F476637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 397 | 669 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100222581|Ga0070673_1002225812 |
| Length | 361 |
| Sequence | MGNEHSDAGPPQGGLRPPRGEASTRSDGALGATLPRFAAVGAGRMGRGIAIAFAYAGHRISIVDLRPRSDEAWQKLRGEAEAEIEASLAGLAQLGVIDAAQVGAIAXRVAFVDXXSAPAALAAAELVFEGVPETLEAKRDAFEHINRHCREDAILTSTTSSILVTQLAALVHRPERFLNMHWLNPAYVIPVVELSCHPGTDPAVLERTKALMEAIGKLPVVCGASPGYIVPRLQALVMNEAARMIEEGAATAEEIDKATRYGLGLRFAALGVVEFIDFGGCDILHHASREMAASIDRARYTTPAIVDRMVEEGRLGLKSGSGFYEYEGRDVGAYRRDVLSRTLGMLKHAGLWQPPAAETRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 13 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 14 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 15 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 16 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 17 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 18 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 19 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 20 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 21 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 22 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 23 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 24 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 25 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 26 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 27 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 28 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 29 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 30 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 31 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 32 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 33 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 34 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 35 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 36 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 37 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 38 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 39 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 40 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 41 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 42 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 43 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 50 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 51 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 128 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 135 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 232 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 233 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 252 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 266 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 267 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 268 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 271 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 272 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 273 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 274 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 275 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 279 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 280 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 283 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 352 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 374 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 381 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 382 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.22 |
| Metatranscriptomes | 0.14 |
| Isolates | 5.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.25 |
| Nodule | 0.42 |
| Rhizoplane | 1.83 |
| Rhizosphere | 63.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003501 | 3300002773 | Bacteria | 5328 |
| 2 | JGI25150J39212_1001724 | 3300002774 | Bacteria | 5866 |
| 3 | JGI25159J45721_1005177 | 3300002987 | Bacteria | 4130 |
| 4 | JGI25151J46595_10000884 | 3300003187 | Bacteria | 23605 |
| 5 | JGI25151J46595_10001131 | 3300003187 | Bacteria | 19391 |
| 6 | JGI25151J46595_10001895 | 3300003187 | Bacteria | 13315 |
| 7 | JGI25151J46595_10013620 | 3300003187 | Bacteria | 3653 |
| 8 | JGI25153J46596_10007574 | 3300003215 | Bacteria | 5313 |
| 9 | rootH1_10012321 | 3300003316 | Bacteria | 3928 |
| 10 | rootL2_10051089 | 3300003322 | Bacteria | 3242 |
| 11 | rootL2_10055748 | 3300003322 | Bacteria | 4787 |
| 12 | JGI25160J50197_1005251 | 3300003354 | Bacteria | 5421 |
| 13 | JGI25160J50197_1006869 | 3300003354 | Bacteria | 4545 |
| 14 | JGI25161J50226_1002022 | 3300003374 | Bacteria | 5534 |
| 15 | JGI25161J50226_1003243 | 3300003374 | Bacteria | 3800 |
| 16 | Ga0006562J51391_1101148 | 3300003578 | Bacteria | 4594 |
| 17 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 18 | Ga0055529_1001127 | 3300003763 | Bacteria | 11441 |
| 19 | Ga0055526_1011021 | 3300003771 | Bacteria | 4130 |
| 20 | Ga0055526_1016946 | 3300003771 | Bacteria | 2814 |
| 21 | Ga0055537_1000011 | 3300003773 | Bacteria | 137556 |
| 22 | Ga0055537_1004264 | 3300003773 | Bacteria | 4130 |
| 23 | Ga0055524_1007760 | 3300003775 | Bacteria | 4525 |
| 24 | Ga0055524_1008910 | 3300003775 | Bacteria | 4130 |
| 25 | Ga0055536_1001862 | 3300003781 | Bacteria | 12307 |
| 26 | Ga0055536_1010873 | 3300003781 | Bacteria | 3555 |
| 27 | Ga0055534_1000020 | 3300003784 | Bacteria | 137562 |
| 28 | Ga0055534_1005003 | 3300003784 | Bacteria | 3672 |
| 29 | Ga0055534_1005481 | 3300003784 | Bacteria | 3386 |
| 30 | Ga0055534_1007068 | 3300003784 | Bacteria | 2731 |
| 31 | Ga0055528_1009260 | 3300003790 | Bacteria | 4130 |
| 32 | Ga0055530_10001397 | 3300003791 | Bacteria | 17854 |
| 33 | Ga0055530_10021165 | 3300003791 | Bacteria | 1924 |
| 34 | Ga0055540_1001207 | 3300003792 | Bacteria | 15899 |
| 35 | Ga0055540_1003435 | 3300003792 | Bacteria | 7656 |
| 36 | Ga0055540_1005079 | 3300003792 | Bacteria | 5681 |
| 37 | Ga0055540_1008609 | 3300003792 | Bacteria | 3653 |
| 38 | Ga0055540_1009163 | 3300003792 | Bacteria | 3460 |
| 39 | Ga0055540_1009576 | 3300003792 | Bacteria | 3331 |
| 40 | Ga0055531_10000265 | 3300003794 | Bacteria | 54568 |
| 41 | Ga0055531_10005088 | 3300003794 | Bacteria | 7776 |
| 42 | Ga0055531_10008108 | 3300003794 | Bacteria | 5598 |
| 43 | Ga0055531_10014627 | 3300003794 | Bacteria | 3520 |
| 44 | Ga0055543_1002918 | 3300004625 | Bacteria | 5351 |
| 45 | Ga0055543_1021689 | 3300004625 | Bacteria | 1170 |
| 46 | Ga0065165_1007487 | 3300005262 | Bacteria | 5351 |
| 47 | Ga0065712_10182771 | 3300005290 | Bacteria | 1184 |
| 48 | Ga0070658_10025112 | 3300005327 | Bacteria | 4777 |
| 49 | Ga0070658_10074970 | 3300005327 | Bacteria | 2775 |
| 50 | Ga0070683_100026669 | 3300005329 | Bacteria | 5206 |
| 51 | Ga0070683_100044470 | 3300005329 | Bacteria | 4095 |
| 52 | Ga0070690_100013882 | 3300005330 | Bacteria | 4774 |
| 53 | Ga0070670_100005546 | 3300005331 | Bacteria | 10644 |
| 54 | Ga0070670_100027243 | 3300005331 | Bacteria | 4916 |
| 55 | Ga0070670_100067111 | 3300005331 | Bacteria | 3079 |
| 56 | Ga0070670_100092173 | 3300005331 | Bacteria | 2605 |
| 57 | Ga0070677_10003382 | 3300005333 | Bacteria | 5140 |
| 58 | Ga0070666_10278498 | 3300005335 | Bacteria | 1189 |
| 59 | Ga0068868_100043119 | 3300005338 | Bacteria | 3524 |
| 60 | Ga0068868_100126454 | 3300005338 | Bacteria | 2089 |
| 61 | Ga0070660_100192020 | 3300005339 | Bacteria | 1654 |
| 62 | Ga0070691_10020416 | 3300005341 | Bacteria | 3061 |
| 63 | Ga0070661_100029916 | 3300005344 | Bacteria | 3933 |
| 64 | Ga0070661_100062601 | 3300005344 | Bacteria | 2731 |
| 65 | Ga0070668_100256562 | 3300005347 | Bacteria | 1453 |
| 66 | Ga0070675_100000635 | 3300005354 | Bacteria | 24215 |
| 67 | Ga0070675_100090507 | 3300005354 | Bacteria | 2563 |
| 68 | Ga0070675_100393866 | 3300005354 | Bacteria | 1235 |
| 69 | Ga0070671_100002597 | 3300005355 | Bacteria | 13989 |
| 70 | Ga0070671_100019600 | 3300005355 | Bacteria | 5508 |
| 71 | Ga0070671_100022133 | 3300005355 | Bacteria | 5192 |
| 72 | Ga0070671_100144940 | 3300005355 | Bacteria | 2004 |
| 73 | Ga0070674_100026543 | 3300005356 | Bacteria | 3785 |
| 74 | Ga0070673_100013219 | 3300005364 | Bacteria | 5699 |
| 75 | Ga0070673_100222581 | 3300005364 | Bacteria | 1634 |
| 76 | Ga0070659_100024749 | 3300005366 | Bacteria | 4604 |
| 77 | Ga0070667_100080705 | 3300005367 | Bacteria | 2783 |
| 78 | Ga0070710_10251981 | 3300005437 | Unclassified | 1135 |
| 79 | Ga0070701_10168430 | 3300005438 | Bacteria | 1274 |
| 80 | Ga0070700_100090546 | 3300005441 | Bacteria | 1995 |
| 81 | Ga0070694_100132862 | 3300005444 | Bacteria | 1800 |
| 82 | Ga0070708_100296071 | 3300005445 | Bacteria | 1524 |
| 83 | Ga0070663_100064345 | 3300005455 | Bacteria | 2651 |
| 84 | Ga0070678_100047822 | 3300005456 | Bacteria | 3076 |
| 85 | Ga0070678_100347254 | 3300005456 | Bacteria | 1275 |
| 86 | Ga0070662_100025092 | 3300005457 | Bacteria | 4113 |
| 87 | Ga0070662_100094013 | 3300005457 | Bacteria | 2256 |
| 88 | Ga0070662_100397587 | 3300005457 | Bacteria | 1137 |
| 89 | Ga0070681_10000175 | 3300005458 | Bacteria | 48999 |
| 90 | Ga0068867_100000428 | 3300005459 | Bacteria | 28160 |
| 91 | Ga0068867_100003674 | 3300005459 | Bacteria | 10796 |
| 92 | Ga0068867_100074154 | 3300005459 | Bacteria | 2550 |
| 93 | Ga0068867_100178470 | 3300005459 | Bacteria | 1687 |
| 94 | Ga0068867_100408142 | 3300005459 | Bacteria | 1147 |
| 95 | Ga0070706_100001519 | 3300005467 | Bacteria | 24333 |
| 96 | Ga0070698_100058761 | 3300005471 | Bacteria | 3887 |
| 97 | Ga0070698_100076768 | 3300005471 | Bacteria | 3342 |
| 98 | Ga0070698_100270777 | 3300005471 | Bacteria | 1630 |
| 99 | Ga0070699_100059744 | 3300005518 | Bacteria | 3302 |
| 100 | Ga0070679_100035754 | 3300005530 | Bacteria | 4928 |
| 101 | Ga0070679_100050863 | 3300005530 | Bacteria | 4128 |
| 102 | Ga0070684_100011605 | 3300005535 | Bacteria | 7022 |
| 103 | Ga0070684_100014195 | 3300005535 | Bacteria | 6444 |
| 104 | Ga0070684_100039922 | 3300005535 | Bacteria | 4039 |
| 105 | Ga0068853_100043050 | 3300005539 | Bacteria | 3862 |
| 106 | Ga0068853_100089057 | 3300005539 | Bacteria | 2710 |
| 107 | Ga0068853_100206188 | 3300005539 | Bacteria | 1790 |
| 108 | Ga0068853_100256398 | 3300005539 | Bacteria | 1607 |
| 109 | Ga0068853_100503382 | 3300005539 | Bacteria | 1144 |
| 110 | Ga0070672_100000188 | 3300005543 | Bacteria | 34174 |
| 111 | Ga0070672_100035212 | 3300005543 | Bacteria | 3805 |
| 112 | Ga0070672_100251445 | 3300005543 | Bacteria | 1489 |
| 113 | Ga0070686_100015078 | 3300005544 | Bacteria | 4468 |
| 114 | Ga0070686_100083439 | 3300005544 | Bacteria | 2121 |
| 115 | Ga0070696_100061847 | 3300005546 | Bacteria | 2620 |
| 116 | Ga0070696_100160656 | 3300005546 | Bacteria | 1655 |
| 117 | Ga0070693_100017897 | 3300005547 | Bacteria | 3693 |
| 118 | Ga0070693_100175929 | 3300005547 | Bacteria | 1374 |
| 119 | Ga0070665_100011217 | 3300005548 | Bacteria | 9061 |
| 120 | Ga0070665_100077624 | 3300005548 | Bacteria | 3328 |
| 121 | Ga0070664_100063811 | 3300005564 | Bacteria | 3141 |
| 122 | Ga0068857_100039725 | 3300005577 | Bacteria | 4170 |
| 123 | Ga0068857_100040500 | 3300005577 | Bacteria | 4131 |
| 124 | Ga0068857_100145308 | 3300005577 | Bacteria | 2146 |
| 125 | Ga0068857_100245987 | 3300005577 | Bacteria | 1638 |
| 126 | Ga0068854_100202421 | 3300005578 | Bacteria | 1561 |
| 127 | Ga0068856_100019589 | 3300005614 | Bacteria | 6568 |
| 128 | Ga0068856_100083507 | 3300005614 | Bacteria | 3172 |
| 129 | Ga0068859_100038576 | 3300005617 | Bacteria | 4792 |
| 130 | Ga0068859_100119353 | 3300005617 | Bacteria | 2703 |
| 131 | Ga0068859_100156473 | 3300005617 | Bacteria | 2356 |
| 132 | Ga0068864_100016644 | 3300005618 | Bacteria | 6125 |
| 133 | Ga0068864_100048182 | 3300005618 | Bacteria | 3662 |
| 134 | Ga0068861_100003931 | 3300005719 | Bacteria | 9935 |
| 135 | Ga0068861_100173692 | 3300005719 | Bacteria | 1788 |
| 136 | Ga0068851_10013256 | 3300005834 | Bacteria | 3900 |
| 137 | Ga0068851_10054130 | 3300005834 | Bacteria | 2043 |
| 138 | Ga0068870_10022385 | 3300005840 | Bacteria | 3105 |
| 139 | Ga0068863_100246047 | 3300005841 | Bacteria | 1727 |
| 140 | Ga0068858_100013451 | 3300005842 | Bacteria | 7721 |
| 141 | Ga0068858_100026462 | 3300005842 | Bacteria | 5388 |
| 142 | Ga0068860_100003712 | 3300005843 | Bacteria | 15704 |
| 143 | Ga0068860_100007838 | 3300005843 | Bacteria | 10660 |
| 144 | Ga0068862_100009256 | 3300005844 | Bacteria | 8156 |
| 145 | Ga0068862_100010258 | 3300005844 | Bacteria | 7731 |
| 146 | Ga0068862_100026748 | 3300005844 | Bacteria | 4851 |
| 147 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 148 | Ga0075365_10307452 | 3300006038 | Bacteria | 1116 |
| 149 | Ga0075363_100004888 | 3300006048 | Bacteria | 5921 |
| 150 | Ga0075363_100005543 | 3300006048 | Bacteria | 5628 |
| 151 | Ga0075363_100033782 | 3300006048 | Bacteria | 2667 |
| 152 | Ga0075363_100039517 | 3300006048 | Bacteria | 2483 |
| 153 | Ga0075364_10002462 | 3300006051 | Bacteria | 10367 |
| 154 | Ga0075362_10019257 | 3300006177 | Bacteria | 2836 |
| 155 | Ga0075362_10031834 | 3300006177 | Bacteria | 2285 |
| 156 | Ga0075362_10042693 | 3300006177 | Bacteria | 2005 |
| 157 | Ga0075367_10009261 | 3300006178 | Bacteria | 5139 |
| 158 | Ga0075367_10021564 | 3300006178 | Bacteria | 3602 |
| 159 | Ga0075369_10025866 | 3300006186 | Bacteria | 2443 |
| 160 | Ga0075366_10004246 | 3300006195 | Bacteria | 7681 |
| 161 | Ga0075366_10010842 | 3300006195 | Bacteria | 5128 |
| 162 | Ga0075366_10012754 | 3300006195 | Bacteria | 4774 |
| 163 | Ga0075366_10017232 | 3300006195 | Bacteria | 4155 |
| 164 | Ga0075366_10020508 | 3300006195 | Bacteria | 3835 |
| 165 | Ga0075366_10022934 | 3300006195 | Bacteria | 3635 |
| 166 | Ga0075366_10025548 | 3300006195 | Bacteria | 3451 |
| 167 | Ga0075366_10050650 | 3300006195 | Bacteria | 2466 |
| 168 | Ga0075366_10071144 | 3300006195 | Bacteria | 2072 |
| 169 | Ga0075366_10076056 | 3300006195 | Bacteria | 2003 |
| 170 | Ga0097621_100011749 | 3300006237 | Bacteria | 6466 |
| 171 | Ga0097621_100014096 | 3300006237 | Bacteria | 5975 |
| 172 | Ga0097621_100029031 | 3300006237 | Bacteria | 4365 |
| 173 | Ga0075370_10007645 | 3300006353 | Bacteria | 5515 |
| 174 | Ga0075370_10016681 | 3300006353 | Bacteria | 3954 |
| 175 | Ga0075370_10045153 | 3300006353 | Bacteria | 2491 |
| 176 | Ga0075370_10047720 | 3300006353 | Bacteria | 2425 |
| 177 | Ga0068871_100051422 | 3300006358 | Bacteria | 3336 |
| 178 | Ga0068871_100478267 | 3300006358 | Bacteria | 1120 |
| 179 | Ga0075428_100018493 | 3300006844 | Bacteria | 7705 |
| 180 | Ga0075430_100001924 | 3300006846 | Bacteria | 17039 |
| 181 | Ga0075431_100000645 | 3300006847 | Bacteria | 29557 |
| 182 | Ga0075431_100245020 | 3300006847 | Bacteria | 1822 |
| 183 | Ga0075429_100000476 | 3300006880 | Bacteria | 29908 |
| 184 | Ga0068865_100000919 | 3300006881 | Bacteria | 16683 |
| 185 | Ga0075436_100009711 | 3300006914 | Bacteria | 6583 |
| 186 | Ga0097620_100038576 | 3300006931 | Bacteria | 4792 |
| 187 | Ga0097620_100119344 | 3300006931 | Bacteria | 2703 |
| 188 | Ga0097620_100156475 | 3300006931 | Bacteria | 2356 |
| 189 | Ga0099826_10000432 | 3300006948 | Bacteria | 19961 |
| 190 | Ga0105244_10001781 | 3300009036 | Bacteria | 16898 |
| 191 | Ga0105244_10061924 | 3300009036 | Bacteria | 1882 |
| 192 | Ga0105240_10077802 | 3300009093 | Bacteria | 4086 |
| 193 | Ga0105240_10144453 | 3300009093 | Bacteria | 2841 |
| 194 | Ga0111539_10405974 | 3300009094 | Bacteria | 1587 |
| 195 | Ga0111539_10498442 | 3300009094 | Bacteria | 1418 |
| 196 | Ga0105245_10109324 | 3300009098 | Bacteria | 2569 |
| 197 | Ga0105245_10436644 | 3300009098 | Bacteria | 1315 |
| 198 | Ga0114129_10002793 | 3300009147 | Bacteria | 24352 |
| 199 | Ga0105243_10002000 | 3300009148 | Bacteria | 17343 |
| 200 | Ga0105243_10005462 | 3300009148 | Bacteria | 9916 |
| 201 | Ga0105243_10024964 | 3300009148 | Bacteria | 4564 |
| 202 | Ga0105243_10086372 | 3300009148 | Bacteria | 2573 |
| 203 | Ga0105243_10386886 | 3300009148 | Bacteria | 1295 |
| 204 | Ga0105241_10083373 | 3300009174 | Bacteria | 2508 |
| 205 | Ga0105248_10205018 | 3300009177 | Bacteria | 2222 |
| 206 | Ga0105248_10337097 | 3300009177 | Bacteria | 1698 |
| 207 | Ga0105249_10035064 | 3300009553 | Bacteria | 4548 |
| 208 | Ga0105249_10134229 | 3300009553 | Bacteria | 2367 |
| 209 | Ga0105239_10033940 | 3300010375 | Bacteria | 5602 |
| 210 | Ga0105246_10142335 | 3300011119 | Bacteria | 1805 |
| 211 | Ga0157373_10007987 | 3300013100 | Bacteria | 7867 |
| 212 | Ga0157373_10072148 | 3300013100 | Bacteria | 2437 |
| 213 | Ga0157371_10057838 | 3300013102 | Bacteria | 2750 |
| 214 | Ga0157370_10004758 | 3300013104 | Bacteria | 15452 |
| 215 | Ga0157369_10020698 | 3300013105 | Bacteria | 7355 |
| 216 | Ga0157369_10021810 | 3300013105 | Bacteria | 7161 |
| 217 | Ga0157369_10055285 | 3300013105 | Bacteria | 4285 |
| 218 | Ga0157369_10085647 | 3300013105 | Bacteria | 3367 |
| 219 | Ga0157374_10051039 | 3300013296 | Bacteria | 3848 |
| 220 | Ga0157378_10005326 | 3300013297 | Bacteria | 11291 |
| 221 | Ga0157378_10094159 | 3300013297 | Bacteria | 2728 |
| 222 | Ga0157372_10009605 | 3300013307 | Bacteria | 10280 |
| 223 | Ga0157372_10037609 | 3300013307 | Bacteria | 5340 |
| 224 | Ga0157372_10116622 | 3300013307 | Bacteria | 3062 |
| 225 | Ga0157375_10049857 | 3300013308 | Bacteria | 4104 |
| 226 | Ga0157375_10067681 | 3300013308 | Bacteria | 3569 |
| 227 | Ga0157375_10251976 | 3300013308 | Bacteria | 1926 |
| 228 | Ga0157380_10068813 | 3300014326 | Bacteria | 2855 |
| 229 | Ga0182008_10002890 | 3300014497 | Bacteria | 10629 |
| 230 | Ga0182008_10054927 | 3300014497 | Bacteria | 1970 |
| 231 | Ga0182008_10060742 | 3300014497 | Bacteria | 1863 |
| 232 | Ga0157379_10069093 | 3300014968 | Bacteria | 3159 |
| 233 | Ga0157379_10084937 | 3300014968 | Bacteria | 2836 |
| 234 | Ga0157376_10035508 | 3300014969 | Bacteria | 4032 |
| 235 | Ga0157376_10119404 | 3300014969 | Bacteria | 2334 |
| 236 | Ga0182006_1005774 | 3300015261 | Bacteria | 5837 |
| 237 | Ga0182006_1043948 | 3300015261 | Bacteria | 1744 |
| 238 | Ga0182007_10000298 | 3300015262 | Bacteria | 32177 |
| 239 | Ga0182005_1021497 | 3300015265 | Bacteria | 1770 |
| 240 | Ga0182005_1025023 | 3300015265 | Bacteria | 1629 |
| 241 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 242 | Ga0163161_10000042 | 3300017792 | Bacteria | 135368 |
| 243 | Ga0163161_10018527 | 3300017792 | Bacteria | 4878 |
| 244 | Ga0163161_10088969 | 3300017792 | Bacteria | 2283 |
| 245 | Ga0209436_107422 | 3300025208 | Bacteria | 2293 |
| 246 | Ga0209436_108296 | 3300025208 | Bacteria | 2082 |
| 247 | Ga0209672_104501 | 3300025228 | Bacteria | 2576 |
| 248 | Ga0209147_100373 | 3300025229 | Bacteria | 31414 |
| 249 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 250 | Ga0207425_1000590 | 3300025245 | Bacteria | 21180 |
| 251 | Ga0207425_1005361 | 3300025245 | Bacteria | 3667 |
| 252 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 253 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 254 | Ga0209129_1000415 | 3300025258 | Bacteria | 33012 |
| 255 | Ga0209565_1000058 | 3300025263 | Bacteria | 194126 |
| 256 | Ga0209565_1000197 | 3300025263 | Bacteria | 71850 |
| 257 | Ga0209565_1004258 | 3300025263 | Bacteria | 4420 |
| 258 | Ga0209455_1000534 | 3300025272 | Bacteria | 26400 |
| 259 | Ga0209673_1000053 | 3300025273 | Bacteria | 279449 |
| 260 | Ga0209673_1000245 | 3300025273 | Bacteria | 103315 |
| 261 | Ga0209673_1000535 | 3300025273 | Bacteria | 62272 |
| 262 | Ga0209673_1005273 | 3300025273 | Bacteria | 6564 |
| 263 | Ga0209130_1000163 | 3300025284 | Bacteria | 98074 |
| 264 | Ga0209130_1001170 | 3300025284 | Bacteria | 18856 |
| 265 | Ga0209130_1002376 | 3300025284 | Bacteria | 9542 |
| 266 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 267 | Ga0209675_1000440 | 3300025291 | Bacteria | 32862 |
| 268 | Ga0209675_1001994 | 3300025291 | Bacteria | 10957 |
| 269 | Ga0209675_1003630 | 3300025291 | Bacteria | 7240 |
| 270 | Ga0209676_1000108 | 3300025292 | Bacteria | 221168 |
| 271 | Ga0209676_1000653 | 3300025292 | Bacteria | 49661 |
| 272 | Ga0209676_1001003 | 3300025292 | Bacteria | 33089 |
| 273 | Ga0209676_1010636 | 3300025292 | Bacteria | 3801 |
| 274 | Ga0209676_1018846 | 3300025292 | Bacteria | 2394 |
| 275 | Ga0209025_1000103 | 3300025294 | Bacteria | 228054 |
| 276 | Ga0209025_1000129 | 3300025294 | Bacteria | 198847 |
| 277 | Ga0209025_1000169 | 3300025294 | Bacteria | 161428 |
| 278 | Ga0209025_1015590 | 3300025294 | Bacteria | 4565 |
| 279 | Ga0209564_1000171 | 3300025295 | Bacteria | 155716 |
| 280 | Ga0209564_1000517 | 3300025295 | Bacteria | 63233 |
| 281 | Ga0209758_1000067 | 3300025297 | Bacteria | 288575 |
| 282 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 283 | Ga0209050_1001558 | 3300025298 | Bacteria | 23912 |
| 284 | Ga0209050_1006217 | 3300025298 | Bacteria | 7164 |
| 285 | Ga0209256_1000077 | 3300025299 | Bacteria | 230410 |
| 286 | Ga0209256_1000121 | 3300025299 | Bacteria | 167299 |
| 287 | Ga0207426_1000101 | 3300025302 | Bacteria | 262096 |
| 288 | Ga0207426_1000129 | 3300025302 | Bacteria | 210930 |
| 289 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 290 | Ga0209051_1000145 | 3300025303 | Bacteria | 134807 |
| 291 | Ga0209051_1000252 | 3300025303 | Bacteria | 90654 |
| 292 | Ga0209051_1000289 | 3300025303 | Bacteria | 80415 |
| 293 | Ga0209051_1000501 | 3300025303 | Bacteria | 49660 |
| 294 | Ga0209051_1002533 | 3300025303 | Bacteria | 12921 |
| 295 | Ga0209051_1013408 | 3300025303 | Bacteria | 3902 |
| 296 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 297 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 298 | Ga0209257_1001684 | 3300025304 | Bacteria | 24845 |
| 299 | Ga0209257_1003753 | 3300025304 | Bacteria | 12550 |
| 300 | Ga0209257_1037010 | 3300025304 | Bacteria | 1492 |
| 301 | Ga0207697_10040075 | 3300025315 | Bacteria | 1923 |
| 302 | Ga0207656_10035733 | 3300025321 | Bacteria | 2082 |
| 303 | Ga0207656_10055860 | 3300025321 | Bacteria | 1720 |
| 304 | Ga0207655_1001616 | 3300025728 | Bacteria | 20066 |
| 305 | Ga0207688_10075285 | 3300025901 | Bacteria | 1921 |
| 306 | Ga0207645_10004557 | 3300025907 | Bacteria | 10230 |
| 307 | Ga0207645_10068841 | 3300025907 | Bacteria | 2264 |
| 308 | Ga0207645_10098456 | 3300025907 | Bacteria | 1885 |
| 309 | Ga0207643_10068410 | 3300025908 | Bacteria | 2040 |
| 310 | Ga0207705_10012949 | 3300025909 | Bacteria | 6019 |
| 311 | Ga0207705_10105784 | 3300025909 | Bacteria | 2075 |
| 312 | Ga0207684_10006075 | 3300025910 | Bacteria | 11049 |
| 313 | Ga0207707_10000660 | 3300025912 | Bacteria | 34202 |
| 314 | Ga0207671_10014895 | 3300025914 | Bacteria | 6116 |
| 315 | Ga0207657_10047837 | 3300025919 | Bacteria | 3737 |
| 316 | Ga0207649_10007994 | 3300025920 | Bacteria | 5754 |
| 317 | Ga0207652_10060917 | 3300025921 | Bacteria | 3258 |
| 318 | Ga0207681_10013857 | 3300025923 | Bacteria | 4995 |
| 319 | Ga0207650_10000748 | 3300025925 | Bacteria | 25074 |
| 320 | Ga0207650_10056300 | 3300025925 | Bacteria | 2921 |
| 321 | Ga0207659_10037765 | 3300025926 | Bacteria | 3355 |
| 322 | Ga0207659_10046168 | 3300025926 | Bacteria | 3075 |
| 323 | Ga0207659_10371671 | 3300025926 | Bacteria | 1190 |
| 324 | Ga0207644_10013153 | 3300025931 | Bacteria | 5510 |
| 325 | Ga0207644_10022994 | 3300025931 | Bacteria | 4264 |
| 326 | Ga0207644_10023506 | 3300025931 | Bacteria | 4223 |
| 327 | Ga0207644_10168745 | 3300025931 | Bacteria | 1707 |
| 328 | Ga0207690_10006705 | 3300025932 | Bacteria | 6822 |
| 329 | Ga0207706_10020413 | 3300025933 | Bacteria | 5956 |
| 330 | Ga0207709_10000375 | 3300025935 | Bacteria | 44662 |
| 331 | Ga0207709_10009694 | 3300025935 | Bacteria | 5306 |
| 332 | Ga0207669_10012504 | 3300025937 | Bacteria | 4177 |
| 333 | Ga0207704_10009150 | 3300025938 | Bacteria | 4766 |
| 334 | Ga0207691_10001187 | 3300025940 | Bacteria | 25907 |
| 335 | Ga0207691_10092780 | 3300025940 | Bacteria | 2704 |
| 336 | Ga0207689_10154801 | 3300025942 | Bacteria | 1890 |
| 337 | Ga0207661_10139377 | 3300025944 | Bacteria | 2086 |
| 338 | Ga0207679_10013185 | 3300025945 | Bacteria | 5414 |
| 339 | Ga0207679_10036634 | 3300025945 | Bacteria | 3480 |
| 340 | Ga0207679_10043476 | 3300025945 | Bacteria | 3235 |
| 341 | Ga0207651_10007651 | 3300025960 | Bacteria | 5767 |
| 342 | Ga0207658_10043181 | 3300025986 | Bacteria | 3276 |
| 343 | Ga0207677_10009993 | 3300026023 | Bacteria | 5355 |
| 344 | Ga0207677_10100834 | 3300026023 | Bacteria | 2124 |
| 345 | Ga0207703_10091068 | 3300026035 | Bacteria | 2564 |
| 346 | Ga0207639_10093316 | 3300026041 | Bacteria | 2414 |
| 347 | Ga0207678_10064746 | 3300026067 | Bacteria | 3141 |
| 348 | Ga0207708_10018408 | 3300026075 | Bacteria | 5260 |
| 349 | Ga0207702_10010757 | 3300026078 | Bacteria | 7638 |
| 350 | Ga0207702_10057881 | 3300026078 | Bacteria | 3296 |
| 351 | Ga0207648_10001166 | 3300026089 | Bacteria | 29390 |
| 352 | Ga0207648_10001269 | 3300026089 | Bacteria | 28173 |
| 353 | Ga0207648_10040126 | 3300026089 | Bacteria | 4114 |
| 354 | Ga0207648_10399206 | 3300026089 | Bacteria | 1246 |
| 355 | Ga0207676_10007264 | 3300026095 | Bacteria | 7848 |
| 356 | Ga0207676_10045713 | 3300026095 | Bacteria | 3384 |
| 357 | Ga0207674_10012160 | 3300026116 | Bacteria | 9636 |
| 358 | Ga0207674_10025299 | 3300026116 | Bacteria | 6334 |
| 359 | Ga0207674_10071507 | 3300026116 | Bacteria | 3485 |
| 360 | Ga0207674_10152689 | 3300026116 | Bacteria | 2266 |
| 361 | Ga0207675_100000838 | 3300026118 | Bacteria | 30617 |
| 362 | Ga0207675_100127126 | 3300026118 | Bacteria | 2415 |
| 363 | Ga0207683_10004545 | 3300026121 | Bacteria | 11957 |
| 364 | Ga0207683_10026834 | 3300026121 | Bacteria | 4975 |
| 365 | Ga0207683_10038469 | 3300026121 | Bacteria | 4170 |
| 366 | Ga0209282_1001250 | 3300027666 | Bacteria | 13759 |
| 367 | Ga0209813_10054337 | 3300027866 | Bacteria | 1262 |
| 368 | Ga0207428_10137288 | 3300027907 | Bacteria | 1869 |
| 369 | Ga0268266_10013898 | 3300028379 | Bacteria | 6932 |
| 370 | Ga0268266_10393223 | 3300028379 | Bacteria | 1310 |
| 371 | Ga0268265_10005821 | 3300028380 | Bacteria | 8407 |
| 372 | Ga0268265_10070045 | 3300028380 | Bacteria | 2726 |
| 373 | Ga0268264_10014746 | 3300028381 | Bacteria | 6421 |
| 374 | Ga0268264_10045871 | 3300028381 | Bacteria | 3630 |
| 375 | Ga0307517_10000196 | 3300028786 | Bacteria | 102384 |
| 376 | Ga0307517_10004307 | 3300028786 | Bacteria | 21926 |
| 377 | Ga0307515_10000014 | 3300028794 | Bacteria | 562358 |
| 378 | Ga0307515_10000424 | 3300028794 | Bacteria | 101910 |
| 379 | Ga0307515_10002595 | 3300028794 | Bacteria | 38945 |
| 380 | Ga0307515_10034279 | 3300028794 | Bacteria | 8320 |
| 381 | Ga0307515_10310832 | 3300028794 | Bacteria | 1251 |
| 382 | Ga0316179_1007438 | 3300030734 | Bacteria | 3062 |
| 383 | Ga0316178_1036479 | 3300030735 | Bacteria | 1232 |
| 384 | Ga0316183_1021428 | 3300030742 | Bacteria | 2821 |
| 385 | Ga0316183_1120317 | 3300030742 | Bacteria | 1748 |
| 386 | Ga0265327_10000806 | 3300031251 | Bacteria | 47753 |
| 387 | Ga0307513_10069162 | 3300031456 | Bacteria | 3695 |
| 388 | Ga0307509_10001286 | 3300031507 | Bacteria | 42598 |
| 389 | Ga0307509_10025821 | 3300031507 | Bacteria | 6560 |
| 390 | Ga0307509_10219003 | 3300031507 | Bacteria | 1719 |
| 391 | Ga0307509_10248800 | 3300031507 | Bacteria | 1563 |
| 392 | Ga0307408_100023580 | 3300031548 | Bacteria | 4193 |
| 393 | Ga0307408_100186067 | 3300031548 | Bacteria | 1669 |
| 394 | Ga0307408_100205828 | 3300031548 | Bacteria | 1596 |
| 395 | Ga0307508_10015309 | 3300031616 | Bacteria | 6988 |
| 396 | Ga0307508_10126918 | 3300031616 | Bacteria | 2154 |
| 397 | Ga0307514_10040739 | 3300031649 | Bacteria | 3660 |
| 398 | Ga0307516_10166161 | 3300031730 | Bacteria | 1951 |
| 399 | Ga0307516_10166543 | 3300031730 | Bacteria | 1948 |
| 400 | Ga0307405_10006212 | 3300031731 | Bacteria | 5856 |
| 401 | Ga0307405_10007635 | 3300031731 | Bacteria | 5428 |
| 402 | Ga0307405_10025741 | 3300031731 | Bacteria | 3382 |
| 403 | Ga0307405_10089630 | 3300031731 | Bacteria | 2032 |
| 404 | Ga0307405_10116992 | 3300031731 | Bacteria | 1816 |
| 405 | Ga0307405_10159118 | 3300031731 | Bacteria | 1597 |
| 406 | Ga0307405_10238908 | 3300031731 | Bacteria | 1344 |
| 407 | Ga0307405_10318018 | 3300031731 | Bacteria | 1188 |
| 408 | Ga0307410_10359624 | 3300031852 | Bacteria | 1165 |
| 409 | Ga0307406_10334179 | 3300031901 | Bacteria | 1177 |
| 410 | Ga0307412_10032318 | 3300031911 | Bacteria | 3314 |
| 411 | Ga0307412_10054656 | 3300031911 | Bacteria | 2651 |
| 412 | Ga0307412_10081552 | 3300031911 | Bacteria | 2237 |
| 413 | Ga0307412_10091615 | 3300031911 | Bacteria | 2128 |
| 414 | Ga0307409_100118691 | 3300031995 | Bacteria | 2235 |
| 415 | Ga0307416_100053538 | 3300032002 | Bacteria | 3238 |
| 416 | Ga0307416_100055750 | 3300032002 | Bacteria | 3185 |
| 417 | Ga0307416_100073436 | 3300032002 | Bacteria | 2852 |
| 418 | Ga0307416_100125974 | 3300032002 | Bacteria | 2294 |
| 419 | Ga0307416_100419473 | 3300032002 | Bacteria | 1382 |
| 420 | Ga0307411_10039636 | 3300032005 | Bacteria | 2982 |
| 421 | Ga0307411_10074470 | 3300032005 | Bacteria | 2314 |
| 422 | Ga0307415_100003121 | 3300032126 | Bacteria | 8393 |
| 423 | Ga0307415_100142940 | 3300032126 | Bacteria | 1830 |
| 424 | Ga0307510_10002924 | 3300033180 | Bacteria | 19645 |
| 425 | Ga0307510_10161888 | 3300033180 | Bacteria | 1833 |
| 426 | Ga0373948_0022584 | 3300034817 | Unclassified | 1214 |
| 427 | Ga0373938_0007684 | 3300034957 | Bacteria | 1904 |
| 428 | Ga0373960_0035775 | 3300035121 | Bacteria | 1411 |
| 429 | Ga0373943_0025212 | 3300035170 | Bacteria | 2779 |
| 430 | Ga0373946_0115287 | 3300035171 | Bacteria | 1221 |
| 431 | Ga0316574_0010549 | 3300035398 | Bacteria | 5226 |
| 432 | Ga0373927_0047357 | 3300035695 | Bacteria | 2781 |
| 433 | Ga0373937_0133815 | 3300036401 | Bacteria | 2317 |
| 434 | Ga0373937_0367515 | 3300036401 | Bacteria | 1364 |
| 435 | Ga0373925_0003526 | 3300037068 | Bacteria | 12067 |
| 436 | Ga0395899_0002692 | 3300037312 | Bacteria | 14327 |
| 437 | Ga0395899_0062951 | 3300037312 | Bacteria | 2731 |
| 438 | Ga0395900_0010858 | 3300037418 | Bacteria | 9315 |
| 439 | Ga0395900_0095943 | 3300037418 | Bacteria | 3047 |
| 440 | Ga0395898_0028661 | 3300037466 | Bacteria | 5579 |
| 441 | Ga0395898_0059152 | 3300037466 | Bacteria | 3729 |
| 442 | Ga0395905_0107359 | 3300037471 | Bacteria | 2621 |
| 443 | Ga0395905_0167594 | 3300037471 | Bacteria | 2064 |
| 444 | Ga0395901_0013558 | 3300038443 | Bacteria | 8288 |
| 445 | Ga0395901_0419762 | 3300038443 | Bacteria | 1372 |
| 446 | Ga0436363_1647914 | 3300039450 | Bacteria | 3918 |
| 447 | Ga0439436_0000074 | 3300041404 | Bacteria | 25886 |
| 448 | Ga0439436_0003672 | 3300041404 | Bacteria | 4678 |
| 449 | Ga0439436_0017877 | 3300041404 | Bacteria | 2122 |
| 450 | Ga0439439_0001203 | 3300041406 | Bacteria | 5011 |
| 451 | Ga0439439_0002957 | 3300041406 | Bacteria | 3692 |
| 452 | Ga0439447_007723 | 3300041407 | Bacteria | 3387 |
| 453 | Ga0439466_0013978 | 3300041411 | Bacteria | 2930 |
| 454 | Ga0439466_0037552 | 3300041411 | Bacteria | 1630 |
| 455 | Ga0439466_0042792 | 3300041411 | Bacteria | 1506 |
| 456 | Ga0439465_0003681 | 3300041413 | Bacteria | 4996 |
| 457 | Ga0439431_0000361 | 3300041997 | Bacteria | 9565 |
| 458 | Ga0439433_0006567 | 3300041999 | Bacteria | 2504 |
| 459 | Ga0439433_0021321 | 3300041999 | Bacteria | 1449 |
| 460 | Ga0439442_007050 | 3300042002 | Bacteria | 2256 |
| 461 | Ga0439445_0001373 | 3300042004 | Bacteria | 5276 |
| 462 | Ga0439432_001162 | 3300042006 | Bacteria | 9959 |
| 463 | Ga0439432_063073 | 3300042006 | Bacteria | 1139 |
| 464 | Ga0439449_0002224 | 3300042007 | Bacteria | 7633 |
| 465 | Ga0439449_0004686 | 3300042007 | Bacteria | 5281 |
| 466 | Ga0439457_011445 | 3300042014 | Bacteria | 2019 |
| 467 | Ga0439462_0002186 | 3300042015 | Bacteria | 4508 |
| 468 | Ga0439462_0042206 | 3300042015 | Bacteria | 1218 |
| 469 | Ga0450921_003496 | 3300042123 | Bacteria | 1108 |
| 470 | Ga0450923_011036 | 3300042125 | Bacteria | 1617 |
| 471 | Ga0439434_0009992 | 3300042435 | Bacteria | 2793 |
| 472 | Ga0439464_0011345 | 3300042439 | Bacteria | 2361 |
| 473 | Ga0450918_004653 | 3300042531 | Bacteria | 2489 |
| 474 | Ga0450893_0011234 | 3300042532 | Bacteria | 1478 |
| 475 | Ga0450893_0024001 | 3300042532 | Bacteria | 1063 |
| 476 | Ga0451577_0018204 | 3300042876 | Bacteria | 6473 |
| 477 | Ga0466972_0054738 | 3300044658 | Bacteria | 1919 |
| 478 | Ga0466965_0006009 | 3300044683 | Bacteria | 5485 |
| 479 | Ga0466965_0093831 | 3300044683 | Bacteria | 1529 |
| 480 | Ga0466965_0150119 | 3300044683 | Bacteria | 1218 |
| 481 | Ga0466966_0029976 | 3300044684 | Bacteria | 3537 |
| 482 | Ga0466957_0052609 | 3300044842 | Bacteria | 2480 |
| 483 | Ga0466959_0273361 | 3300045049 | Bacteria | 1161 |
| 484 | Ga0466967_0139821 | 3300045976 | Bacteria | 2254 |
| 485 | Ga0495592_0009766 | 3300046454 | Bacteria | 7223 |
| 486 | Ga0495629_0026455 | 3300046459 | Bacteria | 4121 |
| 487 | Ga0495638_0029205 | 3300046460 | Bacteria | 3556 |
| 488 | Ga0495651_0026102 | 3300046462 | Bacteria | 4549 |
| 489 | Ga0495616_0010064 | 3300046513 | Bacteria | 5487 |
| 490 | Ga0495620_0053995 | 3300046515 | Bacteria | 1699 |
| 491 | Ga0495630_0093704 | 3300046517 | Bacteria | 2270 |
| 492 | Ga0495631_0000088 | 3300046518 | Bacteria | 59630 |
| 493 | Ga0495631_0056712 | 3300046518 | Bacteria | 1706 |
| 494 | Ga0495632_0023965 | 3300046519 | Bacteria | 3250 |
| 495 | Ga0495632_0027467 | 3300046519 | Bacteria | 2981 |
| 496 | Ga0495637_0003001 | 3300046520 | Bacteria | 9055 |
| 497 | Ga0495621_0043897 | 3300046539 | Bacteria | 1578 |
| 498 | Ga0495597_0039461 | 3300046542 | Bacteria | 2114 |
| 499 | Ga0495597_0044840 | 3300046542 | Bacteria | 1965 |
| 500 | Ga0495656_0000106 | 3300046615 | Bacteria | 34172 |
| 501 | Ga0495668_0099156 | 3300046616 | Bacteria | 1594 |
| 502 | Ga0495625_0002306 | 3300046660 | Bacteria | 20876 |
| 503 | Ga0495625_0078708 | 3300046660 | Bacteria | 2301 |
| 504 | Ga0495646_0098379 | 3300046680 | Bacteria | 1680 |
| 505 | Ga0495647_0042133 | 3300046681 | Bacteria | 1742 |
| 506 | Ga0495649_0017929 | 3300046694 | Bacteria | 3989 |
| 507 | Ga0495660_0067142 | 3300046810 | Bacteria | 1911 |
| 508 | Ga0495676_0002416 | 3300047321 | Bacteria | 16576 |
| 509 | Ga0495687_000685 | 3300047443 | Bacteria | 38430 |
| 510 | Ga0495687_006026 | 3300047443 | Bacteria | 7555 |
| 511 | Ga0495687_010622 | 3300047443 | Bacteria | 5036 |
| 512 | Ga0495593_0007745 | 3300047673 | Bacteria | 6262 |
| 513 | Ga0495602_0224877 | 3300048088 | Bacteria | 1414 |
| 514 | Ga0495614_0001061 | 3300048089 | Bacteria | 11765 |
| 515 | Ga0495626_0123573 | 3300048091 | Bacteria | 1110 |
| 516 | Ga0496101_0086446 | 3300048904 | Bacteria | 2325 |
| 517 | Ga0496101_0104298 | 3300048904 | Bacteria | 2126 |
| 518 | Ga0496102_0062097 | 3300048905 | Bacteria | 3421 |
| 519 | Ga0496102_0159067 | 3300048905 | Bacteria | 2124 |
| 520 | Ga0496104_0390720 | 3300048907 | Bacteria | 1303 |
| 521 | Ga0496105_0129684 | 3300048908 | Bacteria | 2079 |
| 522 | Ga0496105_0512043 | 3300048908 | Bacteria | 941 |
| 523 | Ga0496110_0555823 | 3300048913 | Bacteria | 1043 |
| 524 | Ga0496114_0061620 | 3300048917 | Bacteria | 3138 |
| 525 | Ga0496114_0063490 | 3300048917 | Bacteria | 3092 |
| 526 | Ga0496117_0011528 | 3300048920 | Bacteria | 7910 |
| 527 | Ga0496117_0112727 | 3300048920 | Bacteria | 1690 |
| 528 | Ga0496117_0161533 | 3300048920 | Bacteria | 1312 |
| 529 | Ga0496118_0014670 | 3300048921 | Bacteria | 7323 |
| 530 | Ga0496118_0034068 | 3300048921 | Bacteria | 4164 |
| 531 | Ga0496121_0036930 | 3300048924 | Bacteria | 4346 |
| 532 | Ga0496121_0135167 | 3300048924 | Bacteria | 1838 |
| 533 | Ga0496122_0000528 | 3300048925 | Bacteria | 79201 |
| 534 | Ga0496122_0125482 | 3300048925 | Bacteria | 1644 |
| 535 | Ga0496123_0000308 | 3300048926 | Bacteria | 94712 |
| 536 | Ga0496123_0016199 | 3300048926 | Bacteria | 6069 |
| 537 | Ga0496123_0097867 | 3300048926 | Bacteria | 1717 |
| 538 | Ga0496124_0053577 | 3300048927 | Bacteria | 3418 |
| 539 | Ga0496124_0088713 | 3300048927 | Bacteria | 2527 |
| 540 | Ga0496124_0137637 | 3300048927 | Bacteria | 1931 |
| 541 | Ga0496125_0004247 | 3300048928 | Bacteria | 16695 |
| 542 | Ga0496125_0028035 | 3300048928 | Bacteria | 5093 |
| 543 | Ga0496125_0029090 | 3300048928 | Bacteria | 4973 |
| 544 | Ga0496125_0160881 | 3300048928 | Bacteria | 1525 |
| 545 | Ga0496125_0163199 | 3300048928 | Bacteria | 1510 |
| 546 | Ga0496125_0195810 | 3300048928 | Bacteria | 1329 |
| 547 | Ga0501303_002153 | 3300049526 | Bacteria | 1505 |
| 548 | Ga0501033_0010954 | 3300049570 | Bacteria | 6950 |
| 549 | Ga0501034_0044857 | 3300049571 | Bacteria | 4469 |
| 550 | Ga0501036_0013718 | 3300049572 | Bacteria | 6738 |
| 551 | Ga0501038_0004011 | 3300049574 | Bacteria | 13676 |
| 552 | Ga0501038_0032296 | 3300049574 | Bacteria | 4620 |
| 553 | Ga0501039_0034867 | 3300049575 | Bacteria | 3883 |
| 554 | Ga0501039_0057504 | 3300049575 | Bacteria | 3011 |
| 555 | Ga0501040_0000158 | 3300049576 | Bacteria | 37510 |
| 556 | Ga0501040_0003761 | 3300049576 | Bacteria | 9837 |
| 557 | Ga0501041_0000402 | 3300049577 | Bacteria | 21806 |
| 558 | Ga0501041_0001759 | 3300049577 | Bacteria | 12153 |
| 559 | Ga0501041_0161340 | 3300049577 | Bacteria | 1402 |
| 560 | Ga0501042_0006708 | 3300049578 | Bacteria | 7502 |
| 561 | Ga0501042_0037523 | 3300049578 | Bacteria | 3439 |
| 562 | Ga0501043_0000052 | 3300049579 | Bacteria | 106686 |
| 563 | Ga0501043_0011563 | 3300049579 | Bacteria | 6906 |
| 564 | Ga0501046_0000423 | 3300049580 | Bacteria | 42227 |
| 565 | Ga0501046_0002696 | 3300049580 | Bacteria | 16522 |
| 566 | Ga0501046_0019371 | 3300049580 | Bacteria | 5646 |
| 567 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 568 | Ga0501048_0005001 | 3300049582 | Bacteria | 10109 |
| 569 | Ga0501048_0006812 | 3300049582 | Bacteria | 8678 |
| 570 | Ga0501067_0063540 | 3300049583 | Bacteria | 2044 |
| 571 | Ga0501070_0131858 | 3300049586 | Bacteria | 2064 |
| 572 | Ga0501071_0001483 | 3300049587 | Bacteria | 13639 |
| 573 | Ga0501071_0031190 | 3300049587 | Bacteria | 3776 |
| 574 | Ga0501071_0231713 | 3300049587 | Bacteria | 1391 |
| 575 | Ga0501072_0001081 | 3300049588 | Bacteria | 20222 |
| 576 | Ga0501072_0005126 | 3300049588 | Bacteria | 9964 |
| 577 | Ga0501072_0054663 | 3300049588 | Bacteria | 3146 |
| 578 | Ga0501072_0096577 | 3300049588 | Bacteria | 2348 |
| 579 | Ga0501073_0270013 | 3300049589 | Bacteria | 1174 |
| 580 | Ga0501074_0006814 | 3300049590 | Bacteria | 8253 |
| 581 | Ga0501075_0000114 | 3300049591 | Bacteria | 38676 |
| 582 | Ga0501075_0061859 | 3300049591 | Bacteria | 2821 |
| 583 | Ga0501076_0000382 | 3300049592 | Bacteria | 27649 |
| 584 | Ga0501076_0001519 | 3300049592 | Bacteria | 15560 |
| 585 | Ga0501077_0000229 | 3300049593 | Bacteria | 33036 |
| 586 | Ga0501077_0089535 | 3300049593 | Bacteria | 1950 |
| 587 | Ga0501077_0189384 | 3300049593 | Bacteria | 1307 |
| 588 | Ga0501257_021486 | 3300049686 | Bacteria | 1522 |
| 589 | Ga0501225_0021786 | 3300049705 | Bacteria | 1769 |
| 590 | Ga0501079_0000666 | 3300049741 | Bacteria | 23023 |
| 591 | Ga0501079_0005639 | 3300049741 | Bacteria | 9343 |
| 592 | Ga0501080_0019726 | 3300049742 | Bacteria | 6243 |
| 593 | Ga0501080_0023073 | 3300049742 | Bacteria | 5770 |
| 594 | Ga0501081_0000108 | 3300049743 | Bacteria | 35118 |
| 595 | Ga0501081_0006217 | 3300049743 | Bacteria | 7739 |
| 596 | Ga0501081_0068580 | 3300049743 | Bacteria | 2469 |
| 597 | Ga0501035_0006648 | 3300049822 | Bacteria | 10817 |
| 598 | Ga0501035_0009909 | 3300049822 | Bacteria | 8846 |
| 599 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 600 | Ga0501045_0011185 | 3300049824 | Bacteria | 6292 |
| 601 | Ga0501045_0017400 | 3300049824 | Bacteria | 5103 |
| 602 | Ga0501045_0020888 | 3300049824 | Bacteria | 4681 |
| 603 | nmdc:mga03683_38495_c1 | 3300050489 | Bacteria | 1953 |
| 604 | nmdc:mga03683_48280_c1 | 3300050489 | Bacteria | 1769 |
| 605 | nmdc:mga03683_4879_c1 | 3300050489 | Bacteria | 4478 |
| 606 | nmdc:mga03n38_10621_c1 | 3300050490 | Bacteria | 3397 |
| 607 | nmdc:mga00v17_13154_c1 | 3300050491 | Bacteria | 4586 |
| 608 | nmdc:mga00v17_230306_c1 | 3300050491 | Bacteria | 1200 |
| 609 | nmdc:mga0yw44_10570_c1 | 3300050492 | Bacteria | 4722 |
| 610 | nmdc:mga0k408_10224_c1 | 3300050493 | Bacteria | 5073 |
| 611 | nmdc:mga0k408_112905_c1 | 3300050493 | Bacteria | 1607 |
| 612 | nmdc:mga0k408_27283_c1 | 3300050493 | Bacteria | 3243 |
| 613 | nmdc:mga0k408_60457_c1 | 3300050493 | Bacteria | 2202 |
| 614 | nmdc:mga0k408_98948_c1 | 3300050493 | Bacteria | 1719 |
| 615 | nmdc:mga06z11_68112_c1 | 3300050494 | Bacteria | 1875 |
| 616 | nmdc:mga06z11_7262_c1 | 3300050494 | Bacteria | 4548 |
| 617 | nmdc:mga04h51_5261_c1 | 3300050495 | Bacteria | 3288 |
| 618 | nmdc:mga04h51_63068_c1 | 3300050495 | Bacteria | 1275 |
| 619 | nmdc:mga07m45_12052_c1 | 3300050496 | Bacteria | 4560 |
| 620 | nmdc:mga07m45_24438_c1 | 3300050496 | Bacteria | 3310 |
| 621 | nmdc:mga07m45_2773_c1 | 3300050496 | Bacteria | 8276 |
| 622 | nmdc:mga07m45_3471_c1 | 3300050496 | Bacteria | 7601 |
| 623 | nmdc:mga07m45_54_c1 | 3300050496 | Bacteria | 49018 |
| 624 | nmdc:mga07m45_71780_c1 | 3300050496 | Bacteria | 1970 |
| 625 | nmdc:mga07m45_7379_c1 | 3300050496 | Bacteria | 5616 |
| 626 | nmdc:mga07m45_8551_c1 | 3300050496 | Bacteria | 5268 |
| 627 | nmdc:mga09592_59_c1 | 3300050508 | Bacteria | 60821 |
| 628 | nmdc:mga0qj67_38522_c1 | 3300050509 | Bacteria | 3751 |
| 629 | nmdc:mga06r32_296677_c1 | 3300050510 | Bacteria | 1603 |
| 630 | nmdc:mga06r32_77902_c1 | 3300050510 | Bacteria | 3221 |
| 631 | nmdc:mga08x19_3928_c1 | 3300050514 | Bacteria | 8852 |
| 632 | Ga0495601_0041396 | 3300053077 | Bacteria | 2888 |
| 633 | Ga0500610_0002813 | 3300053079 | Bacteria | 6526 |
| 634 | Ga0500610_0004548 | 3300053079 | Bacteria | 5532 |
| 635 | Ga0500610_0013844 | 3300053079 | Bacteria | 3767 |
| 636 | Ga0500643_009215 | 3300053087 | Bacteria | 3790 |
| 637 | Ga0500644_0017691 | 3300053088 | Bacteria | 2075 |
| 638 | Ga0500651_0000056 | 3300053093 | Bacteria | 72712 |
| 639 | Ga0500566_0017204 | 3300053094 | Bacteria | 4245 |
| 640 | Ga0500571_000344 | 3300053110 | Bacteria | 18321 |
| 641 | Ga0500593_002457 | 3300053117 | Bacteria | 6800 |
| 642 | Ga0500594_0002730 | 3300053118 | Bacteria | 3845 |
| 643 | Ga0500594_0013231 | 3300053118 | Bacteria | 1958 |
| 644 | Ga0500607_001013 | 3300053121 | Bacteria | 26660 |
| 645 | Ga0500608_010021 | 3300053122 | Bacteria | 4052 |
| 646 | Ga0500608_030956 | 3300053122 | Bacteria | 2538 |
| 647 | Ga0500626_022077 | 3300053128 | Bacteria | 2843 |
| 648 | Ga0500655_000657 | 3300053133 | Bacteria | 6875 |
| 649 | Ga0500658_0000487 | 3300053134 | Bacteria | 16958 |
| 650 | Ga0500658_0000584 | 3300053134 | Bacteria | 15340 |
| 651 | Ga0500559_0000134 | 3300053136 | Bacteria | 56963 |
| 652 | Ga0500559_0006783 | 3300053136 | Bacteria | 5139 |
| 653 | Ga0500564_006905 | 3300053138 | Bacteria | 4777 |
| 654 | Ga0500619_026564 | 3300053154 | Bacteria | 1725 |
| 655 | Ga0500622_0006815 | 3300053156 | Bacteria | 6570 |
| 656 | Ga0500627_0000353 | 3300053158 | Bacteria | 12475 |
| 657 | Ga0500634_0026423 | 3300053161 | Bacteria | 3162 |
| 658 | Ga0500638_014624 | 3300053162 | Bacteria | 3584 |
| 659 | Ga0500636_0036388 | 3300053177 | Bacteria | 2914 |
| 660 | Ga0500645_051805 | 3300053730 | Bacteria | 1197 |
| 661 | Ga0500596_007015 | 3300053735 | Bacteria | 1867 |
| 662 | Ga0501084_0006785 | 3300054114 | Bacteria | 9412 |
| 663 | Ga0501084_0047654 | 3300054114 | Bacteria | 3589 |
| 664 | Ga0501084_0189765 | 3300054114 | Bacteria | 1734 |
| 665 | Ga0501082_0009902 | 3300060353 | Bacteria | 8215 |
| 666 | Ga0501082_0013762 | 3300060353 | Bacteria | 6955 |
| 667 | Ga0501082_0153045 | 3300060353 | Bacteria | 2004 |
| 668 | Ga0530510_0000606 | 3300061734 | Bacteria | 23066 |
| 669 | Ga0530510_0002478 | 3300061734 | Bacteria | 12674 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_10057881 | Ga0207702_100578812 | 293 |
| 2 | 3300046519 | Ga0495632_0027467 | Ga0495632_0027467_1231_2190 | 293 |
| 3 | 3300005355 | Ga0070671_100019600 | Ga0070671_1000196002 | 294 |
| 4 | 3300045976 | Ga0466967_0139821 | Ga0466967_0139821_1108_2070 | 295 |
| 5 | 3300046518 | Ga0495631_0056712 | Ga0495631_0056712_803_1690 | 295 |
| 6 | 3300048907 | Ga0496104_0390720 | Ga0496104_0390720_20_973 | 295 |
| 7 | 3300006914 | Ga0075436_100009711 | Ga0075436_1000097112 | 297 |
| 8 | 3300050514 | nmdc:mga08x19_3928_c1 | nmdc:mga08x19_3928_c1_6246_7205 | 297 |
| 9 | 3300005329 | Ga0070683_100044470 | Ga0070683_1000444704 | 298 |
| 10 | 3300005330 | Ga0070690_100013882 | Ga0070690_1000138823 | 298 |
| 11 | 3300005535 | Ga0070684_100014195 | Ga0070684_1000141953 | 298 |
| 12 | 3300005544 | Ga0070686_100015078 | Ga0070686_1000150784 | 298 |
| 13 | 3300006237 | Ga0097621_100011749 | Ga0097621_1000117494 | 298 |
| 14 | 3300009177 | Ga0105248_10205018 | Ga0105248_102050182 | 298 |
| 15 | 3300014969 | Ga0157376_10119404 | Ga0157376_101194042 | 298 |
| 16 | 3300032126 | Ga0307415_100003121 | Ga0307415_1000031212 | 298 |
| 17 | 3300034957 | Ga0373938_0007684 | Ga0373938_0007684_172_1110 | 298 |
| 18 | 3300025901 | Ga0207688_10075285 | Ga0207688_100752852 | 299 |
| 19 | 3300005518 | Ga0070699_100059744 | Ga0070699_1000597443 | 300 |
| 20 | 3300025945 | Ga0207679_10036634 | Ga0207679_100366342 | 300 |
| 21 | 3300042532 | Ga0450893_0024001 | Ga0450893_0024001_150_1052 | 300 |
| 22 | 3300009098 | Ga0105245_10436644 | Ga0105245_104366441 | 301 |
| 23 | 3300035170 | Ga0373943_0025212 | Ga0373943_0025212_1107_2093 | 301 |
| 24 | 3300049588 | Ga0501072_0096577 | Ga0501072_0096577_692_1651 | 301 |
| 25 | 3300054114 | Ga0501084_0189765 | Ga0501084_0189765_465_1424 | 301 |
| 26 | 3300060353 | Ga0501082_0153045 | Ga0501082_0153045_186_1145 | 301 |
| 27 | 3300009094 | Ga0111539_10405974 | Ga0111539_104059742 | 302 |
| 28 | 3300048908 | Ga0496105_0512043 | Ga0496105_0512043_21_929 | 302 |
| 29 | 3300028794 | Ga0307515_10034279 | Ga0307515_100342791 | 303 |
| 30 | 3300003322 | rootL2_10051089 | rootL2_100510894 | 307 |
| 31 | 3300006846 | Ga0075430_100001924 | Ga0075430_1000019245 | 308 |
| 32 | 3300006847 | Ga0075431_100245020 | Ga0075431_1002450202 | 308 |
| 33 | 3300031507 | Ga0307509_10219003 | Ga0307509_102190031 | 308 |
| 34 | 3300048925 | Ga0496122_0000528 | Ga0496122_0000528_41556_42566 | 308 |
| 35 | 3300048926 | Ga0496123_0000308 | Ga0496123_0000308_12250_13260 | 308 |
| 36 | 3300005985 | Ga0081539_10000233 | Ga0081539_1000023341 | 310 |
| 37 | 3300025931 | Ga0207644_10013153 | Ga0207644_100131532 | 310 |
| 38 | 3300044683 | Ga0466965_0150119 | Ga0466965_0150119_205_1161 | 310 |
| 39 | 3300048904 | Ga0496101_0086446 | Ga0496101_0086446_178_1176 | 310 |
| 40 | 3300048908 | Ga0496105_0129684 | Ga0496105_0129684_681_1679 | 310 |
| 41 | 3300048917 | Ga0496114_0063490 | Ga0496114_0063490_1641_2639 | 310 |
| 42 | 3300003187 | JGI25151J46595_10001895 | JGI25151J46595_1000189511 | 311 |
| 43 | 3300025294 | Ga0209025_1000103 | Ga0209025_1000103157 | 311 |
| 44 | 3300050493 | nmdc:mga0k408_27283_c1 | nmdc:mga0k408_27283_c1_1736_2674 | 312 |
| 45 | 3300050496 | nmdc:mga07m45_54_c1 | nmdc:mga07m45_54_c1_33948_34886 | 312 |
| 46 | 3300048917 | Ga0496114_0061620 | Ga0496114_0061620_269_1288 | 313 |
| 47 | 3300006195 | Ga0075366_10050650 | Ga0075366_100506503 | 314 |
| 48 | 3300025931 | Ga0207644_10168745 | Ga0207644_101687452 | 314 |
| 49 | 3300050496 | nmdc:mga07m45_71780_c1 | nmdc:mga07m45_71780_c1_100_1125 | 314 |
| 50 | 3300036401 | Ga0373937_0133815 | Ga0373937_0133815_1064_2050 | 315 |
| 51 | 3300046459 | Ga0495629_0026455 | Ga0495629_0026455_439_1425 | 315 |
| 52 | 3300046681 | Ga0495647_0042133 | Ga0495647_0042133_687_1673 | 315 |
| 53 | 3300053077 | Ga0495601_0041396 | Ga0495601_0041396_464_1450 | 315 |
| 54 | 3300032002 | Ga0307416_100125974 | Ga0307416_1001259742 | 316 |
| 55 | 3300049526 | Ga0501303_002153 | Ga0501303_002153_119_1117 | 316 |
| 56 | 3300049686 | Ga0501257_021486 | Ga0501257_021486_192_1190 | 316 |
| 57 | 3300005327 | Ga0070658_10025112 | Ga0070658_100251122 | 317 |
| 58 | 3300005329 | Ga0070683_100026669 | Ga0070683_1000266693 | 317 |
| 59 | 3300005344 | Ga0070661_100062601 | Ga0070661_1000626011 | 317 |
| 60 | 3300005535 | Ga0070684_100011605 | Ga0070684_1000116052 | 317 |
| 61 | 3300005539 | Ga0068853_100256398 | Ga0068853_1002563982 | 317 |
| 62 | 3300005547 | Ga0070693_100017897 | Ga0070693_1000178973 | 317 |
| 63 | 3300005548 | Ga0070665_100011217 | Ga0070665_1000112174 | 317 |
| 64 | 3300005577 | Ga0068857_100145308 | Ga0068857_1001453082 | 317 |
| 65 | 3300009174 | Ga0105241_10083373 | Ga0105241_100833732 | 317 |
| 66 | 3300009177 | Ga0105248_10337097 | Ga0105248_103370972 | 317 |
| 67 | 3300013100 | Ga0157373_10007987 | Ga0157373_100079873 | 317 |
| 68 | 3300013104 | Ga0157370_10004758 | Ga0157370_100047585 | 317 |
| 69 | 3300013105 | Ga0157369_10021810 | Ga0157369_100218103 | 317 |
| 70 | 3300013296 | Ga0157374_10051039 | Ga0157374_100510392 | 317 |
| 71 | 3300013297 | Ga0157378_10094159 | Ga0157378_100941593 | 317 |
| 72 | 3300013307 | Ga0157372_10116622 | Ga0157372_101166222 | 317 |
| 73 | 3300026116 | Ga0207674_10152689 | Ga0207674_101526893 | 317 |
| 74 | 3300028379 | Ga0268266_10013898 | Ga0268266_100138982 | 317 |
| 75 | 3300041406 | Ga0439439_0001203 | Ga0439439_0001203_626_1579 | 317 |
| 76 | 3300041999 | Ga0439433_0021321 | Ga0439433_0021321_477_1430 | 317 |
| 77 | 3300042006 | Ga0439432_063073 | Ga0439432_063073_37_990 | 317 |
| 78 | 3300042123 | Ga0450921_003496 | Ga0450921_003496_110_1063 | 317 |
| 79 | 3300042439 | Ga0439464_0011345 | Ga0439464_0011345_98_1051 | 317 |
| 80 | 3300046615 | Ga0495656_0000106 | Ga0495656_0000106_22090_23043 | 317 |
| 81 | 3300046680 | Ga0495646_0098379 | Ga0495646_0098379_46_999 | 317 |
| 82 | 3300048913 | Ga0496110_0555823 | Ga0496110_0555823_42_995 | 317 |
| 83 | 3300049571 | Ga0501034_0044857 | Ga0501034_0044857_806_1759 | 317 |
| 84 | 3300053088 | Ga0500644_0017691 | Ga0500644_0017691_889_1902 | 317 |
| 85 | 3300053156 | Ga0500622_0006815 | Ga0500622_0006815_3722_4735 | 317 |
| 86 | 3300005341 | Ga0070691_10020416 | Ga0070691_100204164 | 318 |
| 87 | 3300005437 | Ga0070710_10251981 | Ga0070710_102519811 | 318 |
| 88 | 3300005444 | Ga0070694_100132862 | Ga0070694_1001328622 | 318 |
| 89 | 3300005458 | Ga0070681_10000175 | Ga0070681_1000017527 | 318 |
| 90 | 3300005471 | Ga0070698_100270777 | Ga0070698_1002707772 | 318 |
| 91 | 3300005530 | Ga0070679_100050863 | Ga0070679_1000508634 | 318 |
| 92 | 3300005544 | Ga0070686_100083439 | Ga0070686_1000834392 | 318 |
| 93 | 3300005546 | Ga0070696_100061847 | Ga0070696_1000618472 | 318 |
| 94 | 3300005546 | Ga0070696_100160656 | Ga0070696_1001606562 | 318 |
| 95 | 3300025912 | Ga0207707_10000660 | Ga0207707_100006608 | 318 |
| 96 | 3300025921 | Ga0207652_10060917 | Ga0207652_100609172 | 318 |
| 97 | 3300031251 | Ga0265327_10000806 | Ga0265327_100008063 | 318 |
| 98 | 3300032002 | Ga0307416_100055750 | Ga0307416_1000557504 | 318 |
| 99 | 3300032002 | Ga0307416_100073436 | Ga0307416_1000734364 | 318 |
| 100 | 3300034817 | Ga0373948_0022584 | Ga0373948_0022584_47_1003 | 318 |
| 101 | 3300035121 | Ga0373960_0035775 | Ga0373960_0035775_206_1162 | 318 |
| 102 | 3300044683 | Ga0466965_0006009 | Ga0466965_0006009_3317_4321 | 318 |
| 103 | 3300048928 | Ga0496125_0004247 | Ga0496125_0004247_9784_10839 | 318 |
| 104 | 3300049583 | Ga0501067_0063540 | Ga0501067_0063540_737_1693 | 318 |
| 105 | 3300050509 | nmdc:mga0qj67_38522_c1 | nmdc:mga0qj67_38522_c1_552_1508 | 318 |
| 106 | 3300050510 | nmdc:mga06r32_296677_c1 | nmdc:mga06r32_296677_c1_27_983 | 318 |
| 107 | 3300053118 | Ga0500594_0013231 | Ga0500594_0013231_867_1883 | 318 |
| 108 | 3300046542 | Ga0495597_0039461 | Ga0495597_0039461_228_1214 | 319 |
| 109 | 3300046542 | Ga0495597_0044840 | Ga0495597_0044840_357_1316 | 319 |
| 110 | 3300047443 | Ga0495687_000685 | Ga0495687_000685_30627_31613 | 319 |
| 111 | 3300031507 | Ga0307509_10025821 | Ga0307509_100258213 | 321 |
| 112 | 3300005438 | Ga0070701_10168430 | Ga0070701_101684302 | 322 |
| 113 | 3300005459 | Ga0068867_100178470 | Ga0068867_1001784702 | 322 |
| 114 | 3300005539 | Ga0068853_100206188 | Ga0068853_1002061882 | 322 |
| 115 | 3300005543 | Ga0070672_100251445 | Ga0070672_1002514452 | 322 |
| 116 | 3300005547 | Ga0070693_100175929 | Ga0070693_1001759291 | 322 |
| 117 | 3300005617 | Ga0068859_100119353 | Ga0068859_1001193532 | 322 |
| 118 | 3300005842 | Ga0068858_100026462 | Ga0068858_1000264622 | 322 |
| 119 | 3300005843 | Ga0068860_100007838 | Ga0068860_1000078382 | 322 |
| 120 | 3300006931 | Ga0097620_100119344 | Ga0097620_1001193442 | 322 |
| 121 | 3300013308 | Ga0157375_10251976 | Ga0157375_102519762 | 322 |
| 122 | 3300014326 | Ga0157380_10068813 | Ga0157380_100688132 | 322 |
| 123 | 3300014968 | Ga0157379_10069093 | Ga0157379_100690932 | 322 |
| 124 | 3300028381 | Ga0268264_10045871 | Ga0268264_100458713 | 322 |
| 125 | 3300046660 | Ga0495625_0078708 | Ga0495625_0078708_257_1234 | 322 |
| 126 | 3300006186 | Ga0075369_10025866 | Ga0075369_100258662 | 323 |
| 127 | 3300006195 | Ga0075366_10020508 | Ga0075366_100205084 | 323 |
| 128 | 3300006353 | Ga0075370_10007645 | Ga0075370_100076452 | 323 |
| 129 | 3300031616 | Ga0307508_10126918 | Ga0307508_101269182 | 323 |
| 130 | 3300050489 | nmdc:mga03683_48280_c1 | nmdc:mga03683_48280_c1_316_1287 | 323 |
| 131 | 3300050495 | nmdc:mga04h51_5261_c1 | nmdc:mga04h51_5261_c1_2060_3031 | 323 |
| 132 | 3300005471 | Ga0070698_100058761 | Ga0070698_1000587612 | 324 |
| 133 | 3300006358 | Ga0068871_100478267 | Ga0068871_1004782671 | 324 |
| 134 | 3300006844 | Ga0075428_100018493 | Ga0075428_1000184932 | 324 |
| 135 | 3300006847 | Ga0075431_100000645 | Ga0075431_10000064525 | 324 |
| 136 | 3300006880 | Ga0075429_100000476 | Ga0075429_10000047621 | 324 |
| 137 | 3300009094 | Ga0111539_10498442 | Ga0111539_104984422 | 324 |
| 138 | 3300009147 | Ga0114129_10002793 | Ga0114129_100027932 | 324 |
| 139 | 3300009148 | Ga0105243_10386886 | Ga0105243_103868862 | 324 |
| 140 | 3300025304 | Ga0209257_1037010 | Ga0209257_10370102 | 324 |
| 141 | 3300036401 | Ga0373937_0367515 | Ga0373937_0367515_271_1254 | 324 |
| 142 | 3300050508 | nmdc:mga09592_59_c1 | nmdc:mga09592_59_c1_50824_51807 | 324 |
| 143 | 3300050510 | nmdc:mga06r32_77902_c1 | nmdc:mga06r32_77902_c1_704_1687 | 324 |
| 144 | iso_pu_bacteria | 2895511927 | 2895516557 | 324 |
| 145 | 3300031548 | Ga0307408_100205828 | Ga0307408_1002058282 | 325 |
| 146 | 3300049574 | Ga0501038_0032296 | Ga0501038_0032296_1370_2347 | 325 |
| 147 | 3300049575 | Ga0501039_0034867 | Ga0501039_0034867_1313_2290 | 325 |
| 148 | 3300049576 | Ga0501040_0003761 | Ga0501040_0003761_1030_2007 | 325 |
| 149 | 3300049577 | Ga0501041_0001759 | Ga0501041_0001759_2811_3788 | 325 |
| 150 | 3300049578 | Ga0501042_0037523 | Ga0501042_0037523_1903_2880 | 325 |
| 151 | 3300049580 | Ga0501046_0019371 | Ga0501046_0019371_1972_2949 | 325 |
| 152 | 3300049587 | Ga0501071_0031190 | Ga0501071_0031190_2195_3172 | 325 |
| 153 | 3300049588 | Ga0501072_0005126 | Ga0501072_0005126_1917_2894 | 325 |
| 154 | 3300049591 | Ga0501075_0061859 | Ga0501075_0061859_275_1252 | 325 |
| 155 | 3300049592 | Ga0501076_0001519 | Ga0501076_0001519_9618_10595 | 325 |
| 156 | 3300049593 | Ga0501077_0089535 | Ga0501077_0089535_546_1523 | 325 |
| 157 | 3300049593 | Ga0501077_0189384 | Ga0501077_0189384_220_1197 | 325 |
| 158 | 3300049741 | Ga0501079_0005639 | Ga0501079_0005639_399_1376 | 325 |
| 159 | 3300049742 | Ga0501080_0023073 | Ga0501080_0023073_2146_3123 | 325 |
| 160 | 3300049743 | Ga0501081_0006217 | Ga0501081_0006217_2818_3795 | 325 |
| 161 | 3300049822 | Ga0501035_0006648 | Ga0501035_0006648_9098_10081 | 325 |
| 162 | 3300049822 | Ga0501035_0009909 | Ga0501035_0009909_1856_2839 | 325 |
| 163 | 3300049823 | Ga0501044_0000185 | Ga0501044_0000185_43440_44423 | 325 |
| 164 | 3300049824 | Ga0501045_0020888 | Ga0501045_0020888_3100_4077 | 325 |
| 165 | 3300054114 | Ga0501084_0047654 | Ga0501084_0047654_1603_2580 | 325 |
| 166 | 3300060353 | Ga0501082_0009902 | Ga0501082_0009902_6964_7941 | 325 |
| 167 | 3300061734 | Ga0530510_0000606 | Ga0530510_0000606_18208_19185 | 325 |
| 168 | 3300003763 | Ga0055529_1001127 | Ga0055529_10011277 | 326 |
| 169 | 3300005290 | Ga0065712_10182771 | Ga0065712_101827711 | 326 |
| 170 | 3300005331 | Ga0070670_100005546 | Ga0070670_1000055468 | 326 |
| 171 | 3300005333 | Ga0070677_10003382 | Ga0070677_100033824 | 326 |
| 172 | 3300005338 | Ga0068868_100043119 | Ga0068868_1000431192 | 326 |
| 173 | 3300005354 | Ga0070675_100000635 | Ga0070675_10000063515 | 326 |
| 174 | 3300005355 | Ga0070671_100002597 | Ga0070671_1000025974 | 326 |
| 175 | 3300005356 | Ga0070674_100026543 | Ga0070674_1000265433 | 326 |
| 176 | 3300005364 | Ga0070673_100013219 | Ga0070673_1000132192 | 326 |
| 177 | 3300005367 | Ga0070667_100080705 | Ga0070667_1000807053 | 326 |
| 178 | 3300005459 | Ga0068867_100000428 | Ga0068867_10000042810 | 326 |
| 179 | 3300005543 | Ga0070672_100000188 | Ga0070672_10000018817 | 326 |
| 180 | 3300005564 | Ga0070664_100063811 | Ga0070664_1000638113 | 326 |
| 181 | 3300005618 | Ga0068864_100016644 | Ga0068864_1000166444 | 326 |
| 182 | 3300005719 | Ga0068861_100173692 | Ga0068861_1001736922 | 326 |
| 183 | 3300005840 | Ga0068870_10022385 | Ga0068870_100223853 | 326 |
| 184 | 3300006237 | Ga0097621_100014096 | Ga0097621_1000140964 | 326 |
| 185 | 3300006358 | Ga0068871_100051422 | Ga0068871_1000514223 | 326 |
| 186 | 3300017792 | Ga0163161_10018527 | Ga0163161_100185274 | 326 |
| 187 | 3300025228 | Ga0209672_104501 | Ga0209672_1045012 | 326 |
| 188 | 3300025272 | Ga0209455_1000534 | Ga0209455_100053419 | 326 |
| 189 | 3300025315 | Ga0207697_10040075 | Ga0207697_100400752 | 326 |
| 190 | 3300025908 | Ga0207643_10068410 | Ga0207643_100684102 | 326 |
| 191 | 3300025923 | Ga0207681_10013857 | Ga0207681_100138572 | 326 |
| 192 | 3300025925 | Ga0207650_10000748 | Ga0207650_100007483 | 326 |
| 193 | 3300025926 | Ga0207659_10046168 | Ga0207659_100461682 | 326 |
| 194 | 3300025931 | Ga0207644_10022994 | Ga0207644_100229942 | 326 |
| 195 | 3300025937 | Ga0207669_10012504 | Ga0207669_100125044 | 326 |
| 196 | 3300025940 | Ga0207691_10001187 | Ga0207691_100011876 | 326 |
| 197 | 3300025945 | Ga0207679_10043476 | Ga0207679_100434762 | 326 |
| 198 | 3300025960 | Ga0207651_10007651 | Ga0207651_100076514 | 326 |
| 199 | 3300025986 | Ga0207658_10043181 | Ga0207658_100431812 | 326 |
| 200 | 3300026023 | Ga0207677_10009993 | Ga0207677_100099933 | 326 |
| 201 | 3300026089 | Ga0207648_10001166 | Ga0207648_1000116620 | 326 |
| 202 | 3300026095 | Ga0207676_10045713 | Ga0207676_100457132 | 326 |
| 203 | 3300026118 | Ga0207675_100127126 | Ga0207675_1001271262 | 326 |
| 204 | 3300026121 | Ga0207683_10004545 | Ga0207683_100045452 | 326 |
| 205 | iso_pu_bacteria | 2904449895 | 2904450432 | 326 |
| 206 | iso_pu_bacteria | 2904456579 | 2904456745 | 326 |
| 207 | 3300028794 | Ga0307515_10000424 | Ga0307515_1000042474 | 327 |
| 208 | 3300028794 | Ga0307515_10310832 | Ga0307515_103108321 | 327 |
| 209 | 3300031456 | Ga0307513_10069162 | Ga0307513_100691624 | 327 |
| 210 | 3300033180 | Ga0307510_10161888 | Ga0307510_101618882 | 327 |
| 211 | 3300035398 | Ga0316574_0010549 | Ga0316574_0010549_22_1005 | 327 |
| 212 | iso_pu_bacteria | 2904541872 | 2904544393 | 327 |
| 213 | iso_pu_bacteria | 2929160207 | 2929162036 | 327 |
| 214 | 3300005331 | Ga0070670_100092173 | Ga0070670_1000921731 | 328 |
| 215 | 3300005335 | Ga0070666_10278498 | Ga0070666_102784982 | 328 |
| 216 | 3300005338 | Ga0068868_100126454 | Ga0068868_1001264542 | 328 |
| 217 | 3300005347 | Ga0070668_100256562 | Ga0070668_1002565622 | 328 |
| 218 | 3300005355 | Ga0070671_100022133 | Ga0070671_1000221335 | 328 |
| 219 | 3300005441 | Ga0070700_100090546 | Ga0070700_1000905462 | 328 |
| 220 | 3300005445 | Ga0070708_100296071 | Ga0070708_1002960712 | 328 |
| 221 | 3300005455 | Ga0070663_100064345 | Ga0070663_1000643453 | 328 |
| 222 | 3300005456 | Ga0070678_100347254 | Ga0070678_1003472542 | 328 |
| 223 | 3300005457 | Ga0070662_100094013 | Ga0070662_1000940132 | 328 |
| 224 | 3300005457 | Ga0070662_100397587 | Ga0070662_1003975871 | 328 |
| 225 | 3300005459 | Ga0068867_100003674 | Ga0068867_10000367410 | 328 |
| 226 | 3300005459 | Ga0068867_100408142 | Ga0068867_1004081421 | 328 |
| 227 | 3300005467 | Ga0070706_100001519 | Ga0070706_10000151911 | 328 |
| 228 | 3300005471 | Ga0070698_100076768 | Ga0070698_1000767684 | 328 |
| 229 | 3300005535 | Ga0070684_100039922 | Ga0070684_1000399222 | 328 |
| 230 | 3300005539 | Ga0068853_100503382 | Ga0068853_1005033821 | 328 |
| 231 | 3300005577 | Ga0068857_100245987 | Ga0068857_1002459872 | 328 |
| 232 | 3300005614 | Ga0068856_100083507 | Ga0068856_1000835073 | 328 |
| 233 | 3300005617 | Ga0068859_100038576 | Ga0068859_1000385764 | 328 |
| 234 | 3300005719 | Ga0068861_100003931 | Ga0068861_1000039316 | 328 |
| 235 | 3300005834 | Ga0068851_10054130 | Ga0068851_100541302 | 328 |
| 236 | 3300005842 | Ga0068858_100013451 | Ga0068858_1000134512 | 328 |
| 237 | 3300005843 | Ga0068860_100003712 | Ga0068860_10000371211 | 328 |
| 238 | 3300005844 | Ga0068862_100009256 | Ga0068862_1000092564 | 328 |
| 239 | 3300005844 | Ga0068862_100010258 | Ga0068862_1000102583 | 328 |
| 240 | 3300006038 | Ga0075365_10307452 | Ga0075365_103074521 | 328 |
| 241 | 3300006048 | Ga0075363_100039517 | Ga0075363_1000395172 | 328 |
| 242 | 3300006177 | Ga0075362_10042693 | Ga0075362_100426932 | 328 |
| 243 | 3300006178 | Ga0075367_10009261 | Ga0075367_100092614 | 328 |
| 244 | 3300006195 | Ga0075366_10004246 | Ga0075366_100042462 | 328 |
| 245 | 3300006195 | Ga0075366_10010842 | Ga0075366_100108424 | 328 |
| 246 | 3300006195 | Ga0075366_10025548 | Ga0075366_100255482 | 328 |
| 247 | 3300006353 | Ga0075370_10016681 | Ga0075370_100166813 | 328 |
| 248 | 3300006353 | Ga0075370_10047720 | Ga0075370_100477202 | 328 |
| 249 | 3300006881 | Ga0068865_100000919 | Ga0068865_1000009197 | 328 |
| 250 | 3300006931 | Ga0097620_100038576 | Ga0097620_1000385764 | 328 |
| 251 | 3300009093 | Ga0105240_10077802 | Ga0105240_100778024 | 328 |
| 252 | 3300009093 | Ga0105240_10144453 | Ga0105240_101444533 | 328 |
| 253 | 3300009098 | Ga0105245_10109324 | Ga0105245_101093242 | 328 |
| 254 | 3300009148 | Ga0105243_10086372 | Ga0105243_100863722 | 328 |
| 255 | 3300013105 | Ga0157369_10020698 | Ga0157369_100206982 | 328 |
| 256 | 3300013105 | Ga0157369_10085647 | Ga0157369_100856471 | 328 |
| 257 | 3300013307 | Ga0157372_10009605 | Ga0157372_100096058 | 328 |
| 258 | 3300025321 | Ga0207656_10055860 | Ga0207656_100558602 | 328 |
| 259 | 3300025907 | Ga0207645_10068841 | Ga0207645_100688413 | 328 |
| 260 | 3300025907 | Ga0207645_10098456 | Ga0207645_100984562 | 328 |
| 261 | 3300025910 | Ga0207684_10006075 | Ga0207684_100060754 | 328 |
| 262 | 3300025914 | Ga0207671_10014895 | Ga0207671_100148955 | 328 |
| 263 | 3300025926 | Ga0207659_10371671 | Ga0207659_103716711 | 328 |
| 264 | 3300025931 | Ga0207644_10023506 | Ga0207644_100235064 | 328 |
| 265 | 3300025938 | Ga0207704_10009150 | Ga0207704_100091503 | 328 |
| 266 | 3300025940 | Ga0207691_10092780 | Ga0207691_100927804 | 328 |
| 267 | 3300025942 | Ga0207689_10154801 | Ga0207689_101548012 | 328 |
| 268 | 3300025944 | Ga0207661_10139377 | Ga0207661_101393771 | 328 |
| 269 | 3300026023 | Ga0207677_10100834 | Ga0207677_101008342 | 328 |
| 270 | 3300026035 | Ga0207703_10091068 | Ga0207703_100910682 | 328 |
| 271 | 3300026041 | Ga0207639_10093316 | Ga0207639_100933162 | 328 |
| 272 | 3300026067 | Ga0207678_10064746 | Ga0207678_100647463 | 328 |
| 273 | 3300026075 | Ga0207708_10018408 | Ga0207708_100184082 | 328 |
| 274 | 3300026089 | Ga0207648_10001269 | Ga0207648_1000126921 | 328 |
| 275 | 3300026089 | Ga0207648_10040126 | Ga0207648_100401262 | 328 |
| 276 | 3300026116 | Ga0207674_10025299 | Ga0207674_100252994 | 328 |
| 277 | 3300026118 | Ga0207675_100000838 | Ga0207675_10000083826 | 328 |
| 278 | 3300028380 | Ga0268265_10005821 | Ga0268265_100058218 | 328 |
| 279 | 3300028380 | Ga0268265_10070045 | Ga0268265_100700453 | 328 |
| 280 | 3300028381 | Ga0268264_10014746 | Ga0268264_100147462 | 328 |
| 281 | 3300031730 | Ga0307516_10166543 | Ga0307516_101665431 | 328 |
| 282 | 3300032005 | Ga0307411_10039636 | Ga0307411_100396362 | 328 |
| 283 | 3300035695 | Ga0373927_0047357 | Ga0373927_0047357_712_1698 | 328 |
| 284 | 3300037068 | Ga0373925_0003526 | Ga0373925_0003526_729_1715 | 328 |
| 285 | 3300037312 | Ga0395899_0062951 | Ga0395899_0062951_1345_2334 | 328 |
| 286 | 3300037418 | Ga0395900_0095943 | Ga0395900_0095943_48_1037 | 328 |
| 287 | 3300037466 | Ga0395898_0059152 | Ga0395898_0059152_736_1725 | 328 |
| 288 | 3300044658 | Ga0466972_0054738 | Ga0466972_0054738_669_1655 | 328 |
| 289 | 3300044842 | Ga0466957_0052609 | Ga0466957_0052609_659_1645 | 328 |
| 290 | 3300046517 | Ga0495630_0093704 | Ga0495630_0093704_393_1379 | 328 |
| 291 | 3300046519 | Ga0495632_0023965 | Ga0495632_0023965_1889_2875 | 328 |
| 292 | 3300046694 | Ga0495649_0017929 | Ga0495649_0017929_1567_2553 | 328 |
| 293 | 3300046810 | Ga0495660_0067142 | Ga0495660_0067142_87_1073 | 328 |
| 294 | 3300047443 | Ga0495687_006026 | Ga0495687_006026_1277_2263 | 328 |
| 295 | 3300047443 | Ga0495687_010622 | Ga0495687_010622_2774_3760 | 328 |
| 296 | 3300048091 | Ga0495626_0123573 | Ga0495626_0123573_27_1013 | 328 |
| 297 | 3300049577 | Ga0501041_0161340 | Ga0501041_0161340_111_1112 | 328 |
| 298 | 3300049587 | Ga0501071_0001483 | Ga0501071_0001483_5953_6954 | 328 |
| 299 | 3300049588 | Ga0501072_0054663 | Ga0501072_0054663_919_1920 | 328 |
| 300 | 3300049743 | Ga0501081_0068580 | Ga0501081_0068580_295_1296 | 328 |
| 301 | 3300050493 | nmdc:mga0k408_10224_c1 | nmdc:mga0k408_10224_c1_915_1901 | 328 |
| 302 | 3300050493 | nmdc:mga0k408_112905_c1 | nmdc:mga0k408_112905_c1_493_1479 | 328 |
| 303 | 3300050494 | nmdc:mga06z11_68112_c1 | nmdc:mga06z11_68112_c1_152_1138 | 328 |
| 304 | 3300050494 | nmdc:mga06z11_7262_c1 | nmdc:mga06z11_7262_c1_1122_2108 | 328 |
| 305 | 3300050496 | nmdc:mga07m45_12052_c1 | nmdc:mga07m45_12052_c1_216_1202 | 328 |
| 306 | 3300050496 | nmdc:mga07m45_24438_c1 | nmdc:mga07m45_24438_c1_1291_2277 | 328 |
| 307 | 3300050496 | nmdc:mga07m45_7379_c1 | nmdc:mga07m45_7379_c1_4323_5309 | 328 |
| 308 | 3300053730 | Ga0500645_051805 | Ga0500645_051805_162_1148 | 328 |
| 309 | 3300005354 | Ga0070675_100090507 | Ga0070675_1000905073 | 329 |
| 310 | 3300005456 | Ga0070678_100047822 | Ga0070678_1000478223 | 329 |
| 311 | 3300005543 | Ga0070672_100035212 | Ga0070672_1000352123 | 329 |
| 312 | 3300005617 | Ga0068859_100156473 | Ga0068859_1001564732 | 329 |
| 313 | 3300005618 | Ga0068864_100048182 | Ga0068864_1000481823 | 329 |
| 314 | 3300006195 | Ga0075366_10012754 | Ga0075366_100127542 | 329 |
| 315 | 3300006931 | Ga0097620_100156475 | Ga0097620_1001564752 | 329 |
| 316 | 3300014968 | Ga0157379_10084937 | Ga0157379_100849373 | 329 |
| 317 | 3300025909 | Ga0207705_10012949 | Ga0207705_100129495 | 329 |
| 318 | 3300025925 | Ga0207650_10056300 | Ga0207650_100563003 | 329 |
| 319 | 3300025926 | Ga0207659_10037765 | Ga0207659_100377653 | 329 |
| 320 | 3300026095 | Ga0207676_10007264 | Ga0207676_100072644 | 329 |
| 321 | 3300028786 | Ga0307517_10000196 | Ga0307517_1000019658 | 329 |
| 322 | 3300032002 | Ga0307416_100419473 | Ga0307416_1004194732 | 329 |
| 323 | 3300042876 | Ga0451577_0018204 | Ga0451577_0018204_4666_5658 | 329 |
| 324 | 3300049579 | Ga0501043_0000052 | Ga0501043_0000052_43997_44989 | 329 |
| 325 | 3300049580 | Ga0501046_0002696 | Ga0501046_0002696_1762_2754 | 329 |
| 326 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_7831_8823 | 329 |
| 327 | 3300049582 | Ga0501048_0005001 | Ga0501048_0005001_1559_2551 | 329 |
| 328 | 3300049824 | Ga0501045_0017400 | Ga0501045_0017400_2406_3398 | 329 |
| 329 | 3300050493 | nmdc:mga0k408_60457_c1 | nmdc:mga0k408_60457_c1_1002_1991 | 329 |
| 330 | 3300003792 | Ga0055540_1009576 | Ga0055540_10095764 | 330 |
| 331 | 3300003794 | Ga0055531_10000265 | Ga0055531_1000026548 | 330 |
| 332 | 3300009553 | Ga0105249_10035064 | Ga0105249_100350645 | 330 |
| 333 | 3300009553 | Ga0105249_10134229 | Ga0105249_101342292 | 330 |
| 334 | 3300013297 | Ga0157378_10005326 | Ga0157378_1000532610 | 330 |
| 335 | 3300025303 | Ga0209051_1000252 | Ga0209051_100025216 | 330 |
| 336 | 3300025304 | Ga0209257_1000012 | Ga0209257_100001284 | 330 |
| 337 | 3300028794 | Ga0307515_10000014 | Ga0307515_10000014485 | 330 |
| 338 | 3300037312 | Ga0395899_0002692 | Ga0395899_0002692_2123_3115 | 330 |
| 339 | 3300037418 | Ga0395900_0010858 | Ga0395900_0010858_7937_8929 | 330 |
| 340 | 3300037466 | Ga0395898_0028661 | Ga0395898_0028661_1901_2893 | 330 |
| 341 | 3300037471 | Ga0395905_0107359 | Ga0395905_0107359_239_1231 | 330 |
| 342 | 3300038443 | Ga0395901_0013558 | Ga0395901_0013558_1705_2697 | 330 |
| 343 | 3300044684 | Ga0466966_0029976 | Ga0466966_0029976_2481_3473 | 330 |
| 344 | 3300045049 | Ga0466959_0273361 | Ga0466959_0273361_28_1020 | 330 |
| 345 | 3300053122 | Ga0500608_030956 | Ga0500608_030956_986_1978 | 330 |
| 346 | iso_pu_bacteria | 2513020051 | 2513228214 | 330 |
| 347 | iso_pu_bacteria | 2643221628 | 2644160519 | 330 |
| 348 | iso_pu_bacteria | 2643221658 | 2644324659 | 330 |
| 349 | iso_pu_bacteria | 2643221672 | 2644396523 | 330 |
| 350 | iso_pu_bacteria | 2643221683 | 2644464437 | 330 |
| 351 | iso_pu_bacteria | 2738541307 | 2738881035 | 330 |
| 352 | iso_pu_bacteria | 2885192300 | 2885193703 | 330 |
| 353 | iso_pu_bacteria | 2885198086 | 2885200588 | 330 |
| 354 | iso_pu_bacteria | 2885211737 | 2885214629 | 330 |
| 355 | iso_pu_bacteria | 2928084124 | 2928089345 | 330 |
| 356 | iso_pu_bacteria | 2945909444 | 2945913557 | 330 |
| 357 | iso_pu_bacteria | 2945984333 | 2945991048 | 330 |
| 358 | iso_pu_bacteria | 2954767861 | 2954768525 | 330 |
| 359 | 3300044683 | Ga0466965_0093831 | Ga0466965_0093831_286_1308 | 331 |
| 360 | 3300046462 | Ga0495651_0026102 | Ga0495651_0026102_1022_2020 | 331 |
| 361 | 3300049570 | Ga0501033_0010954 | Ga0501033_0010954_5593_6597 | 331 |
| 362 | 3300049572 | Ga0501036_0013718 | Ga0501036_0013718_5221_6225 | 331 |
| 363 | 3300049574 | Ga0501038_0004011 | Ga0501038_0004011_2075_3079 | 331 |
| 364 | 3300049575 | Ga0501039_0057504 | Ga0501039_0057504_669_1673 | 331 |
| 365 | 3300049576 | Ga0501040_0000158 | Ga0501040_0000158_16313_17317 | 331 |
| 366 | 3300049577 | Ga0501041_0000402 | Ga0501041_0000402_16225_17229 | 331 |
| 367 | 3300049578 | Ga0501042_0006708 | Ga0501042_0006708_5643_6647 | 331 |
| 368 | 3300049579 | Ga0501043_0011563 | Ga0501043_0011563_93_1097 | 331 |
| 369 | 3300049580 | Ga0501046_0000423 | Ga0501046_0000423_12571_13575 | 331 |
| 370 | 3300049582 | Ga0501048_0006812 | Ga0501048_0006812_2201_3205 | 331 |
| 371 | 3300049586 | Ga0501070_0131858 | Ga0501070_0131858_968_1972 | 331 |
| 372 | 3300049587 | Ga0501071_0231713 | Ga0501071_0231713_130_1134 | 331 |
| 373 | 3300049588 | Ga0501072_0001081 | Ga0501072_0001081_17235_18239 | 331 |
| 374 | 3300049589 | Ga0501073_0270013 | Ga0501073_0270013_57_1061 | 331 |
| 375 | 3300049590 | Ga0501074_0006814 | Ga0501074_0006814_449_1453 | 331 |
| 376 | 3300049591 | Ga0501075_0000114 | Ga0501075_0000114_21128_22132 | 331 |
| 377 | 3300049592 | Ga0501076_0000382 | Ga0501076_0000382_5819_6823 | 331 |
| 378 | 3300049593 | Ga0501077_0000229 | Ga0501077_0000229_5183_6187 | 331 |
| 379 | 3300049741 | Ga0501079_0000666 | Ga0501079_0000666_4673_5677 | 331 |
| 380 | 3300049742 | Ga0501080_0019726 | Ga0501080_0019726_5066_6070 | 331 |
| 381 | 3300049743 | Ga0501081_0000108 | Ga0501081_0000108_5255_6259 | 331 |
| 382 | 3300049824 | Ga0501045_0011185 | Ga0501045_0011185_4912_5916 | 331 |
| 383 | 3300054114 | Ga0501084_0006785 | Ga0501084_0006785_2614_3618 | 331 |
| 384 | 3300060353 | Ga0501082_0013762 | Ga0501082_0013762_2296_3300 | 331 |
| 385 | 3300061734 | Ga0530510_0002478 | Ga0530510_0002478_6300_7304 | 331 |
| 386 | iso_pu_bacteria | 2599185214 | 2599626927 | 331 |
| 387 | iso_pu_bacteria | 2599185226 | 2599676173 | 331 |
| 388 | iso_pu_bacteria | 2599185227 | 2599684485 | 331 |
| 389 | iso_pu_bacteria | 2599185229 | 2599696478 | 331 |
| 390 | iso_pu_bacteria | 2818991446 | 2819599454 | 331 |
| 391 | iso_pu_bacteria | 2831265667 | 2831271275 | 331 |
| 392 | iso_pu_bacteria | 2838054893 | 2838055864 | 331 |
| 393 | iso_pu_bacteria | 2842677519 | 2842681986 | 331 |
| 394 | iso_pu_bacteria | 2899924645 | 2899925805 | 331 |
| 395 | iso_pu_bacteria | 2919462493 | 2919463039 | 331 |
| 396 | iso_pu_bacteria | 2928037797 | 2928041807 | 331 |
| 397 | iso_pu_bacteria | 2928044640 | 2928049371 | 331 |
| 398 | iso_pu_bacteria | 2928051484 | 2928051954 | 331 |
| 399 | iso_pu_bacteria | 2928064002 | 2928065354 | 331 |
| 400 | iso_pu_bacteria | 2928070936 | 2928076546 | 331 |
| 401 | iso_pu_bacteria | 2929520902 | 2929521145 | 331 |
| 402 | iso_pu_bacteria | 2945972063 | 2945973212 | 331 |
| 403 | 3300003784 | Ga0055534_1005003 | Ga0055534_10050032 | 332 |
| 404 | 3300005331 | Ga0070670_100027243 | Ga0070670_1000272435 | 332 |
| 405 | 3300005539 | Ga0068853_100089057 | Ga0068853_1000890571 | 332 |
| 406 | 3300005841 | Ga0068863_100246047 | Ga0068863_1002460472 | 332 |
| 407 | 3300006237 | Ga0097621_100029031 | Ga0097621_1000290313 | 332 |
| 408 | 3300013308 | Ga0157375_10049857 | Ga0157375_100498573 | 332 |
| 409 | 3300014969 | Ga0157376_10035508 | Ga0157376_100355082 | 332 |
| 410 | 3300015265 | Ga0182005_1021497 | Ga0182005_10214972 | 332 |
| 411 | 3300025284 | Ga0209130_1002376 | Ga0209130_10023764 | 332 |
| 412 | 3300025291 | Ga0209675_1003630 | Ga0209675_10036304 | 332 |
| 413 | 3300025292 | Ga0209676_1018846 | Ga0209676_10188462 | 332 |
| 414 | 3300026121 | Ga0207683_10026834 | Ga0207683_100268344 | 332 |
| 415 | 3300026121 | Ga0207683_10038469 | Ga0207683_100384695 | 332 |
| 416 | 3300035171 | Ga0373946_0115287 | Ga0373946_0115287_61_1062 | 332 |
| 417 | 3300037471 | Ga0395905_0167594 | Ga0395905_0167594_860_1876 | 332 |
| 418 | 3300038443 | Ga0395901_0419762 | Ga0395901_0419762_138_1154 | 332 |
| 419 | 3300048905 | Ga0496102_0159067 | Ga0496102_0159067_598_1596 | 332 |
| 420 | iso_pu_bacteria | 2738541277 | 2738718977 | 332 |
| 421 | iso_pu_bacteria | 2738543013 | 2739249335 | 332 |
| 422 | iso_pu_bacteria | 2738543019 | 2739281739 | 332 |
| 423 | iso_pu_bacteria | 2842747753 | 2842750837 | 332 |
| 424 | 3300003187 | JGI25151J46595_10000884 | JGI25151J46595_1000088415 | 333 |
| 425 | 3300003187 | JGI25151J46595_10001131 | JGI25151J46595_1000113116 | 333 |
| 426 | 3300005327 | Ga0070658_10074970 | Ga0070658_100749703 | 333 |
| 427 | 3300005844 | Ga0068862_100026748 | Ga0068862_1000267482 | 333 |
| 428 | 3300006048 | Ga0075363_100004888 | Ga0075363_1000048883 | 333 |
| 429 | 3300006048 | Ga0075363_100033782 | Ga0075363_1000337822 | 333 |
| 430 | 3300006051 | Ga0075364_10002462 | Ga0075364_100024624 | 333 |
| 431 | 3300006178 | Ga0075367_10021564 | Ga0075367_100215643 | 333 |
| 432 | 3300006195 | Ga0075366_10017232 | Ga0075366_100172323 | 333 |
| 433 | 3300006195 | Ga0075366_10022934 | Ga0075366_100229343 | 333 |
| 434 | 3300006195 | Ga0075366_10071144 | Ga0075366_100711442 | 333 |
| 435 | 3300006353 | Ga0075370_10045153 | Ga0075370_100451533 | 333 |
| 436 | 3300009148 | Ga0105243_10024964 | Ga0105243_100249642 | 333 |
| 437 | 3300015683 | Ga0183362_10001 | Ga0183362_10001159 | 333 |
| 438 | 3300025258 | Ga0209129_1000415 | Ga0209129_100041533 | 333 |
| 439 | 3300025294 | Ga0209025_1000129 | Ga0209025_1000129141 | 333 |
| 440 | 3300025909 | Ga0207705_10105784 | Ga0207705_101057842 | 333 |
| 441 | 3300025935 | Ga0207709_10009694 | Ga0207709_100096942 | 333 |
| 442 | 3300026089 | Ga0207648_10399206 | Ga0207648_103992061 | 333 |
| 443 | 3300027866 | Ga0209813_10054337 | Ga0209813_100543372 | 333 |
| 444 | 3300027907 | Ga0207428_10137288 | Ga0207428_101372882 | 333 |
| 445 | 3300031731 | Ga0307405_10007635 | Ga0307405_100076352 | 333 |
| 446 | 3300031901 | Ga0307406_10334179 | Ga0307406_103341792 | 333 |
| 447 | 3300031911 | Ga0307412_10054656 | Ga0307412_100546562 | 333 |
| 448 | 3300032126 | Ga0307415_100142940 | Ga0307415_1001429402 | 333 |
| 449 | 3300046515 | Ga0495620_0053995 | Ga0495620_0053995_90_1091 | 333 |
| 450 | 3300046520 | Ga0495637_0003001 | Ga0495637_0003001_1088_2089 | 333 |
| 451 | 3300046616 | Ga0495668_0099156 | Ga0495668_0099156_575_1576 | 333 |
| 452 | 3300048088 | Ga0495602_0224877 | Ga0495602_0224877_17_1021 | 333 |
| 453 | 3300050491 | nmdc:mga00v17_13154_c1 | nmdc:mga00v17_13154_c1_443_1444 | 333 |
| 454 | 3300050492 | nmdc:mga0yw44_10570_c1 | nmdc:mga0yw44_10570_c1_1821_2822 | 333 |
| 455 | 3300050493 | nmdc:mga0k408_98948_c1 | nmdc:mga0k408_98948_c1_29_1030 | 333 |
| 456 | 3300050495 | nmdc:mga04h51_63068_c1 | nmdc:mga04h51_63068_c1_117_1118 | 333 |
| 457 | 3300050496 | nmdc:mga07m45_2773_c1 | nmdc:mga07m45_2773_c1_872_1873 | 333 |
| 458 | 3300053079 | Ga0500610_0002813 | Ga0500610_0002813_3308_4309 | 333 |
| 459 | 3300053079 | Ga0500610_0004548 | Ga0500610_0004548_2176_3177 | 333 |
| 460 | 3300053079 | Ga0500610_0013844 | Ga0500610_0013844_2324_3325 | 333 |
| 461 | 3300053117 | Ga0500593_002457 | Ga0500593_002457_3773_4774 | 333 |
| 462 | 3300053121 | Ga0500607_001013 | Ga0500607_001013_23138_24139 | 333 |
| 463 | 3300053158 | Ga0500627_0000353 | Ga0500627_0000353_10195_11196 | 333 |
| 464 | 3300053161 | Ga0500634_0026423 | Ga0500634_0026423_592_1593 | 333 |
| 465 | 3300003773 | Ga0055537_1000011 | Ga0055537_1000011122 | 334 |
| 466 | 3300003781 | Ga0055536_1001862 | Ga0055536_10018621 | 334 |
| 467 | 3300003784 | Ga0055534_1000020 | Ga0055534_100002014 | 334 |
| 468 | 3300003791 | Ga0055530_10021165 | Ga0055530_100211652 | 334 |
| 469 | 3300003792 | Ga0055540_1001207 | Ga0055540_100120712 | 334 |
| 470 | 3300003792 | Ga0055540_1003435 | Ga0055540_10034355 | 334 |
| 471 | 3300003794 | Ga0055531_10008108 | Ga0055531_100081085 | 334 |
| 472 | 3300005331 | Ga0070670_100067111 | Ga0070670_1000671114 | 334 |
| 473 | 3300005344 | Ga0070661_100029916 | Ga0070661_1000299162 | 334 |
| 474 | 3300005457 | Ga0070662_100025092 | Ga0070662_1000250922 | 334 |
| 475 | 3300005459 | Ga0068867_100074154 | Ga0068867_1000741543 | 334 |
| 476 | 3300005530 | Ga0070679_100035754 | Ga0070679_1000357542 | 334 |
| 477 | 3300005577 | Ga0068857_100040500 | Ga0068857_1000405003 | 334 |
| 478 | 3300006048 | Ga0075363_100005543 | Ga0075363_1000055433 | 334 |
| 479 | 3300006948 | Ga0099826_10000432 | Ga0099826_100004325 | 334 |
| 480 | 3300009036 | Ga0105244_10001781 | Ga0105244_1000178112 | 334 |
| 481 | 3300009036 | Ga0105244_10061924 | Ga0105244_100619241 | 334 |
| 482 | 3300009148 | Ga0105243_10002000 | Ga0105243_1000200015 | 334 |
| 483 | 3300009148 | Ga0105243_10005462 | Ga0105243_100054629 | 334 |
| 484 | 3300010375 | Ga0105239_10033940 | Ga0105239_100339405 | 334 |
| 485 | 3300011119 | Ga0105246_10142335 | Ga0105246_101423352 | 334 |
| 486 | 3300013105 | Ga0157369_10055285 | Ga0157369_100552855 | 334 |
| 487 | 3300013308 | Ga0157375_10067681 | Ga0157375_100676812 | 334 |
| 488 | 3300014497 | Ga0182008_10002890 | Ga0182008_100028908 | 334 |
| 489 | 3300015261 | Ga0182006_1005774 | Ga0182006_10057743 | 334 |
| 490 | 3300015262 | Ga0182007_10000298 | Ga0182007_100002986 | 334 |
| 491 | 3300015265 | Ga0182005_1025023 | Ga0182005_10250232 | 334 |
| 492 | 3300017792 | Ga0163161_10000042 | Ga0163161_1000004211 | 334 |
| 493 | 3300017792 | Ga0163161_10088969 | Ga0163161_100889693 | 334 |
| 494 | 3300025263 | Ga0209565_1000058 | Ga0209565_100005852 | 334 |
| 495 | 3300025273 | Ga0209673_1000053 | Ga0209673_1000053128 | 334 |
| 496 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010409 | 334 |
| 497 | 3300025291 | Ga0209675_1001994 | Ga0209675_10019942 | 334 |
| 498 | 3300025292 | Ga0209676_1000653 | Ga0209676_100065312 | 334 |
| 499 | 3300025292 | Ga0209676_1001003 | Ga0209676_100100320 | 334 |
| 500 | 3300025294 | Ga0209025_1015590 | Ga0209025_10155903 | 334 |
| 501 | 3300025298 | Ga0209050_1001558 | Ga0209050_100155812 | 334 |
| 502 | 3300025298 | Ga0209050_1006217 | Ga0209050_10062173 | 334 |
| 503 | 3300025303 | Ga0209051_1000145 | Ga0209051_100014523 | 334 |
| 504 | 3300025303 | Ga0209051_1000501 | Ga0209051_100050112 | 334 |
| 505 | 3300025304 | Ga0209257_1001684 | Ga0209257_100168424 | 334 |
| 506 | 3300025728 | Ga0207655_1001616 | Ga0207655_100161613 | 334 |
| 507 | 3300025907 | Ga0207645_10004557 | Ga0207645_100045574 | 334 |
| 508 | 3300025920 | Ga0207649_10007994 | Ga0207649_100079945 | 334 |
| 509 | 3300025932 | Ga0207690_10006705 | Ga0207690_100067056 | 334 |
| 510 | 3300025933 | Ga0207706_10020413 | Ga0207706_100204135 | 334 |
| 511 | 3300025935 | Ga0207709_10000375 | Ga0207709_1000037542 | 334 |
| 512 | 3300026116 | Ga0207674_10071507 | Ga0207674_100715073 | 334 |
| 513 | 3300027666 | Ga0209282_1001250 | Ga0209282_10012509 | 334 |
| 514 | 3300028794 | Ga0307515_10002595 | Ga0307515_1000259539 | 334 |
| 515 | 3300030742 | Ga0316183_1120317 | Ga0316183_11203172 | 334 |
| 516 | 3300031731 | Ga0307405_10006212 | Ga0307405_100062124 | 334 |
| 517 | 3300031731 | Ga0307405_10159118 | Ga0307405_101591182 | 334 |
| 518 | 3300031731 | Ga0307405_10318018 | Ga0307405_103180181 | 334 |
| 519 | 3300031852 | Ga0307410_10359624 | Ga0307410_103596241 | 334 |
| 520 | 3300031911 | Ga0307412_10032318 | Ga0307412_100323182 | 334 |
| 521 | 3300031911 | Ga0307412_10091615 | Ga0307412_100916152 | 334 |
| 522 | 3300031995 | Ga0307409_100118691 | Ga0307409_1001186913 | 334 |
| 523 | 3300032002 | Ga0307416_100053538 | Ga0307416_1000535384 | 334 |
| 524 | 3300041404 | Ga0439436_0000074 | Ga0439436_0000074_12622_13626 | 334 |
| 525 | 3300041404 | Ga0439436_0017877 | Ga0439436_0017877_1062_2066 | 334 |
| 526 | 3300041406 | Ga0439439_0002957 | Ga0439439_0002957_2145_3149 | 334 |
| 527 | 3300041411 | Ga0439466_0013978 | Ga0439466_0013978_1554_2558 | 334 |
| 528 | 3300041411 | Ga0439466_0042792 | Ga0439466_0042792_105_1109 | 334 |
| 529 | 3300041413 | Ga0439465_0003681 | Ga0439465_0003681_2788_3792 | 334 |
| 530 | 3300041997 | Ga0439431_0000361 | Ga0439431_0000361_5464_6468 | 334 |
| 531 | 3300042004 | Ga0439445_0001373 | Ga0439445_0001373_3637_4641 | 334 |
| 532 | 3300042006 | Ga0439432_001162 | Ga0439432_001162_2364_3368 | 334 |
| 533 | 3300042007 | Ga0439449_0002224 | Ga0439449_0002224_3044_4048 | 334 |
| 534 | 3300042014 | Ga0439457_011445 | Ga0439457_011445_896_1900 | 334 |
| 535 | 3300042015 | Ga0439462_0042206 | Ga0439462_0042206_106_1110 | 334 |
| 536 | 3300042435 | Ga0439434_0009992 | Ga0439434_0009992_1019_2023 | 334 |
| 537 | 3300042531 | Ga0450918_004653 | Ga0450918_004653_731_1735 | 334 |
| 538 | 3300046460 | Ga0495638_0029205 | Ga0495638_0029205_2217_3221 | 334 |
| 539 | 3300046513 | Ga0495616_0010064 | Ga0495616_0010064_2492_3496 | 334 |
| 540 | 3300046518 | Ga0495631_0000088 | Ga0495631_0000088_3811_4815 | 334 |
| 541 | 3300046539 | Ga0495621_0043897 | Ga0495621_0043897_373_1377 | 334 |
| 542 | 3300046660 | Ga0495625_0002306 | Ga0495625_0002306_8022_9026 | 334 |
| 543 | 3300047321 | Ga0495676_0002416 | Ga0495676_0002416_4561_5565 | 334 |
| 544 | 3300047673 | Ga0495593_0007745 | Ga0495593_0007745_4027_5031 | 334 |
| 545 | 3300048089 | Ga0495614_0001061 | Ga0495614_0001061_830_1834 | 334 |
| 546 | 3300048905 | Ga0496102_0062097 | Ga0496102_0062097_1840_2844 | 334 |
| 547 | 3300048920 | Ga0496117_0011528 | Ga0496117_0011528_569_1573 | 334 |
| 548 | 3300048920 | Ga0496117_0112727 | Ga0496117_0112727_465_1469 | 334 |
| 549 | 3300048920 | Ga0496117_0161533 | Ga0496117_0161533_224_1228 | 334 |
| 550 | 3300048921 | Ga0496118_0034068 | Ga0496118_0034068_301_1305 | 334 |
| 551 | 3300048924 | Ga0496121_0036930 | Ga0496121_0036930_1328_2332 | 334 |
| 552 | 3300048924 | Ga0496121_0135167 | Ga0496121_0135167_780_1784 | 334 |
| 553 | 3300048925 | Ga0496122_0125482 | Ga0496122_0125482_479_1483 | 334 |
| 554 | 3300048926 | Ga0496123_0016199 | Ga0496123_0016199_1342_2346 | 334 |
| 555 | 3300048926 | Ga0496123_0097867 | Ga0496123_0097867_186_1190 | 334 |
| 556 | 3300048927 | Ga0496124_0053577 | Ga0496124_0053577_1675_2679 | 334 |
| 557 | 3300048927 | Ga0496124_0088713 | Ga0496124_0088713_875_1879 | 334 |
| 558 | 3300048928 | Ga0496125_0028035 | Ga0496125_0028035_1762_2766 | 334 |
| 559 | 3300048928 | Ga0496125_0160881 | Ga0496125_0160881_360_1364 | 334 |
| 560 | 3300048928 | Ga0496125_0195810 | Ga0496125_0195810_285_1289 | 334 |
| 561 | 3300050490 | nmdc:mga03n38_10621_c1 | nmdc:mga03n38_10621_c1_312_1316 | 334 |
| 562 | 3300050491 | nmdc:mga00v17_230306_c1 | nmdc:mga00v17_230306_c1_52_1056 | 334 |
| 563 | 3300050496 | nmdc:mga07m45_3471_c1 | nmdc:mga07m45_3471_c1_4305_5309 | 334 |
| 564 | 3300053087 | Ga0500643_009215 | Ga0500643_009215_151_1155 | 334 |
| 565 | 3300053093 | Ga0500651_0000056 | Ga0500651_0000056_13941_14945 | 334 |
| 566 | 3300053094 | Ga0500566_0017204 | Ga0500566_0017204_1334_2338 | 334 |
| 567 | 3300053110 | Ga0500571_000344 | Ga0500571_000344_15979_16983 | 334 |
| 568 | 3300053118 | Ga0500594_0002730 | Ga0500594_0002730_1143_2147 | 334 |
| 569 | 3300053122 | Ga0500608_010021 | Ga0500608_010021_2570_3574 | 334 |
| 570 | 3300053128 | Ga0500626_022077 | Ga0500626_022077_1772_2776 | 334 |
| 571 | 3300053133 | Ga0500655_000657 | Ga0500655_000657_4639_5643 | 334 |
| 572 | 3300053134 | Ga0500658_0000487 | Ga0500658_0000487_2620_3624 | 334 |
| 573 | 3300053134 | Ga0500658_0000584 | Ga0500658_0000584_13105_14109 | 334 |
| 574 | 3300053136 | Ga0500559_0000134 | Ga0500559_0000134_30694_31707 | 334 |
| 575 | 3300053136 | Ga0500559_0006783 | Ga0500559_0006783_2750_3754 | 334 |
| 576 | 3300053138 | Ga0500564_006905 | Ga0500564_006905_1396_2400 | 334 |
| 577 | 3300053162 | Ga0500638_014624 | Ga0500638_014624_1143_2147 | 334 |
| 578 | 3300053177 | Ga0500636_0036388 | Ga0500636_0036388_1789_2793 | 334 |
| 579 | 3300053735 | Ga0500596_007015 | Ga0500596_007015_796_1800 | 334 |
| 580 | 3300002773 | JGI25152J39213_1003501 | JGI25152J39213_10035013 | 335 |
| 581 | 3300002774 | JGI25150J39212_1001724 | JGI25150J39212_10017244 | 335 |
| 582 | 3300002987 | JGI25159J45721_1005177 | JGI25159J45721_10051772 | 335 |
| 583 | 3300003187 | JGI25151J46595_10013620 | JGI25151J46595_100136202 | 335 |
| 584 | 3300003215 | JGI25153J46596_10007574 | JGI25153J46596_100075743 | 335 |
| 585 | 3300003316 | rootH1_10012321 | rootH1_100123214 | 335 |
| 586 | 3300003322 | rootL2_10055748 | rootL2_100557483 | 335 |
| 587 | 3300003354 | JGI25160J50197_1005251 | JGI25160J50197_10052513 | 335 |
| 588 | 3300003354 | JGI25160J50197_1006869 | JGI25160J50197_10068693 | 335 |
| 589 | 3300003374 | JGI25161J50226_1002022 | JGI25161J50226_10020222 | 335 |
| 590 | 3300003374 | JGI25161J50226_1003243 | JGI25161J50226_10032434 | 335 |
| 591 | 3300003578 | Ga0006562J51391_1101148 | Ga0006562J51391_11011483 | 335 |
| 592 | 3300003762 | Ga0055542_1000009 | Ga0055542_100000962 | 335 |
| 593 | 3300003771 | Ga0055526_1011021 | Ga0055526_10110214 | 335 |
| 594 | 3300003771 | Ga0055526_1016946 | Ga0055526_10169462 | 335 |
| 595 | 3300003773 | Ga0055537_1004264 | Ga0055537_10042644 | 335 |
| 596 | 3300003775 | Ga0055524_1007760 | Ga0055524_10077605 | 335 |
| 597 | 3300003775 | Ga0055524_1008910 | Ga0055524_10089104 | 335 |
| 598 | 3300003781 | Ga0055536_1010873 | Ga0055536_10108732 | 335 |
| 599 | 3300003784 | Ga0055534_1005481 | Ga0055534_10054812 | 335 |
| 600 | 3300003784 | Ga0055534_1007068 | Ga0055534_10070682 | 335 |
| 601 | 3300003790 | Ga0055528_1009260 | Ga0055528_10092604 | 335 |
| 602 | 3300003791 | Ga0055530_10001397 | Ga0055530_100013977 | 335 |
| 603 | 3300003792 | Ga0055540_1005079 | Ga0055540_10050795 | 335 |
| 604 | 3300003792 | Ga0055540_1008609 | Ga0055540_10086092 | 335 |
| 605 | 3300003792 | Ga0055540_1009163 | Ga0055540_10091634 | 335 |
| 606 | 3300003794 | Ga0055531_10005088 | Ga0055531_100050887 | 335 |
| 607 | 3300003794 | Ga0055531_10014627 | Ga0055531_100146272 | 335 |
| 608 | 3300004625 | Ga0055543_1002918 | Ga0055543_10029183 | 335 |
| 609 | 3300004625 | Ga0055543_1021689 | Ga0055543_10216891 | 335 |
| 610 | 3300005262 | Ga0065165_1007487 | Ga0065165_10074873 | 335 |
| 611 | 3300005339 | Ga0070660_100192020 | Ga0070660_1001920201 | 335 |
| 612 | 3300005354 | Ga0070675_100393866 | Ga0070675_1003938661 | 335 |
| 613 | 3300005355 | Ga0070671_100144940 | Ga0070671_1001449402 | 335 |
| 614 | 3300005364 | Ga0070673_100222581 | Ga0070673_1002225812 | 335 |
| 615 | 3300005366 | Ga0070659_100024749 | Ga0070659_1000247494 | 335 |
| 616 | 3300005539 | Ga0068853_100043050 | Ga0068853_1000430501 | 335 |
| 617 | 3300005548 | Ga0070665_100077624 | Ga0070665_1000776244 | 335 |
| 618 | 3300005577 | Ga0068857_100039725 | Ga0068857_1000397252 | 335 |
| 619 | 3300005578 | Ga0068854_100202421 | Ga0068854_1002024211 | 335 |
| 620 | 3300005614 | Ga0068856_100019589 | Ga0068856_1000195893 | 335 |
| 621 | 3300005834 | Ga0068851_10013256 | Ga0068851_100132563 | 335 |
| 622 | 3300006177 | Ga0075362_10019257 | Ga0075362_100192572 | 335 |
| 623 | 3300006177 | Ga0075362_10031834 | Ga0075362_100318343 | 335 |
| 624 | 3300006195 | Ga0075366_10076056 | Ga0075366_100760562 | 335 |
| 625 | 3300013100 | Ga0157373_10072148 | Ga0157373_100721482 | 335 |
| 626 | 3300013102 | Ga0157371_10057838 | Ga0157371_100578383 | 335 |
| 627 | 3300013307 | Ga0157372_10037609 | Ga0157372_100376092 | 335 |
| 628 | 3300014497 | Ga0182008_10054927 | Ga0182008_100549272 | 335 |
| 629 | 3300014497 | Ga0182008_10060742 | Ga0182008_100607422 | 335 |
| 630 | 3300015261 | Ga0182006_1043948 | Ga0182006_10439482 | 335 |
| 631 | 3300025208 | Ga0209436_107422 | Ga0209436_1074223 | 335 |
| 632 | 3300025208 | Ga0209436_108296 | Ga0209436_1082962 | 335 |
| 633 | 3300025229 | Ga0209147_100373 | Ga0209147_10037316 | 335 |
| 634 | 3300025242 | Ga0209258_100009 | Ga0209258_100009587 | 335 |
| 635 | 3300025245 | Ga0207425_1000590 | Ga0207425_10005907 | 335 |
| 636 | 3300025245 | Ga0207425_1005361 | Ga0207425_10053612 | 335 |
| 637 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007587 | 335 |
| 638 | 3300025258 | Ga0209129_1000013 | Ga0209129_100001377 | 335 |
| 639 | 3300025263 | Ga0209565_1000197 | Ga0209565_100019726 | 335 |
| 640 | 3300025263 | Ga0209565_1004258 | Ga0209565_10042586 | 335 |
| 641 | 3300025273 | Ga0209673_1000245 | Ga0209673_100024518 | 335 |
| 642 | 3300025273 | Ga0209673_1000535 | Ga0209673_100053537 | 335 |
| 643 | 3300025273 | Ga0209673_1005273 | Ga0209673_10052734 | 335 |
| 644 | 3300025284 | Ga0209130_1000163 | Ga0209130_100016329 | 335 |
| 645 | 3300025284 | Ga0209130_1001170 | Ga0209130_10011705 | 335 |
| 646 | 3300025291 | Ga0209675_1000440 | Ga0209675_100044016 | 335 |
| 647 | 3300025292 | Ga0209676_1000108 | Ga0209676_1000108130 | 335 |
| 648 | 3300025292 | Ga0209676_1010636 | Ga0209676_10106365 | 335 |
| 649 | 3300025294 | Ga0209025_1000169 | Ga0209025_100016935 | 335 |
| 650 | 3300025295 | Ga0209564_1000171 | Ga0209564_100017135 | 335 |
| 651 | 3300025295 | Ga0209564_1000517 | Ga0209564_100051735 | 335 |
| 652 | 3300025297 | Ga0209758_1000067 | Ga0209758_1000067178 | 335 |
| 653 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002388 | 335 |
| 654 | 3300025299 | Ga0209256_1000077 | Ga0209256_1000077177 | 335 |
| 655 | 3300025299 | Ga0209256_1000121 | Ga0209256_100012135 | 335 |
| 656 | 3300025302 | Ga0207426_1000101 | Ga0207426_100010177 | 335 |
| 657 | 3300025302 | Ga0207426_1000129 | Ga0207426_100012981 | 335 |
| 658 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002156 | 335 |
| 659 | 3300025303 | Ga0209051_1000289 | Ga0209051_100028921 | 335 |
| 660 | 3300025303 | Ga0209051_1002533 | Ga0209051_10025333 | 335 |
| 661 | 3300025303 | Ga0209051_1013408 | Ga0209051_10134085 | 335 |
| 662 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002297 | 335 |
| 663 | 3300025304 | Ga0209257_1003753 | Ga0209257_100375310 | 335 |
| 664 | 3300025321 | Ga0207656_10035733 | Ga0207656_100357332 | 335 |
| 665 | 3300025919 | Ga0207657_10047837 | Ga0207657_100478373 | 335 |
| 666 | 3300025945 | Ga0207679_10013185 | Ga0207679_100131853 | 335 |
| 667 | 3300026078 | Ga0207702_10010757 | Ga0207702_100107573 | 335 |
| 668 | 3300026116 | Ga0207674_10012160 | Ga0207674_100121609 | 335 |
| 669 | 3300028379 | Ga0268266_10393223 | Ga0268266_103932232 | 335 |
| 670 | 3300028786 | Ga0307517_10004307 | Ga0307517_100043077 | 335 |
| 671 | 3300030734 | Ga0316179_1007438 | Ga0316179_10074382 | 335 |
| 672 | 3300030735 | Ga0316178_1036479 | Ga0316178_10364792 | 335 |
| 673 | 3300030742 | Ga0316183_1021428 | Ga0316183_10214282 | 335 |
| 674 | 3300031507 | Ga0307509_10001286 | Ga0307509_1000128620 | 335 |
| 675 | 3300031507 | Ga0307509_10248800 | Ga0307509_102488002 | 335 |
| 676 | 3300031548 | Ga0307408_100023580 | Ga0307408_1000235804 | 335 |
| 677 | 3300031548 | Ga0307408_100186067 | Ga0307408_1001860672 | 335 |
| 678 | 3300031616 | Ga0307508_10015309 | Ga0307508_100153094 | 335 |
| 679 | 3300031649 | Ga0307514_10040739 | Ga0307514_100407393 | 335 |
| 680 | 3300031730 | Ga0307516_10166161 | Ga0307516_101661612 | 335 |
| 681 | 3300031731 | Ga0307405_10025741 | Ga0307405_100257412 | 335 |
| 682 | 3300031731 | Ga0307405_10089630 | Ga0307405_100896302 | 335 |
| 683 | 3300031731 | Ga0307405_10116992 | Ga0307405_101169922 | 335 |
| 684 | 3300031731 | Ga0307405_10238908 | Ga0307405_102389082 | 335 |
| 685 | 3300031911 | Ga0307412_10081552 | Ga0307412_100815523 | 335 |
| 686 | 3300032005 | Ga0307411_10074470 | Ga0307411_100744702 | 335 |
| 687 | 3300033180 | Ga0307510_10002924 | Ga0307510_1000292420 | 335 |
| 688 | 3300039450 | Ga0436363_1647914 | Ga0436363_1647914_1030_2043 | 335 |
| 689 | 3300041404 | Ga0439436_0003672 | Ga0439436_0003672_3230_4237 | 335 |
| 690 | 3300041407 | Ga0439447_007723 | Ga0439447_007723_1293_2300 | 335 |
| 691 | 3300041411 | Ga0439466_0037552 | Ga0439466_0037552_471_1478 | 335 |
| 692 | 3300041999 | Ga0439433_0006567 | Ga0439433_0006567_133_1140 | 335 |
| 693 | 3300042002 | Ga0439442_007050 | Ga0439442_007050_794_1801 | 335 |
| 694 | 3300042007 | Ga0439449_0004686 | Ga0439449_0004686_934_1941 | 335 |
| 695 | 3300042015 | Ga0439462_0002186 | Ga0439462_0002186_2971_3978 | 335 |
| 696 | 3300042125 | Ga0450923_011036 | Ga0450923_011036_96_1103 | 335 |
| 697 | 3300042532 | Ga0450893_0011234 | Ga0450893_0011234_461_1468 | 335 |
| 698 | 3300046454 | Ga0495592_0009766 | Ga0495592_0009766_1252_2268 | 335 |
| 699 | 3300048904 | Ga0496101_0104298 | Ga0496101_0104298_910_1932 | 335 |
| 700 | 3300048921 | Ga0496118_0014670 | Ga0496118_0014670_5770_6777 | 335 |
| 701 | 3300048927 | Ga0496124_0137637 | Ga0496124_0137637_892_1902 | 335 |
| 702 | 3300048928 | Ga0496125_0029090 | Ga0496125_0029090_3283_4290 | 335 |
| 703 | 3300048928 | Ga0496125_0163199 | Ga0496125_0163199_319_1326 | 335 |
| 704 | 3300049705 | Ga0501225_0021786 | Ga0501225_0021786_595_1602 | 335 |
| 705 | 3300050489 | nmdc:mga03683_38495_c1 | nmdc:mga03683_38495_c1_630_1637 | 335 |
| 706 | 3300050489 | nmdc:mga03683_4879_c1 | nmdc:mga03683_4879_c1_1931_2938 | 335 |
| 707 | 3300050496 | nmdc:mga07m45_8551_c1 | nmdc:mga07m45_8551_c1_2264_3271 | 335 |
| 708 | 3300053154 | Ga0500619_026564 | Ga0500619_026564_11_1027 | 335 |
| 709 | iso_pu_bacteria | 2928115317 | 2928117370 | 335 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gym-assembly1.cif.gz_sa | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.9055 | 9 | 37 |
| 2r0c-assembly1.cif.gz_A | structure of the substrate-free form of the rebeccamycin biosynthetic enzyme rebc | 0.905 | 9 | 39 |
| 4mig-assembly1.cif.gz_C | pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type | 0.9021 | 9 | 39 |
| 1y56-assembly1.cif.gz_B | crystal structure of l-proline dehydrogenase from p.horikoshii | 0.8988 | 9 | 40 |
| 4mif-assembly1.cif.gz_D | pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source | 0.8985 | 9 | 39 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0JSV2_33_153_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9408 | 95 | 203 | 3.40.50.720 |
| 4kuhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.933 | 9 | 204 | 3.40.50.720 |
| af_Q5I0K1_8_223_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9248 | 10 | 39 | 3.50.50.60 |
| 6hrdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9241 | 7 | 204 | 3.40.50.720 |
| 4kuhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9236 | 9 | 204 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B4ELK6-F1-model_v4 | L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) | 0.9901 | 9 | 328 |
GO:0006631
GO:0009056 GO:0016020 GO:0050104 GO:0070403 |
| AF-A0A7C3N468-F1-model_v4 | L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) | 0.9791 | 11 | 324 |
GO:0006631
GO:0009056 GO:0050104 GO:0070403 |
| AF-A0A658ACS0-F1-model_v4 | deleted | 0.978 | 180 | 328 |
|
| AF-A0A3D3FY16-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9775 | 114 | 332 |
GO:0006631
GO:0009056 GO:0050104 GO:0070403 |
| AF-A0A3D3FY16-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9687 | 114 | 332 |
GO:0006631
GO:0009056 GO:0050104 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar