteria 2779
430 Ga0373946_0115287 3300035171 Bacteria 1221
431 Ga0316574_0010549 3300035398 Bacteria 5226
432 Ga0373927_0047357 3300035695 Bacteria 2781
433 Ga0373937_0133815 3300036401 Bacteria 2317
434 Ga0373937_0367515 3300036401 Bacteria 1364
435 Ga0373925_0003526 3300037068 Bacteria 12067
436 Ga0395899_0002692 3300037312 Bacteria 14327
437 Ga0395899_0062951 3300037312 Bacteria 2731
438 Ga0395900_0010858 3300037418 Bacteria 9315
439 Ga0395900_0095943 3300037418 Bacteria 3047
440 Ga0395898_0028661 3300037466 Bacteria 5579
441 Ga0395898_0059152 3300037466 Bacteria 3729
442 Ga0395905_0107359 3300037471 Bacteria 2621
443 Ga0395905_0167594 3300037471 Bacteria 2064
444 Ga0395901_0013558 3300038443 Bacteria 8288
445 Ga0395901_0419762 3300038443 Bacteria 1372
446 Ga0436363_1647914 3300039450 Bacteria 3918
447 Ga0439436_0000074 3300041404 Bacteria 25886
448 Ga0439436_0003672 3300041404 Bacteria 4678
449 Ga0439436_0017877 3300041404 Bacteria 2122
450 Ga0439439_0001203 3300041406 Bacteria 5011
451 Ga0439439_0002957 3300041406 Bacteria 3692
452 Ga0439447_007723 3300041407 Bacteria 3387
453 Ga0439466_0013978 3300041411 Bacteria 2930
454 Ga0439466_0037552 3300041411 Bacteria 1630
455 Ga0439466_0042792 3300041411 Bacteria 1506
456 Ga0439465_0003681 3300041413 Bacteria 4996
457 Ga0439431_0000361 3300041997 Bacteria 9565
458 Ga0439433_0006567 3300041999 Bacteria 2504
459 Ga0439433_0021321 3300041999 Bacteria 1449
460 Ga0439442_007050 3300042002 Bacteria 2256
461 Ga0439445_0001373 3300042004 Bacteria 5276
462 Ga0439432_001162 3300042006 Bacteria 9959
463 Ga0439432_063073 3300042006 Bacteria 1139
464 Ga0439449_0002224 3300042007 Bacteria 7633
465 Ga0439449_0004686 3300042007 Bacteria 5281
466 Ga0439457_011445 3300042014 Bacteria 2019
467 Ga0439462_0002186 3300042015 Bacteria 4508
468 Ga0439462_0042206 3300042015 Bacteria 1218
469 Ga0450921_003496 3300042123 Bacteria 1108
470 Ga0450923_011036 3300042125 Bacteria 1617
471 Ga0439434_0009992 3300042435 Bacteria 2793
472 Ga0439464_0011345 3300042439 Bacteria 2361
473 Ga0450918_004653 3300042531 Bacteria 2489
474 Ga0450893_0011234 3300042532 Bacteria 1478
475 Ga0450893_0024001 3300042532 Bacteria 1063
476 Ga0451577_0018204 3300042876 Bacteria 6473
477 Ga0466972_0054738 3300044658 Bacteria 1919
478 Ga0466965_0006009 3300044683 Bacteria 5485
479 Ga0466965_0093831 3300044683 Bacteria 1529
480 Ga0466965_0150119 3300044683 Bacteria 1218
481 Ga0466966_0029976 3300044684 Bacteria 3537
482 Ga0466957_0052609 3300044842 Bacteria 2480
483 Ga0466959_0273361 3300045049 Bacteria 1161
484 Ga0466967_0139821 3300045976 Bacteria 2254
485 Ga0495592_0009766 3300046454 Bacteria 7223
486 Ga0495629_0026455 3300046459 Bacteria 4121
487 Ga0495638_0029205 3300046460 Bacteria 3556
488 Ga0495651_0026102 3300046462 Bacteria 4549
489 Ga0495616_0010064 3300046513 Bacteria 5487
490 Ga0495620_0053995 3300046515 Bacteria 1699
491 Ga0495630_0093704 3300046517 Bacteria 2270
492 Ga0495631_0000088 3300046518 Bacteria 59630
493 Ga0495631_0056712 3300046518 Bacteria 1706
494 Ga0495632_0023965 3300046519 Bacteria 3250
495 Ga0495632_0027467 3300046519 Bacteria 2981
496 Ga0495637_0003001 3300046520 Bacteria 9055
497 Ga0495621_0043897 3300046539 Bacteria 1578
498 Ga0495597_0039461 3300046542 Bacteria 2114
499 Ga0495597_0044840 3300046542 Bacteria 1965
500 Ga0495656_0000106 3300046615 Bacteria 34172
501 Ga0495668_0099156 3300046616 Bacteria 1594
502 Ga0495625_0002306 3300046660 Bacteria 20876
503 Ga0495625_0078708 3300046660 Bacteria 2301
504 Ga0495646_0098379 3300046680 Bacteria 1680
505 Ga0495647_0042133 3300046681 Bacteria 1742
506 Ga0495649_0017929 3300046694 Bacteria 3989
507 Ga0495660_0067142 3300046810 Bacteria 1911
508 Ga0495676_0002416 3300047321 Bacteria 16576
509 Ga0495687_000685 3300047443 Bacteria 38430
510 Ga0495687_006026 3300047443 Bacteria 7555
511 Ga0495687_010622 3300047443 Bacteria 5036
512 Ga0495593_0007745 3300047673 Bacteria 6262
513 Ga0495602_0224877 3300048088 Bacteria 1414
514 Ga0495614_0001061 3300048089 Bacteria 11765
515 Ga0495626_0123573 3300048091 Bacteria 1110
516 Ga0496101_0086446 3300048904 Bacteria 2325
517 Ga0496101_0104298 3300048904 Bacteria 2126
518 Ga0496102_0062097 3300048905 Bacteria 3421
519 Ga0496102_0159067 3300048905 Bacteria 2124
520 Ga0496104_0390720 3300048907 Bacteria 1303
521 Ga0496105_0129684 3300048908 Bacteria 2079
522 Ga0496105_0512043 3300048908 Bacteria 941
523 Ga0496110_0555823 3300048913 Bacteria 1043
524 Ga0496114_0061620 3300048917 Bacteria 3138
525 Ga0496114_0063490 3300048917 Bacteria 3092
526 Ga0496117_0011528 3300048920 Bacteria 7910
527 Ga0496117_0112727 3300048920 Bacteria 1690
528 Ga0496117_0161533 3300048920 Bacteria 1312
529 Ga0496118_0014670 3300048921 Bacteria 7323
530 Ga0496118_0034068 3300048921 Bacteria 4164
531 Ga0496121_0036930 3300048924 Bacteria 4346
532 Ga0496121_0135167 3300048924 Bacteria 1838
533 Ga0496122_0000528 3300048925 Bacteria 79201
534 Ga0496122_0125482 3300048925 Bacteria 1644
535 Ga0496123_0000308 3300048926 Bacteria 94712
536 Ga0496123_0016199 3300048926 Bacteria 6069
537 Ga0496123_0097867 3300048926 Bacteria 1717
538 Ga0496124_0053577 3300048927 Bacteria 3418
539 Ga0496124_0088713 3300048927 Bacteria 2527
540 Ga0496124_0137637 3300048927 Bacteria 1931
541 Ga0496125_0004247 3300048928 Bacteria 16695
542 Ga0496125_0028035 3300048928 Bacteria 5093
543 Ga0496125_0029090 3300048928 Bacteria 4973
544 Ga0496125_0160881 3300048928 Bacteria 1525
545 Ga0496125_0163199 3300048928 Bacteria 1510
546 Ga0496125_0195810 3300048928 Bacteria 1329
547 Ga0501303_002153 3300049526 Bacteria 1505
548 Ga0501033_0010954 3300049570 Bacteria 6950
549 Ga0501034_0044857 3300049571 Bacteria 4469
550 Ga0501036_0013718 3300049572 Bacteria 6738
551 Ga0501038_0004011 3300049574 Bacteria 13676
552 Ga0501038_0032296 3300049574 Bacteria 4620
553 Ga0501039_0034867 3300049575 Bacteria 3883
554 Ga0501039_0057504 3300049575 Bacteria 3011
555 Ga0501040_0000158 3300049576 Bacteria 37510
556 Ga0501040_0003761 3300049576 Bacteria 9837
557 Ga0501041_0000402 3300049577 Bacteria 21806
558 Ga0501041_0001759 3300049577 Bacteria 12153
559 Ga0501041_0161340 3300049577 Bacteria 1402
560 Ga0501042_0006708 3300049578 Bacteria 7502
561 Ga0501042_0037523 3300049578 Bacteria 3439
562 Ga0501043_0000052 3300049579 Bacteria 106686
563 Ga0501043_0011563 3300049579 Bacteria 6906
564 Ga0501046_0000423 3300049580 Bacteria 42227
565 Ga0501046_0002696 3300049580 Bacteria 16522
566 Ga0501046_0019371 3300049580 Bacteria 5646
567 Ga0501047_0000039 3300049581 Bacteria 187849
568 Ga0501048_0005001 3300049582 Bacteria 10109
569 Ga0501048_0006812 3300049582 Bacteria 8678
570 Ga0501067_0063540 3300049583 Bacteria 2044
571 Ga0501070_0131858 3300049586 Bacteria 2064
572 Ga0501071_0001483 3300049587 Bacteria 13639
573 Ga0501071_0031190 3300049587 Bacteria 3776
574 Ga0501071_0231713 3300049587 Bacteria 1391
575 Ga0501072_0001081 3300049588 Bacteria 20222
576 Ga0501072_0005126 3300049588 Bacteria 9964
577 Ga0501072_0054663 3300049588 Bacteria 3146
578 Ga0501072_0096577 3300049588 Bacteria 2348
579 Ga0501073_0270013 3300049589 Bacteria 1174
580 Ga0501074_0006814 3300049590 Bacteria 8253
581 Ga0501075_0000114 3300049591 Bacteria 38676
582 Ga0501075_0061859 3300049591 Bacteria 2821
583 Ga0501076_0000382 3300049592 Bacteria 27649
584 Ga0501076_0001519 3300049592 Bacteria 15560
585 Ga0501077_0000229 3300049593 Bacteria 33036
586 Ga0501077_0089535 3300049593 Bacteria 1950
587 Ga0501077_0189384 3300049593 Bacteria 1307
588 Ga0501257_021486 3300049686 Bacteria 1522
589 Ga0501225_0021786 3300049705 Bacteria 1769
590 Ga0501079_0000666 3300049741 Bacteria 23023
591 Ga0501079_0005639 3300049741 Bacteria 9343
592 Ga0501080_0019726 3300049742 Bacteria 6243
593 Ga0501080_0023073 3300049742 Bacteria 5770
594 Ga0501081_0000108 3300049743 Bacteria 35118
595 Ga0501081_0006217 3300049743 Bacteria 7739
596 Ga0501081_0068580 3300049743 Bacteria 2469
597 Ga0501035_0006648 3300049822 Bacteria 10817
598 Ga0501035_0009909 3300049822 Bacteria 8846
599 Ga0501044_0000185 3300049823 Bacteria 77663
600 Ga0501045_0011185 3300049824 Bacteria 6292
601 Ga0501045_0017400 3300049824 Bacteria 5103
602 Ga0501045_0020888 3300049824 Bacteria 4681
603 nmdc:mga03683_38495_c1 3300050489 Bacteria 1953
604 nmdc:mga03683_48280_c1 3300050489 Bacteria 1769
605 nmdc:mga03683_4879_c1 3300050489 Bacteria 4478
606 nmdc:mga03n38_10621_c1 3300050490 Bacteria 3397
607 nmdc:mga00v17_13154_c1 3300050491 Bacteria 4586
608 nmdc:mga00v17_230306_c1 3300050491 Bacteria 1200
609 nmdc:mga0yw44_10570_c1 3300050492 Bacteria 4722
610 nmdc:mga0k408_10224_c1 3300050493 Bacteria 5073
611 nmdc:mga0k408_112905_c1 3300050493 Bacteria 1607
612 nmdc:mga0k408_27283_c1 3300050493 Bacteria 3243
613 nmdc:mga0k408_60457_c1 3300050493 Bacteria 2202
614 nmdc:mga0k408_98948_c1 3300050493 Bacteria 1719
615 nmdc:mga06z11_68112_c1 3300050494 Bacteria 1875
616 nmdc:mga06z11_7262_c1 3300050494 Bacteria 4548
617 nmdc:mga04h51_5261_c1 3300050495 Bacteria 3288
618 nmdc:mga04h51_63068_c1 3300050495 Bacteria 1275
619 nmdc:mga07m45_12052_c1 3300050496 Bacteria 4560
620 nmdc:mga07m45_24438_c1 3300050496 Bacteria 3310
621 nmdc:mga07m45_2773_c1 3300050496 Bacteria 8276
622 nmdc:mga07m45_3471_c1 3300050496 Bacteria 7601
623 nmdc:mga07m45_54_c1 3300050496 Bacteria 49018
624 nmdc:mga07m45_71780_c1 3300050496 Bacteria 1970
625 nmdc:mga07m45_7379_c1 3300050496 Bacteria 5616
626 nmdc:mga07m45_8551_c1 3300050496 Bacteria 5268
627 nmdc:mga09592_59_c1 3300050508 Bacteria 60821
628 nmdc:mga0qj67_38522_c1 3300050509 Bacteria 3751
629 nmdc:mga06r32_296677_c1 3300050510 Bacteria 1603
630 nmdc:mga06r32_77902_c1 3300050510 Bacteria 3221
631 nmdc:mga08x19_3928_c1 3300050514 Bacteria 8852
632 Ga0495601_0041396 3300053077 Bacteria 2888
633 Ga0500610_0002813 3300053079 Bacteria 6526
634 Ga0500610_0004548 3300053079 Bacteria 5532
635 Ga0500610_0013844 3300053079 Bacteria 3767
636 Ga0500643_009215 3300053087 Bacteria 3790
637 Ga0500644_0017691 3300053088 Bacteria 2075
638 Ga0500651_0000056 3300053093 Bacteria 72712
639 Ga0500566_0017204 3300053094 Bacteria 4245
640 Ga0500571_000344 3300053110 Bacteria 18321
641 Ga0500593_002457 3300053117 Bacteria 6800
642 Ga0500594_0002730 3300053118 Bacteria 3845
643 Ga0500594_0013231 3300053118 Bacteria 1958
644 Ga0500607_001013 3300053121 Bacteria 26660
645 Ga0500608_010021 3300053122 Bacteria 4052
646 Ga0500608_030956 3300053122 Bacteria 2538
647 Ga0500626_022077 3300053128 Bacteria 2843
648 Ga0500655_000657 3300053133 Bacteria 6875
649 Ga0500658_0000487 3300053134 Bacteria 16958
650 Ga0500658_0000584 3300053134 Bacteria 15340
651 Ga0500559_0000134 3300053136 Bacteria 56963
652 Ga0500559_0006783 3300053136 Bacteria 5139
653 Ga0500564_006905 3300053138 Bacteria 4777
654 Ga0500619_026564 3300053154 Bacteria 1725
655 Ga0500622_0006815 3300053156 Bacteria 6570
656 Ga0500627_0000353 3300053158 Bacteria 12475
657 Ga0500634_0026423 3300053161 Bacteria 3162
658 Ga0500638_014624 3300053162 Bacteria 3584
659 Ga0500636_0036388 3300053177 Bacteria 2914
660 Ga0500645_051805 3300053730 Bacteria 1197
661 Ga0500596_007015 3300053735 Bacteria 1867
662 Ga0501084_0006785 3300054114 Bacteria 9412
663 Ga0501084_0047654 3300054114 Bacteria 3589
664 Ga0501084_0189765 3300054114 Bacteria 1734
665 Ga0501082_0009902 3300060353 Bacteria 8215
666 Ga0501082_0013762 3300060353 Bacteria 6955
667 Ga0501082_0153045 3300060353 Bacteria 2004
668 Ga0530510_0000606 3300061734 Bacteria 23066
669 Ga0530510_0002478 3300061734 Bacteria 12674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10057881 Ga0207702_100578812 293
2 3300046519 Ga0495632_0027467 Ga0495632_0027467_1231_2190 293
3 3300005355 Ga0070671_100019600 Ga0070671_1000196002 294
4 3300045976 Ga0466967_0139821 Ga0466967_0139821_1108_2070 295
5 3300046518 Ga0495631_0056712 Ga0495631_0056712_803_1690 295
6 3300048907 Ga0496104_0390720 Ga0496104_0390720_20_973 295
7 3300006914 Ga0075436_100009711 Ga0075436_1000097112 297
8 3300050514 nmdc:mga08x19_3928_c1 nmdc:mga08x19_3928_c1_6246_7205 297
9 3300005329 Ga0070683_100044470 Ga0070683_1000444704 298
10 3300005330 Ga0070690_100013882 Ga0070690_1000138823 298
11 3300005535 Ga0070684_100014195 Ga0070684_1000141953 298
12 3300005544 Ga0070686_100015078 Ga0070686_1000150784 298
13 3300006237 Ga0097621_100011749 Ga0097621_1000117494 298
14 3300009177 Ga0105248_10205018 Ga0105248_102050182 298
15 3300014969 Ga0157376_10119404 Ga0157376_101194042 298
16 3300032126 Ga0307415_100003121 Ga0307415_1000031212 298
17 3300034957 Ga0373938_0007684 Ga0373938_0007684_172_1110 298
18 3300025901 Ga0207688_10075285 Ga0207688_100752852 299
19 3300005518 Ga0070699_100059744 Ga0070699_1000597443 300
20 3300025945 Ga0207679_10036634 Ga0207679_100366342 300
21 3300042532 Ga0450893_0024001 Ga0450893_0024001_150_1052 300
22 3300009098 Ga0105245_10436644 Ga0105245_104366441 301
23 3300035170 Ga0373943_0025212 Ga0373943_0025212_1107_2093 301
24 3300049588 Ga0501072_0096577 Ga0501072_0096577_692_1651 301
25 3300054114 Ga0501084_0189765 Ga0501084_0189765_465_1424 301
26 3300060353 Ga0501082_0153045 Ga0501082_0153045_186_1145 301
27 3300009094 Ga0111539_10405974 Ga0111539_104059742 302
28 3300048908 Ga0496105_0512043 Ga0496105_0512043_21_929 302
29 3300028794 Ga0307515_10034279 Ga0307515_100342791 303
30 3300003322 rootL2_10051089 rootL2_100510894 307
31 3300006846 Ga0075430_100001924 Ga0075430_1000019245 308
32 3300006847 Ga0075431_100245020 Ga0075431_1002450202 308
33 3300031507 Ga0307509_10219003 Ga0307509_102190031 308
34 3300048925 Ga0496122_0000528 Ga0496122_0000528_41556_42566 308
35 3300048926 Ga0496123_0000308 Ga0496123_0000308_12250_13260 308
36 3300005985 Ga0081539_10000233 Ga0081539_1000023341 310
37 3300025931 Ga0207644_10013153 Ga0207644_100131532 310
38 3300044683 Ga0466965_0150119 Ga0466965_0150119_205_1161 310
39 3300048904 Ga0496101_0086446 Ga0496101_0086446_178_1176 310
40 3300048908 Ga0496105_0129684 Ga0496105_0129684_681_1679 310
41 3300048917 Ga0496114_0063490 Ga0496114_0063490_1641_2639 310
42 3300003187 JGI25151J46595_10001895 JGI25151J46595_1000189511 311
43 3300025294 Ga0209025_1000103 Ga0209025_1000103157 311
44 3300050493 nmdc:mga0k408_27283_c1 nmdc:mga0k408_27283_c1_1736_2674 312
45 3300050496 nmdc:mga07m45_54_c1 nmdc:mga07m45_54_c1_33948_34886 312
46 3300048917 Ga0496114_0061620 Ga0496114_0061620_269_1288 313
47 3300006195 Ga0075366_10050650 Ga0075366_100506503 314
48 3300025931 Ga0207644_10168745 Ga0207644_101687452 314
49 3300050496 nmdc:mga07m45_71780_c1 nmdc:mga07m45_71780_c1_100_1125 314
50 3300036401 Ga0373937_0133815 Ga0373937_0133815_1064_2050 315
51 3300046459 Ga0495629_0026455 Ga0495629_0026455_439_1425 315
52 3300046681 Ga0495647_0042133 Ga0495647_0042133_687_1673 315
53 3300053077 Ga0495601_0041396 Ga0495601_0041396_464_1450 315
54 3300032002 Ga0307416_100125974 Ga0307416_1001259742 316
55 3300049526 Ga0501303_002153 Ga0501303_002153_119_1117 316
56 3300049686 Ga0501257_021486 Ga0501257_021486_192_1190 316
57 3300005327 Ga0070658_10025112 Ga0070658_100251122 317
58 3300005329 Ga0070683_100026669 Ga0070683_1000266693 317
59 3300005344 Ga0070661_100062601 Ga0070661_1000626011 317
60 3300005535 Ga0070684_100011605 Ga0070684_1000116052 317
61 3300005539 Ga0068853_100256398 Ga0068853_1002563982 317
62 3300005547 Ga0070693_100017897 Ga0070693_1000178973 317
63 3300005548 Ga0070665_100011217 Ga0070665_1000112174 317
64 3300005577 Ga0068857_100145308 Ga0068857_1001453082 317
65 3300009174 Ga0105241_10083373 Ga0105241_100833732 317
66 3300009177 Ga0105248_10337097 Ga0105248_103370972 317
67 3300013100 Ga0157373_10007987 Ga0157373_100079873 317
68 3300013104 Ga0157370_10004758 Ga0157370_100047585 317
69 3300013105 Ga0157369_10021810 Ga0157369_100218103 317
70 3300013296 Ga0157374_10051039 Ga0157374_100510392 317
71 3300013297 Ga0157378_10094159 Ga0157378_100941593 317
72 3300013307 Ga0157372_10116622 Ga0157372_101166222 317
73 3300026116 Ga0207674_10152689 Ga0207674_101526893 317
74 3300028379 Ga0268266_10013898 Ga0268266_100138982 317
75 3300041406 Ga0439439_0001203 Ga0439439_0001203_626_1579 317
76 3300041999 Ga0439433_0021321 Ga0439433_0021321_477_1430 317
77 3300042006 Ga0439432_063073 Ga0439432_063073_37_990 317
78 3300042123 Ga0450921_003496 Ga0450921_003496_110_1063 317
79 3300042439 Ga0439464_0011345 Ga0439464_0011345_98_1051 317
80 3300046615 Ga0495656_0000106 Ga0495656_0000106_22090_23043 317
81 3300046680 Ga0495646_0098379 Ga0495646_0098379_46_999 317
82 3300048913 Ga0496110_0555823 Ga0496110_0555823_42_995 317
83 3300049571 Ga0501034_0044857 Ga0501034_0044857_806_1759 317
84 3300053088 Ga0500644_0017691 Ga0500644_0017691_889_1902 317
85 3300053156 Ga0500622_0006815 Ga0500622_0006815_3722_4735 317
86 3300005341 Ga0070691_10020416 Ga0070691_100204164 318
87 3300005437 Ga0070710_10251981 Ga0070710_102519811 318
88 3300005444 Ga0070694_100132862 Ga0070694_1001328622 318
89 3300005458 Ga0070681_10000175 Ga0070681_1000017527 318
90 3300005471 Ga0070698_100270777 Ga0070698_1002707772 318
91 3300005530 Ga0070679_100050863 Ga0070679_1000508634 318
92 3300005544 Ga0070686_100083439 Ga0070686_1000834392 318
93 3300005546 Ga0070696_100061847 Ga0070696_1000618472 318
94 3300005546 Ga0070696_100160656 Ga0070696_1001606562 318
95 3300025912 Ga0207707_10000660 Ga0207707_100006608 318
96 3300025921 Ga0207652_10060917 Ga0207652_100609172 318
97 3300031251 Ga0265327_10000806 Ga0265327_100008063 318
98 3300032002 Ga0307416_100055750 Ga0307416_1000557504 318
99 3300032002 Ga0307416_100073436 Ga0307416_1000734364 318
100 3300034817 Ga0373948_0022584 Ga0373948_0022584_47_1003 318
101 3300035121 Ga0373960_0035775 Ga0373960_0035775_206_1162 318
102 3300044683 Ga0466965_0006009 Ga0466965_0006009_3317_4321 318
103 3300048928 Ga0496125_0004247 Ga0496125_0004247_9784_10839 318
104 3300049583 Ga0501067_0063540 Ga0501067_0063540_737_1693 318
105 3300050509 nmdc:mga0qj67_38522_c1 nmdc:mga0qj67_38522_c1_552_1508 318
106 3300050510 nmdc:mga06r32_296677_c1 nmdc:mga06r32_296677_c1_27_983 318
107 3300053118 Ga0500594_0013231 Ga0500594_0013231_867_1883 318
108 3300046542 Ga0495597_0039461 Ga0495597_0039461_228_1214 319
109 3300046542 Ga0495597_0044840 Ga0495597_0044840_357_1316 319
110 3300047443 Ga0495687_000685 Ga0495687_000685_30627_31613 319
111 3300031507 Ga0307509_10025821 Ga0307509_100258213 321
112 3300005438 Ga0070701_10168430 Ga0070701_101684302 322
113 3300005459 Ga0068867_100178470 Ga0068867_1001784702 322
114 3300005539 Ga0068853_100206188 Ga0068853_1002061882 322
115 3300005543 Ga0070672_100251445 Ga0070672_1002514452 322
116 3300005547 Ga0070693_100175929 Ga0070693_1001759291 322
117 3300005617 Ga0068859_100119353 Ga0068859_1001193532 322
118 3300005842 Ga0068858_100026462 Ga0068858_1000264622 322
119 3300005843 Ga0068860_100007838 Ga0068860_1000078382 322
120 3300006931 Ga0097620_100119344 Ga0097620_1001193442 322
121 3300013308 Ga0157375_10251976 Ga0157375_102519762 322
122 3300014326 Ga0157380_10068813 Ga0157380_100688132 322
123 3300014968 Ga0157379_10069093 Ga0157379_100690932 322
124 3300028381 Ga0268264_10045871 Ga0268264_100458713 322
125 3300046660 Ga0495625_0078708 Ga0495625_0078708_257_1234 322
126 3300006186 Ga0075369_10025866 Ga0075369_100258662 323
127 3300006195 Ga0075366_10020508 Ga0075366_100205084 323
128 3300006353 Ga0075370_10007645 Ga0075370_100076452 323
129 3300031616 Ga0307508_10126918 Ga0307508_101269182 323
130 3300050489 nmdc:mga03683_48280_c1 nmdc:mga03683_48280_c1_316_1287 323
131 3300050495 nmdc:mga04h51_5261_c1 nmdc:mga04h51_5261_c1_2060_3031 323
132 3300005471 Ga0070698_100058761 Ga0070698_1000587612 324
133 3300006358 Ga0068871_100478267 Ga0068871_1004782671 324
134 3300006844 Ga0075428_100018493 Ga0075428_1000184932 324
135 3300006847 Ga0075431_100000645 Ga0075431_10000064525 324
136 3300006880 Ga0075429_100000476 Ga0075429_10000047621 324
137 3300009094 Ga0111539_10498442 Ga0111539_104984422 324
138 3300009147 Ga0114129_10002793 Ga0114129_100027932 324
139 3300009148 Ga0105243_10386886 Ga0105243_103868862 324
140 3300025304 Ga0209257_1037010 Ga0209257_10370102 324
141 3300036401 Ga0373937_0367515 Ga0373937_0367515_271_1254 324
142 3300050508 nmdc:mga09592_59_c1 nmdc:mga09592_59_c1_50824_51807 324
143 3300050510 nmdc:mga06r32_77902_c1 nmdc:mga06r32_77902_c1_704_1687 324
144 iso_pu_bacteria 2895511927 2895516557 324
145 3300031548 Ga0307408_100205828 Ga0307408_1002058282 325
146 3300049574 Ga0501038_0032296 Ga0501038_0032296_1370_2347 325
147 3300049575 Ga0501039_0034867 Ga0501039_0034867_1313_2290 325
148 3300049576 Ga0501040_0003761 Ga0501040_0003761_1030_2007 325
149 3300049577 Ga0501041_0001759 Ga0501041_0001759_2811_3788 325
150 3300049578 Ga0501042_0037523 Ga0501042_0037523_1903_2880 325
151 3300049580 Ga0501046_0019371 Ga0501046_0019371_1972_2949 325
152 3300049587 Ga0501071_0031190 Ga0501071_0031190_2195_3172 325
153 3300049588 Ga0501072_0005126 Ga0501072_0005126_1917_2894 325
154 3300049591 Ga0501075_0061859 Ga0501075_0061859_275_1252 325
155 3300049592 Ga0501076_0001519 Ga0501076_0001519_9618_10595 325
156 3300049593 Ga0501077_0089535 Ga0501077_0089535_546_1523 325
157 3300049593 Ga0501077_0189384 Ga0501077_0189384_220_1197 325
158 3300049741 Ga0501079_0005639 Ga0501079_0005639_399_1376 325
159 3300049742 Ga0501080_0023073 Ga0501080_0023073_2146_3123 325
160 3300049743 Ga0501081_0006217 Ga0501081_0006217_2818_3795 325
161 3300049822 Ga0501035_0006648 Ga0501035_0006648_9098_10081 325
162 3300049822 Ga0501035_0009909 Ga0501035_0009909_1856_2839 325
163 3300049823 Ga0501044_0000185 Ga0501044_0000185_43440_44423 325
164 3300049824 Ga0501045_0020888 Ga0501045_0020888_3100_4077 325
165 3300054114 Ga0501084_0047654 Ga0501084_0047654_1603_2580 325
166 3300060353 Ga0501082_0009902 Ga0501082_0009902_6964_7941 325
167 3300061734 Ga0530510_0000606 Ga0530510_0000606_18208_19185 325
168 3300003763 Ga0055529_1001127 Ga0055529_10011277 326
169 3300005290 Ga0065712_10182771 Ga0065712_101827711 326
170 3300005331 Ga0070670_100005546 Ga0070670_1000055468 326
171 3300005333 Ga0070677_10003382 Ga0070677_100033824 326
172 3300005338 Ga0068868_100043119 Ga0068868_1000431192 326
173 3300005354 Ga0070675_100000635 Ga0070675_10000063515 326
174 3300005355 Ga0070671_100002597 Ga0070671_1000025974 326
175 3300005356 Ga0070674_100026543 Ga0070674_1000265433 326
176 3300005364 Ga0070673_100013219 Ga0070673_1000132192 326
177 3300005367 Ga0070667_100080705 Ga0070667_1000807053 326
178 3300005459 Ga0068867_100000428 Ga0068867_10000042810 326
179 3300005543 Ga0070672_100000188 Ga0070672_10000018817 326
180 3300005564 Ga0070664_100063811 Ga0070664_1000638113 326
181 3300005618 Ga0068864_100016644 Ga0068864_1000166444 326
182 3300005719 Ga0068861_100173692 Ga0068861_1001736922 326
183 3300005840 Ga0068870_10022385 Ga0068870_100223853 326
184 3300006237 Ga0097621_100014096 Ga0097621_1000140964 326
185 3300006358 Ga0068871_100051422 Ga0068871_1000514223 326
186 3300017792 Ga0163161_10018527 Ga0163161_100185274 326
187 3300025228 Ga0209672_104501 Ga0209672_1045012 326
188 3300025272 Ga0209455_1000534 Ga0209455_100053419 326
189 3300025315 Ga0207697_10040075 Ga0207697_100400752 326
190 3300025908 Ga0207643_10068410 Ga0207643_100684102 326
191 3300025923 Ga0207681_10013857 Ga0207681_100138572 326
192 3300025925 Ga0207650_10000748 Ga0207650_100007483 326
193 3300025926 Ga0207659_10046168 Ga0207659_100461682 326
194 3300025931 Ga0207644_10022994 Ga0207644_100229942 326
195 3300025937 Ga0207669_10012504 Ga0207669_100125044 326
196 3300025940 Ga0207691_10001187 Ga0207691_100011876 326
197 3300025945 Ga0207679_10043476 Ga0207679_100434762 326
198 3300025960 Ga0207651_10007651 Ga0207651_100076514 326
199 3300025986 Ga0207658_10043181 Ga0207658_100431812 326
200 3300026023 Ga0207677_10009993 Ga0207677_100099933 326
201 3300026089 Ga0207648_10001166 Ga0207648_1000116620 326
202 3300026095 Ga0207676_10045713 Ga0207676_100457132 326
203 3300026118 Ga0207675_100127126 Ga0207675_1001271262 326
204 3300026121 Ga0207683_10004545 Ga0207683_100045452 326
205 iso_pu_bacteria 2904449895 2904450432 326
206 iso_pu_bacteria 2904456579 2904456745 326
207 3300028794 Ga0307515_10000424 Ga0307515_1000042474 327
208 3300028794 Ga0307515_10310832 Ga0307515_103108321 327
209 3300031456 Ga0307513_10069162 Ga0307513_100691624 327
210 3300033180 Ga0307510_10161888 Ga0307510_101618882 327
211 3300035398 Ga0316574_0010549 Ga0316574_0010549_22_1005 327
212 iso_pu_bacteria 2904541872 2904544393 327
213 iso_pu_bacteria 2929160207 2929162036 327
214 3300005331 Ga0070670_100092173 Ga0070670_1000921731 328
215 3300005335 Ga0070666_10278498 Ga0070666_102784982 328
216 3300005338 Ga0068868_100126454 Ga0068868_1001264542 328
217 3300005347 Ga0070668_100256562 Ga0070668_1002565622 328
218 3300005355 Ga0070671_100022133 Ga0070671_1000221335 328
219 3300005441 Ga0070700_100090546 Ga0070700_1000905462 328
220 3300005445 Ga0070708_100296071 Ga0070708_1002960712 328
221 3300005455 Ga0070663_100064345 Ga0070663_1000643453 328
222 3300005456 Ga0070678_100347254 Ga0070678_1003472542 328
223 3300005457 Ga0070662_100094013 Ga0070662_1000940132 328
224 3300005457 Ga0070662_100397587 Ga0070662_1003975871 328
225 3300005459 Ga0068867_100003674 Ga0068867_10000367410 328
226 3300005459 Ga0068867_100408142 Ga0068867_1004081421 328
227 3300005467 Ga0070706_100001519 Ga0070706_10000151911 328
228 3300005471 Ga0070698_100076768 Ga0070698_1000767684 328
229 3300005535 Ga0070684_100039922 Ga0070684_1000399222 328
230 3300005539 Ga0068853_100503382 Ga0068853_1005033821 328
231 3300005577 Ga0068857_100245987 Ga0068857_1002459872 328
232 3300005614 Ga0068856_100083507 Ga0068856_1000835073 328
233 3300005617 Ga0068859_100038576 Ga0068859_1000385764 328
234 3300005719 Ga0068861_100003931 Ga0068861_1000039316 328
235 3300005834 Ga0068851_10054130 Ga0068851_100541302 328
236 3300005842 Ga0068858_100013451 Ga0068858_1000134512 328
237 3300005843 Ga0068860_100003712 Ga0068860_10000371211 328
238 3300005844 Ga0068862_100009256 Ga0068862_1000092564 328
239 3300005844 Ga0068862_100010258 Ga0068862_1000102583 328
240 3300006038 Ga0075365_10307452 Ga0075365_103074521 328
241 3300006048 Ga0075363_100039517 Ga0075363_1000395172 328
242 3300006177 Ga0075362_10042693 Ga0075362_100426932 328
243 3300006178 Ga0075367_10009261 Ga0075367_100092614 328
244 3300006195 Ga0075366_10004246 Ga0075366_100042462 328
245 3300006195 Ga0075366_10010842 Ga0075366_100108424 328
246 3300006195 Ga0075366_10025548 Ga0075366_100255482 328
247 3300006353 Ga0075370_10016681 Ga0075370_100166813 328
248 3300006353 Ga0075370_10047720 Ga0075370_100477202 328
249 3300006881 Ga0068865_100000919 Ga0068865_1000009197 328
250 3300006931 Ga0097620_100038576 Ga0097620_1000385764 328
251 3300009093 Ga0105240_10077802 Ga0105240_100778024 328
252 3300009093 Ga0105240_10144453 Ga0105240_101444533 328
253 3300009098 Ga0105245_10109324 Ga0105245_101093242 328
254 3300009148 Ga0105243_10086372 Ga0105243_100863722 328
255 3300013105 Ga0157369_10020698 Ga0157369_100206982 328
256 3300013105 Ga0157369_10085647 Ga0157369_100856471 328
257 3300013307 Ga0157372_10009605 Ga0157372_100096058 328
258 3300025321 Ga0207656_10055860 Ga0207656_100558602 328
259 3300025907 Ga0207645_10068841 Ga0207645_100688413 328
260 3300025907 Ga0207645_10098456 Ga0207645_100984562 328
261 3300025910 Ga0207684_10006075 Ga0207684_100060754 328
262 3300025914 Ga0207671_10014895 Ga0207671_100148955 328
263 3300025926 Ga0207659_10371671 Ga0207659_103716711 328
264 3300025931 Ga0207644_10023506 Ga0207644_100235064 328
265 3300025938 Ga0207704_10009150 Ga0207704_100091503 328
266 3300025940 Ga0207691_10092780 Ga0207691_100927804 328
267 3300025942 Ga0207689_10154801 Ga0207689_101548012 328
268 3300025944 Ga0207661_10139377 Ga0207661_101393771 328
269 3300026023 Ga0207677_10100834 Ga0207677_101008342 328
270 3300026035 Ga0207703_10091068 Ga0207703_100910682 328
271 3300026041 Ga0207639_10093316 Ga0207639_100933162 328
272 3300026067 Ga0207678_10064746 Ga0207678_100647463 328
273 3300026075 Ga0207708_10018408 Ga0207708_100184082 328
274 3300026089 Ga0207648_10001269 Ga0207648_1000126921 328
275 3300026089 Ga0207648_10040126 Ga0207648_100401262 328
276 3300026116 Ga0207674_10025299 Ga0207674_100252994 328
277 3300026118 Ga0207675_100000838 Ga0207675_10000083826 328
278 3300028380 Ga0268265_10005821 Ga0268265_100058218 328
279 3300028380 Ga0268265_10070045 Ga0268265_100700453 328
280 3300028381 Ga0268264_10014746 Ga0268264_100147462 328
281 3300031730 Ga0307516_10166543 Ga0307516_101665431 328
282 3300032005 Ga0307411_10039636 Ga0307411_100396362 328
283 3300035695 Ga0373927_0047357 Ga0373927_0047357_712_1698 328
284 3300037068 Ga0373925_0003526 Ga0373925_0003526_729_1715 328
285 3300037312 Ga0395899_0062951 Ga0395899_0062951_1345_2334 328
286 3300037418 Ga0395900_0095943 Ga0395900_0095943_48_1037 328
287 3300037466 Ga0395898_0059152 Ga0395898_0059152_736_1725 328
288 3300044658 Ga0466972_0054738 Ga0466972_0054738_669_1655 328
289 3300044842 Ga0466957_0052609 Ga0466957_0052609_659_1645 328
290 3300046517 Ga0495630_0093704 Ga0495630_0093704_393_1379 328
291 3300046519 Ga0495632_0023965 Ga0495632_0023965_1889_2875 328
292 3300046694 Ga0495649_0017929 Ga0495649_0017929_1567_2553 328
293 3300046810 Ga0495660_0067142 Ga0495660_0067142_87_1073 328
294 3300047443 Ga0495687_006026 Ga0495687_006026_1277_2263 328
295 3300047443 Ga0495687_010622 Ga0495687_010622_2774_3760 328
296 3300048091 Ga0495626_0123573 Ga0495626_0123573_27_1013 328
297 3300049577 Ga0501041_0161340 Ga0501041_0161340_111_1112 328
298 3300049587 Ga0501071_0001483 Ga0501071_0001483_5953_6954 328
299 3300049588 Ga0501072_0054663 Ga0501072_0054663_919_1920 328
300 3300049743 Ga0501081_0068580 Ga0501081_0068580_295_1296 328
301 3300050493 nmdc:mga0k408_10224_c1 nmdc:mga0k408_10224_c1_915_1901 328
302 3300050493 nmdc:mga0k408_112905_c1 nmdc:mga0k408_112905_c1_493_1479 328
303 3300050494 nmdc:mga06z11_68112_c1 nmdc:mga06z11_68112_c1_152_1138 328
304 3300050494 nmdc:mga06z11_7262_c1 nmdc:mga06z11_7262_c1_1122_2108 328
305 3300050496 nmdc:mga07m45_12052_c1 nmdc:mga07m45_12052_c1_216_1202 328
306 3300050496 nmdc:mga07m45_24438_c1 nmdc:mga07m45_24438_c1_1291_2277 328
307 3300050496 nmdc:mga07m45_7379_c1 nmdc:mga07m45_7379_c1_4323_5309 328
308 3300053730 Ga0500645_051805 Ga0500645_051805_162_1148 328
309 3300005354 Ga0070675_100090507 Ga0070675_1000905073 329
310 3300005456 Ga0070678_100047822 Ga0070678_1000478223 329
311 3300005543 Ga0070672_100035212 Ga0070672_1000352123 329
312 3300005617 Ga0068859_100156473 Ga0068859_1001564732 329
313 3300005618 Ga0068864_100048182 Ga0068864_1000481823 329
314 3300006195 Ga0075366_10012754 Ga0075366_100127542 329
315 3300006931 Ga0097620_100156475 Ga0097620_1001564752 329
316 3300014968 Ga0157379_10084937 Ga0157379_100849373 329
317 3300025909 Ga0207705_10012949 Ga0207705_100129495 329
318 3300025925 Ga0207650_10056300 Ga0207650_100563003 329
319 3300025926 Ga0207659_10037765 Ga0207659_100377653 329
320 3300026095 Ga0207676_10007264 Ga0207676_100072644 329
321 3300028786 Ga0307517_10000196 Ga0307517_1000019658 329
322 3300032002 Ga0307416_100419473 Ga0307416_1004194732 329
323 3300042876 Ga0451577_0018204 Ga0451577_0018204_4666_5658 329
324 3300049579 Ga0501043_0000052 Ga0501043_0000052_43997_44989 329
325 3300049580 Ga0501046_0002696 Ga0501046_0002696_1762_2754 329
326 3300049581 Ga0501047_0000039 Ga0501047_0000039_7831_8823 329
327 3300049582 Ga0501048_0005001 Ga0501048_0005001_1559_2551 329
328 3300049824 Ga0501045_0017400 Ga0501045_0017400_2406_3398 329
329 3300050493 nmdc:mga0k408_60457_c1 nmdc:mga0k408_60457_c1_1002_1991 329
330 3300003792 Ga0055540_1009576 Ga0055540_10095764 330
331 3300003794 Ga0055531_10000265 Ga0055531_1000026548 330
332 3300009553 Ga0105249_10035064 Ga0105249_100350645 330
333 3300009553 Ga0105249_10134229 Ga0105249_101342292 330
334 3300013297 Ga0157378_10005326 Ga0157378_1000532610 330
335 3300025303 Ga0209051_1000252 Ga0209051_100025216 330
336 3300025304 Ga0209257_1000012 Ga0209257_100001284 330
337 3300028794 Ga0307515_10000014 Ga0307515_10000014485 330
338 3300037312 Ga0395899_0002692 Ga0395899_0002692_2123_3115 330
339 3300037418 Ga0395900_0010858 Ga0395900_0010858_7937_8929 330
340 3300037466 Ga0395898_0028661 Ga0395898_0028661_1901_2893 330
341 3300037471 Ga0395905_0107359 Ga0395905_0107359_239_1231 330
342 3300038443 Ga0395901_0013558 Ga0395901_0013558_1705_2697 330
343 3300044684 Ga0466966_0029976 Ga0466966_0029976_2481_3473 330
344 3300045049 Ga0466959_0273361 Ga0466959_0273361_28_1020 330
345 3300053122 Ga0500608_030956 Ga0500608_030956_986_1978 330
346 iso_pu_bacteria 2513020051 2513228214 330
347 iso_pu_bacteria 2643221628 2644160519 330
348 iso_pu_bacteria 2643221658 2644324659 330
349 iso_pu_bacteria 2643221672 2644396523 330
350 iso_pu_bacteria 2643221683 2644464437 330
351 iso_pu_bacteria 2738541307 2738881035 330
352 iso_pu_bacteria 2885192300 2885193703 330
353 iso_pu_bacteria 2885198086 2885200588 330
354 iso_pu_bacteria 2885211737 2885214629 330
355 iso_pu_bacteria 2928084124 2928089345 330
356 iso_pu_bacteria 2945909444 2945913557 330
357 iso_pu_bacteria 2945984333 2945991048 330
358 iso_pu_bacteria 2954767861 2954768525 330
359 3300044683 Ga0466965_0093831 Ga0466965_0093831_286_1308 331
360 3300046462 Ga0495651_0026102 Ga0495651_0026102_1022_2020 331
361 3300049570 Ga0501033_0010954 Ga0501033_0010954_5593_6597 331
362 3300049572 Ga0501036_0013718 Ga0501036_0013718_5221_6225 331
363 3300049574 Ga0501038_0004011 Ga0501038_0004011_2075_3079 331
364 3300049575 Ga0501039_0057504 Ga0501039_0057504_669_1673 331
365 3300049576 Ga0501040_0000158 Ga0501040_0000158_16313_17317 331
366 3300049577 Ga0501041_0000402 Ga0501041_0000402_16225_17229 331
367 3300049578 Ga0501042_0006708 Ga0501042_0006708_5643_6647 331
368 3300049579 Ga0501043_0011563 Ga0501043_0011563_93_1097 331
369 3300049580 Ga0501046_0000423 Ga0501046_0000423_12571_13575 331
370 3300049582 Ga0501048_0006812 Ga0501048_0006812_2201_3205 331
371 3300049586 Ga0501070_0131858 Ga0501070_0131858_968_1972 331
372 3300049587 Ga0501071_0231713 Ga0501071_0231713_130_1134 331
373 3300049588 Ga0501072_0001081 Ga0501072_0001081_17235_18239 331
374 3300049589 Ga0501073_0270013 Ga0501073_0270013_57_1061 331
375 3300049590 Ga0501074_0006814 Ga0501074_0006814_449_1453 331
376 3300049591 Ga0501075_0000114 Ga0501075_0000114_21128_22132 331
377 3300049592 Ga0501076_0000382 Ga0501076_0000382_5819_6823 331
378 3300049593 Ga0501077_0000229 Ga0501077_0000229_5183_6187 331
379 3300049741 Ga0501079_0000666 Ga0501079_0000666_4673_5677 331
380 3300049742 Ga0501080_0019726 Ga0501080_0019726_5066_6070 331
381 3300049743 Ga0501081_0000108 Ga0501081_0000108_5255_6259 331
382 3300049824 Ga0501045_0011185 Ga0501045_0011185_4912_5916 331
383 3300054114 Ga0501084_0006785 Ga0501084_0006785_2614_3618 331
384 3300060353 Ga0501082_0013762 Ga0501082_0013762_2296_3300 331
385 3300061734 Ga0530510_0002478 Ga0530510_0002478_6300_7304 331
386 iso_pu_bacteria 2599185214 2599626927 331
387 iso_pu_bacteria 2599185226 2599676173 331
388 iso_pu_bacteria 2599185227 2599684485 331
389 iso_pu_bacteria 2599185229 2599696478 331
390 iso_pu_bacteria 2818991446 2819599454 331
391 iso_pu_bacteria 2831265667 2831271275 331
392 iso_pu_bacteria 2838054893 2838055864 331
393 iso_pu_bacteria 2842677519 2842681986 331
394 iso_pu_bacteria 2899924645 2899925805 331
395 iso_pu_bacteria 2919462493 2919463039 331
396 iso_pu_bacteria 2928037797 2928041807 331
397 iso_pu_bacteria 2928044640 2928049371 331
398 iso_pu_bacteria 2928051484 2928051954 331
399 iso_pu_bacteria 2928064002 2928065354 331
400 iso_pu_bacteria 2928070936 2928076546 331
401 iso_pu_bacteria 2929520902 2929521145 331
402 iso_pu_bacteria 2945972063 2945973212 331
403 3300003784 Ga0055534_1005003 Ga0055534_10050032 332
404 3300005331 Ga0070670_100027243 Ga0070670_1000272435 332
405 3300005539 Ga0068853_100089057 Ga0068853_1000890571 332
406 3300005841 Ga0068863_100246047 Ga0068863_1002460472 332
407 3300006237 Ga0097621_100029031 Ga0097621_1000290313 332
408 3300013308 Ga0157375_10049857 Ga0157375_100498573 332
409 3300014969 Ga0157376_10035508 Ga0157376_100355082 332
410 3300015265 Ga0182005_1021497 Ga0182005_10214972 332
411 3300025284 Ga0209130_1002376 Ga0209130_10023764 332
412 3300025291 Ga0209675_1003630 Ga0209675_10036304 332
413 3300025292 Ga0209676_1018846 Ga0209676_10188462 332
414 3300026121 Ga0207683_10026834 Ga0207683_100268344 332
415 3300026121 Ga0207683_10038469 Ga0207683_100384695 332
416 3300035171 Ga0373946_0115287 Ga0373946_0115287_61_1062 332
417 3300037471 Ga0395905_0167594 Ga0395905_0167594_860_1876 332
418 3300038443 Ga0395901_0419762 Ga0395901_0419762_138_1154 332
419 3300048905 Ga0496102_0159067 Ga0496102_0159067_598_1596 332
420 iso_pu_bacteria 2738541277 2738718977 332
421 iso_pu_bacteria 2738543013 2739249335 332
422 iso_pu_bacteria 2738543019 2739281739 332
423 iso_pu_bacteria 2842747753 2842750837 332
424 3300003187 JGI25151J46595_10000884 JGI25151J46595_1000088415 333
425 3300003187 JGI25151J46595_10001131 JGI25151J46595_1000113116 333
426 3300005327 Ga0070658_10074970 Ga0070658_100749703 333
427 3300005844 Ga0068862_100026748 Ga0068862_1000267482 333
428 3300006048 Ga0075363_100004888 Ga0075363_1000048883 333
429 3300006048 Ga0075363_100033782 Ga0075363_1000337822 333
430 3300006051 Ga0075364_10002462 Ga0075364_100024624 333
431 3300006178 Ga0075367_10021564 Ga0075367_100215643 333
432 3300006195 Ga0075366_10017232 Ga0075366_100172323 333
433 3300006195 Ga0075366_10022934 Ga0075366_100229343 333
434 3300006195 Ga0075366_10071144 Ga0075366_100711442 333
435 3300006353 Ga0075370_10045153 Ga0075370_100451533 333
436 3300009148 Ga0105243_10024964 Ga0105243_100249642 333
437 3300015683 Ga0183362_10001 Ga0183362_10001159 333
438 3300025258 Ga0209129_1000415 Ga0209129_100041533 333
439 3300025294 Ga0209025_1000129 Ga0209025_1000129141 333
440 3300025909 Ga0207705_10105784 Ga0207705_101057842 333
441 3300025935 Ga0207709_10009694 Ga0207709_100096942 333
442 3300026089 Ga0207648_10399206 Ga0207648_103992061 333
443 3300027866 Ga0209813_10054337 Ga0209813_100543372 333
444 3300027907 Ga0207428_10137288 Ga0207428_101372882 333
445 3300031731 Ga0307405_10007635 Ga0307405_100076352 333
446 3300031901 Ga0307406_10334179 Ga0307406_103341792 333
447 3300031911 Ga0307412_10054656 Ga0307412_100546562 333
448 3300032126 Ga0307415_100142940 Ga0307415_1001429402 333
449 3300046515 Ga0495620_0053995 Ga0495620_0053995_90_1091 333
450 3300046520 Ga0495637_0003001 Ga0495637_0003001_1088_2089 333
451 3300046616 Ga0495668_0099156 Ga0495668_0099156_575_1576 333
452 3300048088 Ga0495602_0224877 Ga0495602_0224877_17_1021 333
453 3300050491 nmdc:mga00v17_13154_c1 nmdc:mga00v17_13154_c1_443_1444 333
454 3300050492 nmdc:mga0yw44_10570_c1 nmdc:mga0yw44_10570_c1_1821_2822 333
455 3300050493 nmdc:mga0k408_98948_c1 nmdc:mga0k408_98948_c1_29_1030 333
456 3300050495 nmdc:mga04h51_63068_c1 nmdc:mga04h51_63068_c1_117_1118 333
457 3300050496 nmdc:mga07m45_2773_c1 nmdc:mga07m45_2773_c1_872_1873 333
458 3300053079 Ga0500610_0002813 Ga0500610_0002813_3308_4309 333
459 3300053079 Ga0500610_0004548 Ga0500610_0004548_2176_3177 333
460 3300053079 Ga0500610_0013844 Ga0500610_0013844_2324_3325 333
461 3300053117 Ga0500593_002457 Ga0500593_002457_3773_4774 333
462 3300053121 Ga0500607_001013 Ga0500607_001013_23138_24139 333
463 3300053158 Ga0500627_0000353 Ga0500627_0000353_10195_11196 333
464 3300053161 Ga0500634_0026423 Ga0500634_0026423_592_1593 333
465 3300003773 Ga0055537_1000011 Ga0055537_1000011122 334
466 3300003781 Ga0055536_1001862 Ga0055536_10018621 334
467 3300003784 Ga0055534_1000020 Ga0055534_100002014 334
468 3300003791 Ga0055530_10021165 Ga0055530_100211652 334
469 3300003792 Ga0055540_1001207 Ga0055540_100120712 334
470 3300003792 Ga0055540_1003435 Ga0055540_10034355 334
471 3300003794 Ga0055531_10008108 Ga0055531_100081085 334
472 3300005331 Ga0070670_100067111 Ga0070670_1000671114 334
473 3300005344 Ga0070661_100029916 Ga0070661_1000299162 334
474 3300005457 Ga0070662_100025092 Ga0070662_1000250922 334
475 3300005459 Ga0068867_100074154 Ga0068867_1000741543 334
476 3300005530 Ga0070679_100035754 Ga0070679_1000357542 334
477 3300005577 Ga0068857_100040500 Ga0068857_1000405003 334
478 3300006048 Ga0075363_100005543 Ga0075363_1000055433 334
479 3300006948 Ga0099826_10000432 Ga0099826_100004325 334
480 3300009036 Ga0105244_10001781 Ga0105244_1000178112 334
481 3300009036 Ga0105244_10061924 Ga0105244_100619241 334
482 3300009148 Ga0105243_10002000 Ga0105243_1000200015 334
483 3300009148 Ga0105243_10005462 Ga0105243_100054629 334
484 3300010375 Ga0105239_10033940 Ga0105239_100339405 334
485 3300011119 Ga0105246_10142335 Ga0105246_101423352 334
486 3300013105 Ga0157369_10055285 Ga0157369_100552855 334
487 3300013308 Ga0157375_10067681 Ga0157375_100676812 334
488 3300014497 Ga0182008_10002890 Ga0182008_100028908 334
489 3300015261 Ga0182006_1005774 Ga0182006_10057743 334
490 3300015262 Ga0182007_10000298 Ga0182007_100002986 334
491 3300015265 Ga0182005_1025023 Ga0182005_10250232 334
492 3300017792 Ga0163161_10000042 Ga0163161_1000004211 334
493 3300017792 Ga0163161_10088969 Ga0163161_100889693 334
494 3300025263 Ga0209565_1000058 Ga0209565_100005852 334
495 3300025273 Ga0209673_1000053 Ga0209673_1000053128 334
496 3300025291 Ga0209675_1000010 Ga0209675_1000010409 334
497 3300025291 Ga0209675_1001994 Ga0209675_10019942 334
498 3300025292 Ga0209676_1000653 Ga0209676_100065312 334
499 3300025292 Ga0209676_1001003 Ga0209676_100100320 334
500 3300025294 Ga0209025_1015590 Ga0209025_10155903 334
501 3300025298 Ga0209050_1001558 Ga0209050_100155812 334
502 3300025298 Ga0209050_1006217 Ga0209050_10062173 334
503 3300025303 Ga0209051_1000145 Ga0209051_100014523 334
504 3300025303 Ga0209051_1000501 Ga0209051_100050112 334
505 3300025304 Ga0209257_1001684 Ga0209257_100168424 334
506 3300025728 Ga0207655_1001616 Ga0207655_100161613 334
507 3300025907 Ga0207645_10004557 Ga0207645_100045574 334
508 3300025920 Ga0207649_10007994 Ga0207649_100079945 334
509 3300025932 Ga0207690_10006705 Ga0207690_100067056 334
510 3300025933 Ga0207706_10020413 Ga0207706_100204135 334
511 3300025935 Ga0207709_10000375 Ga0207709_1000037542 334
512 3300026116 Ga0207674_10071507 Ga0207674_100715073 334
513 3300027666 Ga0209282_1001250 Ga0209282_10012509 334
514 3300028794 Ga0307515_10002595 Ga0307515_1000259539 334
515 3300030742 Ga0316183_1120317 Ga0316183_11203172 334
516 3300031731 Ga0307405_10006212 Ga0307405_100062124 334
517 3300031731 Ga0307405_10159118 Ga0307405_101591182 334
518 3300031731 Ga0307405_10318018 Ga0307405_103180181 334
519 3300031852 Ga0307410_10359624 Ga0307410_103596241 334
520 3300031911 Ga0307412_10032318 Ga0307412_100323182 334
521 3300031911 Ga0307412_10091615 Ga0307412_100916152 334
522 3300031995 Ga0307409_100118691 Ga0307409_1001186913 334
523 3300032002 Ga0307416_100053538 Ga0307416_1000535384 334
524 3300041404 Ga0439436_0000074 Ga0439436_0000074_12622_13626 334
525 3300041404 Ga0439436_0017877 Ga0439436_0017877_1062_2066 334
526 3300041406 Ga0439439_0002957 Ga0439439_0002957_2145_3149 334
527 3300041411 Ga0439466_0013978 Ga0439466_0013978_1554_2558 334
528 3300041411 Ga0439466_0042792 Ga0439466_0042792_105_1109 334
529 3300041413 Ga0439465_0003681 Ga0439465_0003681_2788_3792 334
530 3300041997 Ga0439431_0000361 Ga0439431_0000361_5464_6468 334
531 3300042004 Ga0439445_0001373 Ga0439445_0001373_3637_4641 334
532 3300042006 Ga0439432_001162 Ga0439432_001162_2364_3368 334
533 3300042007 Ga0439449_0002224 Ga0439449_0002224_3044_4048 334
534 3300042014 Ga0439457_011445 Ga0439457_011445_896_1900 334
535 3300042015 Ga0439462_0042206 Ga0439462_0042206_106_1110 334
536 3300042435 Ga0439434_0009992 Ga0439434_0009992_1019_2023 334
537 3300042531 Ga0450918_004653 Ga0450918_004653_731_1735 334
538 3300046460 Ga0495638_0029205 Ga0495638_0029205_2217_3221 334
539 3300046513 Ga0495616_0010064 Ga0495616_0010064_2492_3496 334
540 3300046518 Ga0495631_0000088 Ga0495631_0000088_3811_4815 334
541 3300046539 Ga0495621_0043897 Ga0495621_0043897_373_1377 334
542 3300046660 Ga0495625_0002306 Ga0495625_0002306_8022_9026 334
543 3300047321 Ga0495676_0002416 Ga0495676_0002416_4561_5565 334
544 3300047673 Ga0495593_0007745 Ga0495593_0007745_4027_5031 334
545 3300048089 Ga0495614_0001061 Ga0495614_0001061_830_1834 334
546 3300048905 Ga0496102_0062097 Ga0496102_0062097_1840_2844 334
547 3300048920 Ga0496117_0011528 Ga0496117_0011528_569_1573 334
548 3300048920 Ga0496117_0112727 Ga0496117_0112727_465_1469 334
549 3300048920 Ga0496117_0161533 Ga0496117_0161533_224_1228 334
550 3300048921 Ga0496118_0034068 Ga0496118_0034068_301_1305 334
551 3300048924 Ga0496121_0036930 Ga0496121_0036930_1328_2332 334
552 3300048924 Ga0496121_0135167 Ga0496121_0135167_780_1784 334
553 3300048925 Ga0496122_0125482 Ga0496122_0125482_479_1483 334
554 3300048926 Ga0496123_0016199 Ga0496123_0016199_1342_2346 334
555 3300048926 Ga0496123_0097867 Ga0496123_0097867_186_1190 334
556 3300048927 Ga0496124_0053577 Ga0496124_0053577_1675_2679 334
557 3300048927 Ga0496124_0088713 Ga0496124_0088713_875_1879 334
558 3300048928 Ga0496125_0028035 Ga0496125_0028035_1762_2766 334
559 3300048928 Ga0496125_0160881 Ga0496125_0160881_360_1364 334
560 3300048928 Ga0496125_0195810 Ga0496125_0195810_285_1289 334
561 3300050490 nmdc:mga03n38_10621_c1 nmdc:mga03n38_10621_c1_312_1316 334
562 3300050491 nmdc:mga00v17_230306_c1 nmdc:mga00v17_230306_c1_52_1056 334
563 3300050496 nmdc:mga07m45_3471_c1 nmdc:mga07m45_3471_c1_4305_5309 334
564 3300053087 Ga0500643_009215 Ga0500643_009215_151_1155 334
565 3300053093 Ga0500651_0000056 Ga0500651_0000056_13941_14945 334
566 3300053094 Ga0500566_0017204 Ga0500566_0017204_1334_2338 334
567 3300053110 Ga0500571_000344 Ga0500571_000344_15979_16983 334
568 3300053118 Ga0500594_0002730 Ga0500594_0002730_1143_2147 334
569 3300053122 Ga0500608_010021 Ga0500608_010021_2570_3574 334
570 3300053128 Ga0500626_022077 Ga0500626_022077_1772_2776 334
571 3300053133 Ga0500655_000657 Ga0500655_000657_4639_5643 334
572 3300053134 Ga0500658_0000487 Ga0500658_0000487_2620_3624 334
573 3300053134 Ga0500658_0000584 Ga0500658_0000584_13105_14109 334
574 3300053136 Ga0500559_0000134 Ga0500559_0000134_30694_31707 334
575 3300053136 Ga0500559_0006783 Ga0500559_0006783_2750_3754 334
576 3300053138 Ga0500564_006905 Ga0500564_006905_1396_2400 334
577 3300053162 Ga0500638_014624 Ga0500638_014624_1143_2147 334
578 3300053177 Ga0500636_0036388 Ga0500636_0036388_1789_2793 334
579 3300053735 Ga0500596_007015 Ga0500596_007015_796_1800 334
580 3300002773 JGI25152J39213_1003501 JGI25152J39213_10035013 335
581 3300002774 JGI25150J39212_1001724 JGI25150J39212_10017244 335
582 3300002987 JGI25159J45721_1005177 JGI25159J45721_10051772 335
583 3300003187 JGI25151J46595_10013620 JGI25151J46595_100136202 335
584 3300003215 JGI25153J46596_10007574 JGI25153J46596_100075743 335
585 3300003316 rootH1_10012321 rootH1_100123214 335
586 3300003322 rootL2_10055748 rootL2_100557483 335
587 3300003354 JGI25160J50197_1005251 JGI25160J50197_10052513 335
588 3300003354 JGI25160J50197_1006869 JGI25160J50197_10068693 335
589 3300003374 JGI25161J50226_1002022 JGI25161J50226_10020222 335
590 3300003374 JGI25161J50226_1003243 JGI25161J50226_10032434 335
591 3300003578 Ga0006562J51391_1101148 Ga0006562J51391_11011483 335
592 3300003762 Ga0055542_1000009 Ga0055542_100000962 335
593 3300003771 Ga0055526_1011021 Ga0055526_10110214 335
594 3300003771 Ga0055526_1016946 Ga0055526_10169462 335
595 3300003773 Ga0055537_1004264 Ga0055537_10042644 335
596 3300003775 Ga0055524_1007760 Ga0055524_10077605 335
597 3300003775 Ga0055524_1008910 Ga0055524_10089104 335
598 3300003781 Ga0055536_1010873 Ga0055536_10108732 335
599 3300003784 Ga0055534_1005481 Ga0055534_10054812 335
600 3300003784 Ga0055534_1007068 Ga0055534_10070682 335
601 3300003790 Ga0055528_1009260 Ga0055528_10092604 335
602 3300003791 Ga0055530_10001397 Ga0055530_100013977 335
603 3300003792 Ga0055540_1005079 Ga0055540_10050795 335
604 3300003792 Ga0055540_1008609 Ga0055540_10086092 335
605 3300003792 Ga0055540_1009163 Ga0055540_10091634 335
606 3300003794 Ga0055531_10005088 Ga0055531_100050887 335
607 3300003794 Ga0055531_10014627 Ga0055531_100146272 335
608 3300004625 Ga0055543_1002918 Ga0055543_10029183 335
609 3300004625 Ga0055543_1021689 Ga0055543_10216891 335
610 3300005262 Ga0065165_1007487 Ga0065165_10074873 335
611 3300005339 Ga0070660_100192020 Ga0070660_1001920201 335
612 3300005354 Ga0070675_100393866 Ga0070675_1003938661 335
613 3300005355 Ga0070671_100144940 Ga0070671_1001449402 335
614 3300005364 Ga0070673_100222581 Ga0070673_1002225812 335
615 3300005366 Ga0070659_100024749 Ga0070659_1000247494 335
616 3300005539 Ga0068853_100043050 Ga0068853_1000430501 335
617 3300005548 Ga0070665_100077624 Ga0070665_1000776244 335
618 3300005577 Ga0068857_100039725 Ga0068857_1000397252 335
619 3300005578 Ga0068854_100202421 Ga0068854_1002024211 335
620 3300005614 Ga0068856_100019589 Ga0068856_1000195893 335
621 3300005834 Ga0068851_10013256 Ga0068851_100132563 335
622 3300006177 Ga0075362_10019257 Ga0075362_100192572 335
623 3300006177 Ga0075362_10031834 Ga0075362_100318343 335
624 3300006195 Ga0075366_10076056 Ga0075366_100760562 335
625 3300013100 Ga0157373_10072148 Ga0157373_100721482 335
626 3300013102 Ga0157371_10057838 Ga0157371_100578383 335
627 3300013307 Ga0157372_10037609 Ga0157372_100376092 335
628 3300014497 Ga0182008_10054927 Ga0182008_100549272 335
629 3300014497 Ga0182008_10060742 Ga0182008_100607422 335
630 3300015261 Ga0182006_1043948 Ga0182006_10439482 335
631 3300025208 Ga0209436_107422 Ga0209436_1074223 335
632 3300025208 Ga0209436_108296 Ga0209436_1082962 335
633 3300025229 Ga0209147_100373 Ga0209147_10037316 335
634 3300025242 Ga0209258_100009 Ga0209258_100009587 335
635 3300025245 Ga0207425_1000590 Ga0207425_10005907 335
636 3300025245 Ga0207425_1005361 Ga0207425_10053612 335
637 3300025254 Ga0209148_1000007 Ga0209148_1000007587 335
638 3300025258 Ga0209129_1000013 Ga0209129_100001377 335
639 3300025263 Ga0209565_1000197 Ga0209565_100019726 335
640 3300025263 Ga0209565_1004258 Ga0209565_10042586 335
641 3300025273 Ga0209673_1000245 Ga0209673_100024518 335
642 3300025273 Ga0209673_1000535 Ga0209673_100053537 335
643 3300025273 Ga0209673_1005273 Ga0209673_10052734 335
644 3300025284 Ga0209130_1000163 Ga0209130_100016329 335
645 3300025284 Ga0209130_1001170 Ga0209130_10011705 335
646 3300025291 Ga0209675_1000440 Ga0209675_100044016 335
647 3300025292 Ga0209676_1000108 Ga0209676_1000108130 335
648 3300025292 Ga0209676_1010636 Ga0209676_10106365 335
649 3300025294 Ga0209025_1000169 Ga0209025_100016935 335
650 3300025295 Ga0209564_1000171 Ga0209564_100017135 335
651 3300025295 Ga0209564_1000517 Ga0209564_100051735 335
652 3300025297 Ga0209758_1000067 Ga0209758_1000067178 335
653 3300025298 Ga0209050_1000002 Ga0209050_1000002388 335
654 3300025299 Ga0209256_1000077 Ga0209256_1000077177 335
655 3300025299 Ga0209256_1000121 Ga0209256_100012135 335
656 3300025302 Ga0207426_1000101 Ga0207426_100010177 335
657 3300025302 Ga0207426_1000129 Ga0207426_100012981 335
658 3300025303 Ga0209051_1000002 Ga0209051_1000002156 335
659 3300025303 Ga0209051_1000289 Ga0209051_100028921 335
660 3300025303 Ga0209051_1002533 Ga0209051_10025333 335
661 3300025303 Ga0209051_1013408 Ga0209051_10134085 335
662 3300025304 Ga0209257_1000002 Ga0209257_1000002297 335
663 3300025304 Ga0209257_1003753 Ga0209257_100375310 335
664 3300025321 Ga0207656_10035733 Ga0207656_100357332 335
665 3300025919 Ga0207657_10047837 Ga0207657_100478373 335
666 3300025945 Ga0207679_10013185 Ga0207679_100131853 335
667 3300026078 Ga0207702_10010757 Ga0207702_100107573 335
668 3300026116 Ga0207674_10012160 Ga0207674_100121609 335
669 3300028379 Ga0268266_10393223 Ga0268266_103932232 335
670 3300028786 Ga0307517_10004307 Ga0307517_100043077 335
671 3300030734 Ga0316179_1007438 Ga0316179_10074382 335
672 3300030735 Ga0316178_1036479 Ga0316178_10364792 335
673 3300030742 Ga0316183_1021428 Ga0316183_10214282 335
674 3300031507 Ga0307509_10001286 Ga0307509_1000128620 335
675 3300031507 Ga0307509_10248800 Ga0307509_102488002 335
676 3300031548 Ga0307408_100023580 Ga0307408_1000235804 335
677 3300031548 Ga0307408_100186067 Ga0307408_1001860672 335
678 3300031616 Ga0307508_10015309 Ga0307508_100153094 335
679 3300031649 Ga0307514_10040739 Ga0307514_100407393 335
680 3300031730 Ga0307516_10166161 Ga0307516_101661612 335
681 3300031731 Ga0307405_10025741 Ga0307405_100257412 335
682 3300031731 Ga0307405_10089630 Ga0307405_100896302 335
683 3300031731 Ga0307405_10116992 Ga0307405_101169922 335
684 3300031731 Ga0307405_10238908 Ga0307405_102389082 335
685 3300031911 Ga0307412_10081552 Ga0307412_100815523 335
686 3300032005 Ga0307411_10074470 Ga0307411_100744702 335
687 3300033180 Ga0307510_10002924 Ga0307510_1000292420 335
688 3300039450 Ga0436363_1647914 Ga0436363_1647914_1030_2043 335
689 3300041404 Ga0439436_0003672 Ga0439436_0003672_3230_4237 335
690 3300041407 Ga0439447_007723 Ga0439447_007723_1293_2300 335
691 3300041411 Ga0439466_0037552 Ga0439466_0037552_471_1478 335
692 3300041999 Ga0439433_0006567 Ga0439433_0006567_133_1140 335
693 3300042002 Ga0439442_007050 Ga0439442_007050_794_1801 335
694 3300042007 Ga0439449_0004686 Ga0439449_0004686_934_1941 335
695 3300042015 Ga0439462_0002186 Ga0439462_0002186_2971_3978 335
696 3300042125 Ga0450923_011036 Ga0450923_011036_96_1103 335
697 3300042532 Ga0450893_0011234 Ga0450893_0011234_461_1468 335
698 3300046454 Ga0495592_0009766 Ga0495592_0009766_1252_2268 335
699 3300048904 Ga0496101_0104298 Ga0496101_0104298_910_1932 335
700 3300048921 Ga0496118_0014670 Ga0496118_0014670_5770_6777 335
701 3300048927 Ga0496124_0137637 Ga0496124_0137637_892_1902 335
702 3300048928 Ga0496125_0029090 Ga0496125_0029090_3283_4290 335
703 3300048928 Ga0496125_0163199 Ga0496125_0163199_319_1326 335
704 3300049705 Ga0501225_0021786 Ga0501225_0021786_595_1602 335
705 3300050489 nmdc:mga03683_38495_c1 nmdc:mga03683_38495_c1_630_1637 335
706 3300050489 nmdc:mga03683_4879_c1 nmdc:mga03683_4879_c1_1931_2938 335
707 3300050496 nmdc:mga07m45_8551_c1 nmdc:mga07m45_8551_c1_2264_3271 335
708 3300053154 Ga0500619_026564 Ga0500619_026564_11_1027 335
709 iso_pu_bacteria 2928115317 2928117370 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

227

326

0.97

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

36

225

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gym-assembly1.cif.gz_sa cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9055 9 37
2r0c-assembly1.cif.gz_A structure of the substrate-free form of the rebeccamycin biosynthetic enzyme rebc 0.905 9 39
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9021 9 39
1y56-assembly1.cif.gz_B crystal structure of l-proline dehydrogenase from p.horikoshii 0.8988 9 40
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.8985 9 39
ID Description Score Start End Superfamily
af_A0A0R0JSV2_33_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 95 203 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 9 204 3.40.50.720
af_Q5I0K1_8_223_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9248 10 39 3.50.50.60
6hrdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9241 7 204 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9236 9 204 3.40.50.720
ID Description Score Start End GO Terms
AF-B4ELK6-F1-model_v4 L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) 0.9901 9 328 GO:0006631
GO:0009056
GO:0016020
GO:0050104
GO:0070403
AF-A0A7C3N468-F1-model_v4 L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) 0.9791 11 324 GO:0006631
GO:0009056
GO:0050104
GO:0070403
AF-A0A658ACS0-F1-model_v4 deleted 0.978 180 328
AF-A0A3D3FY16-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9775 114 332 GO:0006631
GO:0009056
GO:0050104
GO:0070403
AF-A0A3D3FY16-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9687 114 332 GO:0006631
GO:0009056
GO:0050104
GO:0070403

Feature Viewer

pLDDT pTM Quality
94.69 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map