F476598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 232 | 1416 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10048889|Ga0207699_100488893 |
| Length | 188 |
| Sequence | VQDSSLTGTKLVLKCFKHFKCRLFRSRKPRVLRSEFTSRDVVQLTGITARQLQWWDERGIVVPARQGRRRLYSMEDLSEVAVICELRDRGFSLQRVRKVVRFLQHEFGTRLAETVSGGSDYHLLTDGRSLYLETSAQQIVDILKNARQPMLAICLSDTVRRVLASVQSGKKRSKPAGYVSAGRRKHAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 108 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 109 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 110 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.93 |
| Rhizosphere | 93.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207699_10048889 | 3300025906 | Bacteria | 2486 |
| 2 | LJNas_1000272 | 3300000546 | Bacteria | 8937 |
| 3 | JGI24751J29686_10093839 | 3300002459 | Bacteria | 625 |
| 4 | Ga0065712_10085279 | 3300005290 | Bacteria | 2694 |
| 5 | Ga0065712_10215806 | 3300005290 | Bacteria | 1057 |
| 6 | Ga0065715_10103416 | 3300005293 | Bacteria | 3036 |
| 7 | Ga0070683_100005566 | 3300005329 | Bacteria | 10518 |
| 8 | Ga0070683_100096613 | 3300005329 | Bacteria | 2779 |
| 9 | Ga0070683_100134957 | 3300005329 | Unclassified | 2336 |
| 10 | Ga0070683_100426329 | 3300005329 | Bacteria | 1265 |
| 11 | Ga0070690_100635624 | 3300005330 | Unclassified | 814 |
| 12 | Ga0070670_101464008 | 3300005331 | Unclassified | 627 |
| 13 | Ga0068869_100002370 | 3300005334 | Bacteria | 11334 |
| 14 | Ga0068869_100526688 | 3300005334 | Bacteria | 990 |
| 15 | Ga0068869_100583491 | 3300005334 | Unclassified | 943 |
| 16 | Ga0070680_100033598 | 3300005336 | Unclassified | 4136 |
| 17 | Ga0070682_100032214 | 3300005337 | Bacteria | 3176 |
| 18 | Ga0068868_100004794 | 3300005338 | Bacteria | 9494 |
| 19 | Ga0068868_100020961 | 3300005338 | Unclassified | 4920 |
| 20 | Ga0068868_100089504 | 3300005338 | Bacteria | 2478 |
| 21 | Ga0068868_100707534 | 3300005338 | Bacteria | 902 |
| 22 | Ga0070660_100023194 | 3300005339 | Bacteria | 4596 |
| 23 | Ga0070689_100103270 | 3300005340 | Bacteria | 2259 |
| 24 | Ga0070689_100103431 | 3300005340 | Bacteria | 2257 |
| 25 | Ga0070691_10230677 | 3300005341 | Unclassified | 985 |
| 26 | Ga0070687_100057813 | 3300005343 | Bacteria | 2035 |
| 27 | Ga0070661_100050967 | 3300005344 | Bacteria | 3029 |
| 28 | Ga0070661_100633111 | 3300005344 | Bacteria | 867 |
| 29 | Ga0070669_100520407 | 3300005353 | Unclassified | 989 |
| 30 | Ga0070675_101423635 | 3300005354 | Unclassified | 639 |
| 31 | Ga0070671_100341399 | 3300005355 | Unclassified | 1278 |
| 32 | Ga0070673_102112382 | 3300005364 | Unclassified | 535 |
| 33 | Ga0070688_100111838 | 3300005365 | Bacteria | 1817 |
| 34 | Ga0070709_10022872 | 3300005434 | Bacteria | 3663 |
| 35 | Ga0070709_10039598 | 3300005434 | Bacteria | 2893 |
| 36 | Ga0070709_10051506 | 3300005434 | Bacteria | 2584 |
| 37 | Ga0070709_10052759 | 3300005434 | Bacteria | 2557 |
| 38 | Ga0070709_10062417 | 3300005434 | Bacteria | 2376 |
| 39 | Ga0070709_10162080 | 3300005434 | Bacteria | 1556 |
| 40 | Ga0070709_10171836 | 3300005434 | Unclassified | 1515 |
| 41 | Ga0070709_10231907 | 3300005434 | Unclassified | 1321 |
| 42 | Ga0070709_10639471 | 3300005434 | Bacteria | 823 |
| 43 | Ga0070714_100006809 | 3300005435 | Bacteria | 8857 |
| 44 | Ga0070714_100043931 | 3300005435 | Bacteria | 3781 |
| 45 | Ga0070714_100076844 | 3300005435 | Bacteria | 2900 |
| 46 | Ga0070714_100173340 | 3300005435 | Bacteria | 1959 |
| 47 | Ga0070714_100176732 | 3300005435 | Bacteria | 1940 |
| 48 | Ga0070714_100182981 | 3300005435 | Bacteria | 1908 |
| 49 | Ga0070714_100219157 | 3300005435 | Bacteria | 1748 |
| 50 | Ga0070714_100251674 | 3300005435 | Bacteria | 1634 |
| 51 | Ga0070714_100374507 | 3300005435 | Bacteria | 1341 |
| 52 | Ga0070714_100515773 | 3300005435 | Unclassified | 1141 |
| 53 | Ga0070714_100528679 | 3300005435 | Unclassified | 1127 |
| 54 | Ga0070713_100003409 | 3300005436 | Bacteria | 10498 |
| 55 | Ga0070713_100011360 | 3300005436 | Bacteria | 6484 |
| 56 | Ga0070713_100079361 | 3300005436 | Bacteria | 2796 |
| 57 | Ga0070713_100079989 | 3300005436 | Bacteria | 2786 |
| 58 | Ga0070713_100124500 | 3300005436 | Bacteria | 2265 |
| 59 | Ga0070713_100136726 | 3300005436 | Bacteria | 2166 |
| 60 | Ga0070713_100275945 | 3300005436 | Unclassified | 1541 |
| 61 | Ga0070713_100734208 | 3300005436 | Unclassified | 944 |
| 62 | Ga0070710_10013298 | 3300005437 | Bacteria | 4118 |
| 63 | Ga0070710_10647707 | 3300005437 | Unclassified | 740 |
| 64 | Ga0070711_100007702 | 3300005439 | Bacteria | 6558 |
| 65 | Ga0070711_100267695 | 3300005439 | Bacteria | 1347 |
| 66 | Ga0070711_100545682 | 3300005439 | Unclassified | 961 |
| 67 | Ga0070711_100731388 | 3300005439 | Bacteria | 835 |
| 68 | Ga0070711_100778055 | 3300005439 | Bacteria | 810 |
| 69 | Ga0070711_100962818 | 3300005439 | Bacteria | 731 |
| 70 | Ga0070711_101477662 | 3300005439 | Unclassified | 592 |
| 71 | Ga0070708_100000589 | 3300005445 | Bacteria | 27247 |
| 72 | Ga0070708_100002277 | 3300005445 | Bacteria | 14852 |
| 73 | Ga0070708_100020036 | 3300005445 | Bacteria | 5633 |
| 74 | Ga0070708_100022011 | 3300005445 | Bacteria | 5403 |
| 75 | Ga0070708_100082620 | 3300005445 | Bacteria | 2910 |
| 76 | Ga0070708_100529372 | 3300005445 | Bacteria | 1112 |
| 77 | Ga0070708_100665840 | 3300005445 | Bacteria | 980 |
| 78 | Ga0070663_100124783 | 3300005455 | Unclassified | 1949 |
| 79 | Ga0070678_100607077 | 3300005456 | Unclassified | 977 |
| 80 | Ga0070662_100041416 | 3300005457 | Bacteria | 3286 |
| 81 | Ga0070681_10000541 | 3300005458 | Bacteria | 31118 |
| 82 | Ga0070681_10071843 | 3300005458 | Bacteria | 3425 |
| 83 | Ga0070681_10181016 | 3300005458 | Bacteria | 2029 |
| 84 | Ga0070681_10270643 | 3300005458 | Bacteria | 1610 |
| 85 | Ga0070681_10295606 | 3300005458 | Unclassified | 1529 |
| 86 | Ga0068867_100001820 | 3300005459 | Bacteria | 14857 |
| 87 | Ga0068867_100140020 | 3300005459 | Bacteria | 1890 |
| 88 | Ga0068867_100162772 | 3300005459 | Bacteria | 1761 |
| 89 | Ga0068867_100213106 | 3300005459 | Bacteria | 1552 |
| 90 | Ga0070685_10042283 | 3300005466 | Bacteria | 2600 |
| 91 | Ga0070706_100000419 | 3300005467 | Bacteria | 51038 |
| 92 | Ga0070706_100003128 | 3300005467 | Bacteria | 16367 |
| 93 | Ga0070706_100045075 | 3300005467 | Bacteria | 4073 |
| 94 | Ga0070706_100321027 | 3300005467 | Bacteria | 1444 |
| 95 | Ga0070706_100429665 | 3300005467 | Unclassified | 1229 |
| 96 | Ga0070706_100861298 | 3300005467 | Unclassified | 838 |
| 97 | Ga0070706_100896775 | 3300005467 | Bacteria | 819 |
| 98 | Ga0070706_101235139 | 3300005467 | Bacteria | 686 |
| 99 | Ga0070707_100002885 | 3300005468 | Bacteria | 16352 |
| 100 | Ga0070707_100101604 | 3300005468 | Bacteria | 2786 |
| 101 | Ga0070707_100157406 | 3300005468 | Bacteria | 2213 |
| 102 | Ga0070707_100264679 | 3300005468 | Bacteria | 1672 |
| 103 | Ga0070707_100846518 | 3300005468 | Unclassified | 879 |
| 104 | Ga0070698_100000809 | 3300005471 | Bacteria | 34141 |
| 105 | Ga0070698_100177613 | 3300005471 | Unclassified | 2068 |
| 106 | Ga0070698_100567769 | 3300005471 | Unclassified | 1074 |
| 107 | Ga0070699_100003819 | 3300005518 | Bacteria | 13308 |
| 108 | Ga0070699_100028521 | 3300005518 | Bacteria | 4814 |
| 109 | Ga0070699_100064484 | 3300005518 | Bacteria | 3177 |
| 110 | Ga0070699_100096949 | 3300005518 | Bacteria | 2583 |
| 111 | Ga0070699_100192852 | 3300005518 | Unclassified | 1810 |
| 112 | Ga0070699_100380405 | 3300005518 | Bacteria | 1274 |
| 113 | Ga0070679_100003227 | 3300005530 | Bacteria | 14897 |
| 114 | Ga0070679_100050666 | 3300005530 | Bacteria | 4136 |
| 115 | Ga0070679_100169084 | 3300005530 | Bacteria | 2159 |
| 116 | Ga0070679_100214016 | 3300005530 | Bacteria | 1890 |
| 117 | Ga0070679_100337721 | 3300005530 | Unclassified | 1455 |
| 118 | Ga0070684_100065092 | 3300005535 | Bacteria | 3199 |
| 119 | Ga0070684_100670229 | 3300005535 | Bacteria | 966 |
| 120 | Ga0070697_100000821 | 3300005536 | Bacteria | 23282 |
| 121 | Ga0070697_100001136 | 3300005536 | Bacteria | 20136 |
| 122 | Ga0070697_100002177 | 3300005536 | Bacteria | 15018 |
| 123 | Ga0070697_100007613 | 3300005536 | Bacteria | 8430 |
| 124 | Ga0070697_100011172 | 3300005536 | Bacteria | 7018 |
| 125 | Ga0070697_100100583 | 3300005536 | Bacteria | 2401 |
| 126 | Ga0070697_100193964 | 3300005536 | Bacteria | 1725 |
| 127 | Ga0070697_100473707 | 3300005536 | Unclassified | 1093 |
| 128 | Ga0068853_100015570 | 3300005539 | Bacteria | 6247 |
| 129 | Ga0068853_100099902 | 3300005539 | Bacteria | 2564 |
| 130 | Ga0068853_100180935 | 3300005539 | Bacteria | 1912 |
| 131 | Ga0068853_100511266 | 3300005539 | Bacteria | 1135 |
| 132 | Ga0068853_100549681 | 3300005539 | Bacteria | 1094 |
| 133 | Ga0070695_100182454 | 3300005545 | Unclassified | 1488 |
| 134 | Ga0070695_100934097 | 3300005545 | Unclassified | 702 |
| 135 | Ga0070693_100017958 | 3300005547 | Bacteria | 3688 |
| 136 | Ga0070693_100045848 | 3300005547 | Unclassified | 2480 |
| 137 | Ga0070693_100078106 | 3300005547 | Unclassified | 1966 |
| 138 | Ga0070693_100844016 | 3300005547 | Bacteria | 682 |
| 139 | Ga0070665_100678152 | 3300005548 | Bacteria | 1044 |
| 140 | Ga0070665_101916853 | 3300005548 | Unclassified | 598 |
| 141 | Ga0070704_100505438 | 3300005549 | Bacteria | 1049 |
| 142 | Ga0068855_100000427 | 3300005563 | Bacteria | 52063 |
| 143 | Ga0068855_100003386 | 3300005563 | Bacteria | 19516 |
| 144 | Ga0068855_100005274 | 3300005563 | Bacteria | 15778 |
| 145 | Ga0068855_100069772 | 3300005563 | Bacteria | 4089 |
| 146 | Ga0068855_100201805 | 3300005563 | Bacteria | 2238 |
| 147 | Ga0068855_100220676 | 3300005563 | Unclassified | 2126 |
| 148 | Ga0068855_101113689 | 3300005563 | Bacteria | 825 |
| 149 | Ga0068855_101530868 | 3300005563 | Bacteria | 684 |
| 150 | Ga0070664_100001749 | 3300005564 | Bacteria | 17386 |
| 151 | Ga0070664_100058147 | 3300005564 | Bacteria | 3288 |
| 152 | Ga0068857_100000136 | 3300005577 | Bacteria | 44769 |
| 153 | Ga0068857_100000352 | 3300005577 | Bacteria | 31917 |
| 154 | Ga0068857_101156089 | 3300005577 | Unclassified | 748 |
| 155 | Ga0068854_100006132 | 3300005578 | Bacteria | 7629 |
| 156 | Ga0068854_100557841 | 3300005578 | Bacteria | 972 |
| 157 | Ga0068856_100000493 | 3300005614 | Bacteria | 43650 |
| 158 | Ga0068856_100000913 | 3300005614 | Bacteria | 31587 |
| 159 | Ga0068856_100003688 | 3300005614 | Bacteria | 15358 |
| 160 | Ga0068856_100006174 | 3300005614 | Bacteria | 11753 |
| 161 | Ga0068856_100037127 | 3300005614 | Bacteria | 4779 |
| 162 | Ga0068856_100086860 | 3300005614 | Bacteria | 3108 |
| 163 | Ga0068856_100553295 | 3300005614 | Bacteria | 1172 |
| 164 | Ga0068856_100828474 | 3300005614 | Unclassified | 945 |
| 165 | Ga0070702_100293866 | 3300005615 | Bacteria | 1121 |
| 166 | Ga0068852_100221865 | 3300005616 | Bacteria | 1798 |
| 167 | Ga0068852_100238645 | 3300005616 | Unclassified | 1736 |
| 168 | Ga0068852_100343651 | 3300005616 | Bacteria | 1455 |
| 169 | Ga0068852_101198171 | 3300005616 | Unclassified | 780 |
| 170 | Ga0068859_100004990 | 3300005617 | Bacteria | 13479 |
| 171 | Ga0068864_100006267 | 3300005618 | Bacteria | 9756 |
| 172 | Ga0068866_10112071 | 3300005718 | Bacteria | 1524 |
| 173 | Ga0068866_10139136 | 3300005718 | Unclassified | 1391 |
| 174 | Ga0068870_10085270 | 3300005840 | Bacteria | 1755 |
| 175 | Ga0068863_100043652 | 3300005841 | Bacteria | 4255 |
| 176 | Ga0068863_100205518 | 3300005841 | Bacteria | 1895 |
| 177 | Ga0068863_101239771 | 3300005841 | Unclassified | 752 |
| 178 | Ga0068858_100004899 | 3300005842 | Bacteria | 13122 |
| 179 | Ga0068858_100006486 | 3300005842 | Bacteria | 11388 |
| 180 | Ga0068858_100012689 | 3300005842 | Bacteria | 7938 |
| 181 | Ga0068858_100150059 | 3300005842 | Bacteria | 2191 |
| 182 | Ga0068858_100193273 | 3300005842 | Bacteria | 1923 |
| 183 | Ga0068858_100276002 | 3300005842 | Bacteria | 1600 |
| 184 | Ga0068858_100486607 | 3300005842 | Unclassified | 1191 |
| 185 | Ga0068858_100782404 | 3300005842 | Bacteria | 930 |
| 186 | Ga0068860_100165500 | 3300005843 | Unclassified | 2134 |
| 187 | Ga0068860_100228207 | 3300005843 | Bacteria | 1809 |
| 188 | Ga0068860_100749590 | 3300005843 | Unclassified | 988 |
| 189 | Ga0068860_100902756 | 3300005843 | Unclassified | 900 |
| 190 | Ga0081540_1033718 | 3300005983 | Bacteria | 2774 |
| 191 | Ga0081540_1112660 | 3300005983 | Bacteria | 1146 |
| 192 | Ga0070717_10007704 | 3300006028 | Bacteria | 8010 |
| 193 | Ga0070717_10054398 | 3300006028 | Bacteria | 3301 |
| 194 | Ga0070717_10055551 | 3300006028 | Bacteria | 3268 |
| 195 | Ga0070717_10061548 | 3300006028 | Bacteria | 3111 |
| 196 | Ga0070717_10119813 | 3300006028 | Unclassified | 2253 |
| 197 | Ga0070717_10236394 | 3300006028 | Bacteria | 1610 |
| 198 | Ga0070717_10337504 | 3300006028 | Unclassified | 1345 |
| 199 | Ga0070717_10496290 | 3300006028 | Unclassified | 1103 |
| 200 | Ga0070717_10656186 | 3300006028 | Bacteria | 952 |
| 201 | Ga0070717_11170502 | 3300006028 | Bacteria | 700 |
| 202 | Ga0070715_10005301 | 3300006163 | Bacteria | 4291 |
| 203 | Ga0070715_10021699 | 3300006163 | Bacteria | 2494 |
| 204 | Ga0070715_10086442 | 3300006163 | Bacteria | 1434 |
| 205 | Ga0070715_10452082 | 3300006163 | Unclassified | 725 |
| 206 | Ga0070716_100007884 | 3300006173 | Bacteria | 5270 |
| 207 | Ga0070716_100014507 | 3300006173 | Bacteria | 4036 |
| 208 | Ga0070716_100046502 | 3300006173 | Bacteria | 2443 |
| 209 | Ga0070716_100059465 | 3300006173 | Bacteria | 2203 |
| 210 | Ga0070716_100190666 | 3300006173 | Unclassified | 1354 |
| 211 | Ga0070716_100238567 | 3300006173 | Unclassified | 1231 |
| 212 | Ga0070716_100295913 | 3300006173 | Bacteria | 1124 |
| 213 | Ga0070716_100354115 | 3300006173 | Bacteria | 1040 |
| 214 | Ga0070716_100425044 | 3300006173 | Bacteria | 962 |
| 215 | Ga0070716_100642169 | 3300006173 | Bacteria | 804 |
| 216 | Ga0070716_101224626 | 3300006173 | Unclassified | 604 |
| 217 | Ga0070712_100000706 | 3300006175 | Bacteria | 19671 |
| 218 | Ga0070712_100030065 | 3300006175 | Bacteria | 3647 |
| 219 | Ga0070712_100054133 | 3300006175 | Bacteria | 2804 |
| 220 | Ga0070712_100160782 | 3300006175 | Bacteria | 1734 |
| 221 | Ga0070712_100242325 | 3300006175 | Unclassified | 1437 |
| 222 | Ga0070712_100431446 | 3300006175 | Bacteria | 1094 |
| 223 | Ga0070712_100614855 | 3300006175 | Unclassified | 921 |
| 224 | Ga0070712_101246285 | 3300006175 | Unclassified | 647 |
| 225 | Ga0097621_100000815 | 3300006237 | Bacteria | 21996 |
| 226 | Ga0097621_100002310 | 3300006237 | Bacteria | 13062 |
| 227 | Ga0097621_100003639 | 3300006237 | Bacteria | 10649 |
| 228 | Ga0097621_100071826 | 3300006237 | Bacteria | 2861 |
| 229 | Ga0097621_100635138 | 3300006237 | Unclassified | 978 |
| 230 | Ga0097621_100897084 | 3300006237 | Unclassified | 825 |
| 231 | Ga0068871_100000014 | 3300006358 | Bacteria | 101648 |
| 232 | Ga0068871_100000048 | 3300006358 | Bacteria | 66152 |
| 233 | Ga0068871_100002644 | 3300006358 | Bacteria | 12239 |
| 234 | Ga0068871_100102906 | 3300006358 | Bacteria | 2394 |
| 235 | Ga0068871_100295554 | 3300006358 | Unclassified | 1420 |
| 236 | Ga0068871_100590210 | 3300006358 | Bacteria | 1009 |
| 237 | Ga0068871_101274802 | 3300006358 | Unclassified | 691 |
| 238 | Ga0075433_10000204 | 3300006852 | Bacteria | 33250 |
| 239 | Ga0075433_10018650 | 3300006852 | Bacteria | 5771 |
| 240 | Ga0075434_100000087 | 3300006871 | Bacteria | 50514 |
| 241 | Ga0075434_100000823 | 3300006871 | Bacteria | 24645 |
| 242 | Ga0075434_101097525 | 3300006871 | Unclassified | 809 |
| 243 | Ga0068865_100030005 | 3300006881 | Bacteria | 3613 |
| 244 | Ga0068865_100095854 | 3300006881 | Bacteria | 2162 |
| 245 | Ga0068865_101010902 | 3300006881 | Unclassified | 728 |
| 246 | Ga0075436_100000746 | 3300006914 | Bacteria | 21522 |
| 247 | Ga0075436_100006591 | 3300006914 | Bacteria | 7957 |
| 248 | Ga0075436_100079617 | 3300006914 | Bacteria | 2270 |
| 249 | Ga0075436_100178005 | 3300006914 | Bacteria | 1503 |
| 250 | Ga0097620_100004990 | 3300006931 | Bacteria | 13479 |
| 251 | Ga0075435_100000998 | 3300007076 | Bacteria | 17932 |
| 252 | Ga0075435_100114351 | 3300007076 | Bacteria | 2247 |
| 253 | Ga0099795_10012174 | 3300007788 | Bacteria | 2599 |
| 254 | Ga0099795_10273098 | 3300007788 | Unclassified | 736 |
| 255 | Ga0099795_10350103 | 3300007788 | Unclassified | 661 |
| 256 | Ga0105250_10409339 | 3300009092 | Bacteria | 603 |
| 257 | Ga0105240_10011653 | 3300009093 | Bacteria | 12222 |
| 258 | Ga0105240_10056667 | 3300009093 | Bacteria | 4903 |
| 259 | Ga0105240_10084281 | 3300009093 | Bacteria | 3897 |
| 260 | Ga0105240_10129465 | 3300009093 | Bacteria | 3029 |
| 261 | Ga0105240_10148511 | 3300009093 | Bacteria | 2794 |
| 262 | Ga0105240_10271243 | 3300009093 | Bacteria | 1953 |
| 263 | Ga0105240_10574609 | 3300009093 | Bacteria | 1244 |
| 264 | Ga0105240_11006250 | 3300009093 | Bacteria | 891 |
| 265 | Ga0105245_10064900 | 3300009098 | Bacteria | 3300 |
| 266 | Ga0105245_10263028 | 3300009098 | Bacteria | 1680 |
| 267 | Ga0105245_11784308 | 3300009098 | Bacteria | 668 |
| 268 | Ga0105247_10036207 | 3300009101 | Bacteria | 3009 |
| 269 | Ga0114129_10348935 | 3300009147 | Unclassified | 1961 |
| 270 | Ga0105241_10008984 | 3300009174 | Bacteria | 7349 |
| 271 | Ga0105241_10027802 | 3300009174 | Bacteria | 4211 |
| 272 | Ga0105241_10046051 | 3300009174 | Bacteria | 3311 |
| 273 | Ga0105241_10076168 | 3300009174 | Bacteria | 2615 |
| 274 | Ga0105241_10126144 | 3300009174 | Bacteria | 2067 |
| 275 | Ga0105241_10227314 | 3300009174 | Unclassified | 1571 |
| 276 | Ga0105241_10235132 | 3300009174 | Unclassified | 1546 |
| 277 | Ga0105241_11130102 | 3300009174 | Unclassified | 739 |
| 278 | Ga0105242_10198063 | 3300009176 | Bacteria | 1782 |
| 279 | Ga0105242_10359983 | 3300009176 | Bacteria | 1346 |
| 280 | Ga0105242_10657163 | 3300009176 | Bacteria | 1020 |
| 281 | Ga0105248_10024837 | 3300009177 | Bacteria | 6662 |
| 282 | Ga0105248_10051809 | 3300009177 | Bacteria | 4605 |
| 283 | Ga0105248_10118084 | 3300009177 | Bacteria | 2991 |
| 284 | Ga0105248_10191379 | 3300009177 | Unclassified | 2305 |
| 285 | Ga0105237_10017022 | 3300009545 | Bacteria | 7545 |
| 286 | Ga0105237_10042971 | 3300009545 | Bacteria | 4555 |
| 287 | Ga0105237_10206616 | 3300009545 | Bacteria | 1964 |
| 288 | Ga0105237_10291395 | 3300009545 | Unclassified | 1635 |
| 289 | Ga0105237_11728855 | 3300009545 | Unclassified | 633 |
| 290 | Ga0105238_10000135 | 3300009551 | Bacteria | 81026 |
| 291 | Ga0105238_10303748 | 3300009551 | Bacteria | 1580 |
| 292 | Ga0105238_10864265 | 3300009551 | Bacteria | 922 |
| 293 | Ga0105238_11322544 | 3300009551 | Bacteria | 747 |
| 294 | Ga0105249_10483911 | 3300009553 | Bacteria | 1281 |
| 295 | Ga0099796_10122148 | 3300010159 | Unclassified | 1002 |
| 296 | Ga0105239_10055738 | 3300010375 | Bacteria | 4335 |
| 297 | Ga0105239_10076881 | 3300010375 | Bacteria | 3672 |
| 298 | Ga0105239_10093774 | 3300010375 | Unclassified | 3315 |
| 299 | Ga0105246_10341213 | 3300011119 | Unclassified | 1224 |
| 300 | Ga0105246_10531679 | 3300011119 | Unclassified | 1004 |
| 301 | Ga0105246_10587727 | 3300011119 | Bacteria | 960 |
| 302 | Ga0157373_10016494 | 3300013100 | Bacteria | 5386 |
| 303 | Ga0157373_10062539 | 3300013100 | Bacteria | 2637 |
| 304 | Ga0157373_10074756 | 3300013100 | Bacteria | 2390 |
| 305 | Ga0157373_10134873 | 3300013100 | Bacteria | 1736 |
| 306 | Ga0157371_10045209 | 3300013102 | Bacteria | 3134 |
| 307 | Ga0157371_10140406 | 3300013102 | Bacteria | 1721 |
| 308 | Ga0157371_10681294 | 3300013102 | Bacteria | 769 |
| 309 | Ga0157370_10056323 | 3300013104 | Bacteria | 3742 |
| 310 | Ga0157370_10212081 | 3300013104 | Unclassified | 1795 |
| 311 | Ga0157370_10357092 | 3300013104 | Bacteria | 1347 |
| 312 | Ga0157370_10748146 | 3300013104 | Unclassified | 891 |
| 313 | Ga0157369_10000034 | 3300013105 | Bacteria | 200710 |
| 314 | Ga0157369_10003121 | 3300013105 | Bacteria | 19795 |
| 315 | Ga0157369_10029870 | 3300013105 | Bacteria | 6019 |
| 316 | Ga0157369_10053964 | 3300013105 | Bacteria | 4341 |
| 317 | Ga0157369_10077614 | 3300013105 | Bacteria | 3560 |
| 318 | Ga0157369_10106777 | 3300013105 | Bacteria | 2979 |
| 319 | Ga0157369_10185994 | 3300013105 | Bacteria | 2184 |
| 320 | Ga0157369_10255642 | 3300013105 | Unclassified | 1828 |
| 321 | Ga0157369_10323851 | 3300013105 | Unclassified | 1602 |
| 322 | Ga0157369_10339555 | 3300013105 | Bacteria | 1560 |
| 323 | Ga0157369_11434355 | 3300013105 | Bacteria | 703 |
| 324 | Ga0157374_10000112 | 3300013296 | Bacteria | 74313 |
| 325 | Ga0157374_10000183 | 3300013296 | Bacteria | 58330 |
| 326 | Ga0157374_10000210 | 3300013296 | Bacteria | 53686 |
| 327 | Ga0157374_10032743 | 3300013296 | Bacteria | 4736 |
| 328 | Ga0157374_10054096 | 3300013296 | Bacteria | 3743 |
| 329 | Ga0157374_10841086 | 3300013296 | Bacteria | 934 |
| 330 | Ga0157378_10000107 | 3300013297 | Bacteria | 79357 |
| 331 | Ga0157378_10000127 | 3300013297 | Bacteria | 74509 |
| 332 | Ga0157378_10000344 | 3300013297 | Bacteria | 45774 |
| 333 | Ga0157378_10007947 | 3300013297 | Bacteria | 9258 |
| 334 | Ga0157378_10031865 | 3300013297 | Bacteria | 4656 |
| 335 | Ga0157378_10359219 | 3300013297 | Bacteria | 1425 |
| 336 | Ga0157378_11104711 | 3300013297 | Unclassified | 830 |
| 337 | Ga0163162_10011789 | 3300013306 | Bacteria | 8525 |
| 338 | Ga0163162_10032187 | 3300013306 | Bacteria | 5206 |
| 339 | Ga0163162_10065064 | 3300013306 | Bacteria | 3692 |
| 340 | Ga0163162_11183056 | 3300013306 | Bacteria | 867 |
| 341 | Ga0157372_10000059 | 3300013307 | Bacteria | 124697 |
| 342 | Ga0157372_10000153 | 3300013307 | Bacteria | 74783 |
| 343 | Ga0157372_10000219 | 3300013307 | Bacteria | 63587 |
| 344 | Ga0157372_10022234 | 3300013307 | Bacteria | 6861 |
| 345 | Ga0157372_10022946 | 3300013307 | Bacteria | 6760 |
| 346 | Ga0157372_10029279 | 3300013307 | Bacteria | 6011 |
| 347 | Ga0157372_10036934 | 3300013307 | Bacteria | 5386 |
| 348 | Ga0157372_10077024 | 3300013307 | Bacteria | 3766 |
| 349 | Ga0157372_10140053 | 3300013307 | Bacteria | 2786 |
| 350 | Ga0157372_10438360 | 3300013307 | Unclassified | 1523 |
| 351 | Ga0157372_10728862 | 3300013307 | Bacteria | 1153 |
| 352 | Ga0157375_10035144 | 3300013308 | Bacteria | 4781 |
| 353 | Ga0163163_10219526 | 3300014325 | Unclassified | 1950 |
| 354 | Ga0163163_10327928 | 3300014325 | Bacteria | 1585 |
| 355 | Ga0163163_10404854 | 3300014325 | Bacteria | 1423 |
| 356 | Ga0163163_10518366 | 3300014325 | Unclassified | 1254 |
| 357 | Ga0163163_11375302 | 3300014325 | Unclassified | 768 |
| 358 | Ga0157380_11391924 | 3300014326 | Unclassified | 752 |
| 359 | Ga0182008_10108604 | 3300014497 | Bacteria | 1374 |
| 360 | Ga0157377_10060505 | 3300014745 | Bacteria | 2162 |
| 361 | Ga0157379_10078071 | 3300014968 | Bacteria | 2965 |
| 362 | Ga0157376_10006705 | 3300014969 | Bacteria | 8150 |
| 363 | Ga0157376_10223409 | 3300014969 | Bacteria | 1746 |
| 364 | Ga0157376_10231478 | 3300014969 | Bacteria | 1717 |
| 365 | Ga0157376_11279702 | 3300014969 | Unclassified | 763 |
| 366 | Ga0157376_12801869 | 3300014969 | Bacteria | 527 |
| 367 | Ga0182006_1063038 | 3300015261 | Bacteria | 1393 |
| 368 | Ga0182007_10049579 | 3300015262 | Unclassified | 1387 |
| 369 | Ga0213874_10030658 | 3300021377 | Unclassified | 1551 |
| 370 | Ga0224569_101080 | 3300022732 | Bacteria | 2322 |
| 371 | Ga0224571_100046 | 3300022734 | Bacteria | 4101 |
| 372 | Ga0224572_1010191 | 3300024225 | Unclassified | 1763 |
| 373 | Ga0224572_1023521 | 3300024225 | Unclassified | 1183 |
| 374 | Ga0224572_1033178 | 3300024225 | Unclassified | 982 |
| 375 | Ga0228598_1000883 | 3300024227 | Bacteria | 6489 |
| 376 | Ga0228598_1042898 | 3300024227 | Bacteria | 894 |
| 377 | Ga0207697_10164265 | 3300025315 | Bacteria | 969 |
| 378 | Ga0207656_10470494 | 3300025321 | Unclassified | 636 |
| 379 | Ga0207692_10028083 | 3300025898 | Bacteria | 2657 |
| 380 | Ga0207692_10314510 | 3300025898 | Unclassified | 957 |
| 381 | Ga0207692_10328420 | 3300025898 | Unclassified | 938 |
| 382 | Ga0207692_10529811 | 3300025898 | Unclassified | 750 |
| 383 | Ga0207642_10010730 | 3300025899 | Unclassified | 3243 |
| 384 | Ga0207642_10083382 | 3300025899 | Bacteria | 1559 |
| 385 | Ga0207710_10059430 | 3300025900 | Bacteria | 1730 |
| 386 | Ga0207647_10006365 | 3300025904 | Bacteria | 8585 |
| 387 | Ga0207647_10247857 | 3300025904 | Bacteria | 1022 |
| 388 | Ga0207685_10007553 | 3300025905 | Bacteria | 3037 |
| 389 | Ga0207685_10021473 | 3300025905 | Bacteria | 2164 |
| 390 | Ga0207685_10036248 | 3300025905 | Bacteria | 1807 |
| 391 | Ga0207685_10043052 | 3300025905 | Bacteria | 1699 |
| 392 | Ga0207685_10048347 | 3300025905 | Bacteria | 1629 |
| 393 | Ga0207699_10010814 | 3300025906 | Bacteria | 4593 |
| 394 | Ga0207699_10064326 | 3300025906 | Bacteria | 2219 |
| 395 | Ga0207699_10071962 | 3300025906 | Bacteria | 2116 |
| 396 | Ga0207699_10326374 | 3300025906 | Bacteria | 1078 |
| 397 | Ga0207699_10377333 | 3300025906 | Unclassified | 1006 |
| 398 | Ga0207699_10564230 | 3300025906 | Unclassified | 827 |
| 399 | Ga0207643_10083520 | 3300025908 | Bacteria | 1853 |
| 400 | Ga0207705_10609541 | 3300025909 | Unclassified | 849 |
| 401 | Ga0207684_10002115 | 3300025910 | Bacteria | 20363 |
| 402 | Ga0207684_10012532 | 3300025910 | Bacteria | 7368 |
| 403 | Ga0207684_10161907 | 3300025910 | Unclassified | 1927 |
| 404 | Ga0207684_10236760 | 3300025910 | Bacteria | 1575 |
| 405 | Ga0207684_10284691 | 3300025910 | Bacteria | 1425 |
| 406 | Ga0207684_11012169 | 3300025910 | Bacteria | 695 |
| 407 | Ga0207654_10009789 | 3300025911 | Bacteria | 4876 |
| 408 | Ga0207654_10118539 | 3300025911 | Unclassified | 1658 |
| 409 | Ga0207654_10135577 | 3300025911 | Unclassified | 1563 |
| 410 | Ga0207654_10190729 | 3300025911 | Bacteria | 1343 |
| 411 | Ga0207707_10007076 | 3300025912 | Bacteria | 9778 |
| 412 | Ga0207707_10187187 | 3300025912 | Bacteria | 1807 |
| 413 | Ga0207707_10461324 | 3300025912 | Bacteria | 1086 |
| 414 | Ga0207695_10040434 | 3300025913 | Bacteria | 4999 |
| 415 | Ga0207695_10042028 | 3300025913 | Bacteria | 4887 |
| 416 | Ga0207695_10109971 | 3300025913 | Bacteria | 2737 |
| 417 | Ga0207695_10387197 | 3300025913 | Bacteria | 1283 |
| 418 | Ga0207695_10732183 | 3300025913 | Bacteria | 869 |
| 419 | Ga0207671_10037257 | 3300025914 | Bacteria | 3607 |
| 420 | Ga0207671_10043424 | 3300025914 | Bacteria | 3324 |
| 421 | Ga0207671_11090352 | 3300025914 | Unclassified | 627 |
| 422 | Ga0207693_10000020 | 3300025915 | Bacteria | 132847 |
| 423 | Ga0207693_10053056 | 3300025915 | Bacteria | 3181 |
| 424 | Ga0207693_10195203 | 3300025915 | Bacteria | 1593 |
| 425 | Ga0207693_10250346 | 3300025915 | Bacteria | 1390 |
| 426 | Ga0207693_10259696 | 3300025915 | Bacteria | 1362 |
| 427 | Ga0207693_10465933 | 3300025915 | Bacteria | 987 |
| 428 | Ga0207663_10068721 | 3300025916 | Bacteria | 2277 |
| 429 | Ga0207663_10141197 | 3300025916 | Bacteria | 1678 |
| 430 | Ga0207663_10294517 | 3300025916 | Bacteria | 1210 |
| 431 | Ga0207663_10434630 | 3300025916 | Bacteria | 1010 |
| 432 | Ga0207663_10606769 | 3300025916 | Bacteria | 860 |
| 433 | Ga0207663_10615020 | 3300025916 | Unclassified | 855 |
| 434 | Ga0207663_10644367 | 3300025916 | Bacteria | 836 |
| 435 | Ga0207660_10131873 | 3300025917 | Unclassified | 1903 |
| 436 | Ga0207649_10190492 | 3300025920 | Unclassified | 1442 |
| 437 | Ga0207649_10533981 | 3300025920 | Bacteria | 896 |
| 438 | Ga0207652_10076495 | 3300025921 | Bacteria | 2919 |
| 439 | Ga0207652_10181617 | 3300025921 | Bacteria | 1891 |
| 440 | Ga0207652_10263896 | 3300025921 | Bacteria | 1553 |
| 441 | Ga0207652_10274096 | 3300025921 | Bacteria | 1522 |
| 442 | Ga0207646_10001256 | 3300025922 | Bacteria | 31771 |
| 443 | Ga0207646_10037248 | 3300025922 | Bacteria | 4386 |
| 444 | Ga0207646_10147295 | 3300025922 | Bacteria | 2122 |
| 445 | Ga0207646_10283512 | 3300025922 | Bacteria | 1497 |
| 446 | Ga0207646_10605239 | 3300025922 | Unclassified | 983 |
| 447 | Ga0207694_10000722 | 3300025924 | Bacteria | 29682 |
| 448 | Ga0207694_10335469 | 3300025924 | Unclassified | 1250 |
| 449 | Ga0207694_10524209 | 3300025924 | Unclassified | 993 |
| 450 | Ga0207694_10903875 | 3300025924 | Bacteria | 747 |
| 451 | Ga0207650_10018347 | 3300025925 | Bacteria | 4909 |
| 452 | Ga0207650_10478952 | 3300025925 | Unclassified | 1038 |
| 453 | Ga0207687_10038123 | 3300025927 | Bacteria | 3283 |
| 454 | Ga0207700_10007543 | 3300025928 | Bacteria | 6659 |
| 455 | Ga0207700_10201753 | 3300025928 | Bacteria | 1676 |
| 456 | Ga0207700_10203197 | 3300025928 | Bacteria | 1671 |
| 457 | Ga0207700_10220334 | 3300025928 | Bacteria | 1608 |
| 458 | Ga0207700_10227492 | 3300025928 | Bacteria | 1584 |
| 459 | Ga0207700_10364091 | 3300025928 | Bacteria | 1261 |
| 460 | Ga0207700_10695715 | 3300025928 | Unclassified | 907 |
| 461 | Ga0207700_11451912 | 3300025928 | Unclassified | 609 |
| 462 | Ga0207664_10004405 | 3300025929 | Bacteria | 9534 |
| 463 | Ga0207664_10044138 | 3300025929 | Bacteria | 3490 |
| 464 | Ga0207664_10238812 | 3300025929 | Bacteria | 1582 |
| 465 | Ga0207664_10296182 | 3300025929 | Bacteria | 1422 |
| 466 | Ga0207664_10402552 | 3300025929 | Bacteria | 1217 |
| 467 | Ga0207664_10747604 | 3300025929 | Bacteria | 879 |
| 468 | Ga0207664_10993767 | 3300025929 | Bacteria | 752 |
| 469 | Ga0207644_10186689 | 3300025931 | Bacteria | 1628 |
| 470 | Ga0207644_10253470 | 3300025931 | Unclassified | 1405 |
| 471 | Ga0207706_10390407 | 3300025933 | Bacteria | 1207 |
| 472 | Ga0207686_10307293 | 3300025934 | Bacteria | 1180 |
| 473 | Ga0207686_10320490 | 3300025934 | Bacteria | 1158 |
| 474 | Ga0207670_10265232 | 3300025936 | Bacteria | 1333 |
| 475 | Ga0207704_10030891 | 3300025938 | Bacteria | 3010 |
| 476 | Ga0207704_10053536 | 3300025938 | Unclassified | 2454 |
| 477 | Ga0207665_10001326 | 3300025939 | Bacteria | 16683 |
| 478 | Ga0207665_10011897 | 3300025939 | Bacteria | 5715 |
| 479 | Ga0207665_10058051 | 3300025939 | Bacteria | 2615 |
| 480 | Ga0207665_10066208 | 3300025939 | Bacteria | 2458 |
| 481 | Ga0207665_10080382 | 3300025939 | Bacteria | 2242 |
| 482 | Ga0207665_10107163 | 3300025939 | Bacteria | 1959 |
| 483 | Ga0207665_10374707 | 3300025939 | Unclassified | 1079 |
| 484 | Ga0207665_10385265 | 3300025939 | Unclassified | 1065 |
| 485 | Ga0207665_10832090 | 3300025939 | Bacteria | 730 |
| 486 | Ga0207711_10050499 | 3300025941 | Bacteria | 3561 |
| 487 | Ga0207711_10212194 | 3300025941 | Bacteria | 1768 |
| 488 | Ga0207711_10368252 | 3300025941 | Bacteria | 1332 |
| 489 | Ga0207711_10592666 | 3300025941 | Unclassified | 1034 |
| 490 | Ga0207689_10000586 | 3300025942 | Bacteria | 34709 |
| 491 | Ga0207689_10017696 | 3300025942 | Bacteria | 6022 |
| 492 | Ga0207661_10012939 | 3300025944 | Bacteria | 6087 |
| 493 | Ga0207661_10072868 | 3300025944 | Bacteria | 2811 |
| 494 | Ga0207661_10462538 | 3300025944 | Bacteria | 1156 |
| 495 | Ga0207661_10875050 | 3300025944 | Unclassified | 827 |
| 496 | Ga0207679_10001953 | 3300025945 | Bacteria | 12799 |
| 497 | Ga0207679_10577326 | 3300025945 | Unclassified | 1011 |
| 498 | Ga0207667_10002755 | 3300025949 | Bacteria | 21728 |
| 499 | Ga0207667_10003317 | 3300025949 | Bacteria | 19862 |
| 500 | Ga0207667_10015892 | 3300025949 | Bacteria | 8524 |
| 501 | Ga0207667_10112192 | 3300025949 | Bacteria | 2811 |
| 502 | Ga0207667_10181377 | 3300025949 | Unclassified | 2162 |
| 503 | Ga0207667_10366352 | 3300025949 | Unclassified | 1469 |
| 504 | Ga0207667_11469483 | 3300025949 | Unclassified | 653 |
| 505 | Ga0207640_10012268 | 3300025981 | Bacteria | 4876 |
| 506 | Ga0207640_10073636 | 3300025981 | Bacteria | 2309 |
| 507 | Ga0207640_10104847 | 3300025981 | Bacteria | 1991 |
| 508 | Ga0207640_10298615 | 3300025981 | Unclassified | 1273 |
| 509 | Ga0207677_10007230 | 3300026023 | Bacteria | 6119 |
| 510 | Ga0207677_10010319 | 3300026023 | Bacteria | 5283 |
| 511 | Ga0207677_10067381 | 3300026023 | Bacteria | 2508 |
| 512 | Ga0207677_10182709 | 3300026023 | Unclassified | 1651 |
| 513 | Ga0207677_10506830 | 3300026023 | Unclassified | 1044 |
| 514 | Ga0207703_10004306 | 3300026035 | Bacteria | 11702 |
| 515 | Ga0207703_10006757 | 3300026035 | Bacteria | 9149 |
| 516 | Ga0207703_10049368 | 3300026035 | Unclassified | 3402 |
| 517 | Ga0207703_10127012 | 3300026035 | Bacteria | 2197 |
| 518 | Ga0207703_10173401 | 3300026035 | Bacteria | 1899 |
| 519 | Ga0207703_11328108 | 3300026035 | Bacteria | 692 |
| 520 | Ga0207639_10006481 | 3300026041 | Bacteria | 7959 |
| 521 | Ga0207639_10084038 | 3300026041 | Bacteria | 2528 |
| 522 | Ga0207639_10154179 | 3300026041 | Bacteria | 1928 |
| 523 | Ga0207639_11129997 | 3300026041 | Unclassified | 735 |
| 524 | Ga0207678_10021833 | 3300026067 | Bacteria | 5615 |
| 525 | Ga0207702_10000171 | 3300026078 | Bacteria | 77495 |
| 526 | Ga0207702_10017783 | 3300026078 | Bacteria | 5884 |
| 527 | Ga0207702_10036388 | 3300026078 | Bacteria | 4117 |
| 528 | Ga0207702_10051835 | 3300026078 | Bacteria | 3470 |
| 529 | Ga0207702_10075111 | 3300026078 | Bacteria | 2919 |
| 530 | Ga0207702_10648382 | 3300026078 | Bacteria | 1038 |
| 531 | Ga0207702_10757076 | 3300026078 | Unclassified | 959 |
| 532 | Ga0207641_10020365 | 3300026088 | Bacteria | 5448 |
| 533 | Ga0207641_10053213 | 3300026088 | Bacteria | 3431 |
| 534 | Ga0207641_10205299 | 3300026088 | Bacteria | 1819 |
| 535 | Ga0207641_11496969 | 3300026088 | Unclassified | 676 |
| 536 | Ga0207648_10029658 | 3300026089 | Bacteria | 4851 |
| 537 | Ga0207648_10159325 | 3300026089 | Bacteria | 1993 |
| 538 | Ga0207676_10047882 | 3300026095 | Bacteria | 3315 |
| 539 | Ga0207676_10434431 | 3300026095 | Unclassified | 1234 |
| 540 | Ga0207674_10000126 | 3300026116 | Bacteria | 88965 |
| 541 | Ga0207674_10000230 | 3300026116 | Bacteria | 69765 |
| 542 | Ga0207674_10243817 | 3300026116 | Unclassified | 1744 |
| 543 | Ga0207683_10638437 | 3300026121 | Unclassified | 986 |
| 544 | Ga0207683_10714610 | 3300026121 | Unclassified | 929 |
| 545 | Ga0207698_10026384 | 3300026142 | Unclassified | 4109 |
| 546 | Ga0207698_10193641 | 3300026142 | Bacteria | 1814 |
| 547 | Ga0207698_10436420 | 3300026142 | Bacteria | 1261 |
| 548 | Ga0207698_11893769 | 3300026142 | Unclassified | 611 |
| 549 | Ga0265356_1011565 | 3300028017 | Bacteria | 975 |
| 550 | Ga0265356_1011992 | 3300028017 | Unclassified | 955 |
| 551 | Ga0268266_10804055 | 3300028379 | Unclassified | 908 |
| 552 | Ga0268265_10170126 | 3300028380 | Bacteria | 1861 |
| 553 | Ga0268264_10018809 | 3300028381 | Bacteria | 5649 |
| 554 | Ga0268264_10019071 | 3300028381 | Bacteria | 5608 |
| 555 | Ga0268264_10701962 | 3300028381 | Unclassified | 1005 |
| 556 | Ga0265338_10067098 | 3300028800 | Bacteria | 3101 |
| 557 | Ga0265762_1000421 | 3300030760 | Bacteria | 7339 |
| 558 | Ga0265760_10003252 | 3300031090 | Bacteria | 4762 |
| 559 | Ga0265760_10006628 | 3300031090 | Bacteria | 3312 |
| 560 | Ga0265760_10039783 | 3300031090 | Bacteria | 1400 |
| 561 | Ga0373926_0031676 | 3300035083 | Bacteria | 1865 |
| 562 | Ga0373934_0246104 | 3300035086 | Unclassified | 739 |
| 563 | Ga0373940_0112067 | 3300035088 | Bacteria | 838 |
| 564 | Ga0373944_0364099 | 3300035089 | Bacteria | 552 |
| 565 | Ga0373923_0092484 | 3300035111 | Bacteria | 1325 |
| 566 | Ga0373956_0294594 | 3300035119 | Unclassified | 773 |
| 567 | Ga0373943_0029368 | 3300035170 | Bacteria | 2597 |
| 568 | Ga0373943_0266709 | 3300035170 | Bacteria | 965 |
| 569 | Ga0373961_0036890 | 3300035241 | Bacteria | 1394 |
| 570 | Ga0373931_0062901 | 3300035691 | Bacteria | 2005 |
| 571 | Ga0373931_0102032 | 3300035691 | Bacteria | 1615 |
| 572 | Ga0373931_0162761 | 3300035691 | Bacteria | 1309 |
| 573 | Ga0373935_0155504 | 3300035692 | Bacteria | 1555 |
| 574 | Ga0373935_0564413 | 3300035692 | Unclassified | 830 |
| 575 | Ga0373935_1240014 | 3300035692 | Unclassified | 556 |
| 576 | Ga0373927_0141747 | 3300035695 | Bacteria | 1572 |
| 577 | Ga0373927_0197850 | 3300035695 | Unclassified | 1319 |
| 578 | Ga0373927_0982261 | 3300035695 | Unclassified | 557 |
| 579 | Ga0373933_0258636 | 3300035724 | Bacteria | 1122 |
| 580 | Ga0373947_0028509 | 3300035725 | Bacteria | 3275 |
| 581 | Ga0373947_0125557 | 3300035725 | Bacteria | 1634 |
| 582 | Ga0373947_0135751 | 3300035725 | Bacteria | 1574 |
| 583 | Ga0373937_0050107 | 3300036401 | Unclassified | 3824 |
| 584 | Ga0373937_0475286 | 3300036401 | Unclassified | 1187 |
| 585 | Ga0373937_0963850 | 3300036401 | Unclassified | 802 |
| 586 | Ga0373937_1213143 | 3300036401 | Bacteria | 703 |
| 587 | Ga0373937_1569103 | 3300036401 | Bacteria | 606 |
| 588 | Ga0373925_0002744 | 3300037068 | Bacteria | 13935 |
| 589 | Ga0373925_0030380 | 3300037068 | Bacteria | 3965 |
| 590 | Ga0373925_0647901 | 3300037068 | Unclassified | 870 |
| 591 | Ga0373925_0721007 | 3300037068 | Bacteria | 822 |
| 592 | Ga0395905_0045188 | 3300037471 | Bacteria | 4131 |
| 593 | Ga0395905_0076396 | 3300037471 | Bacteria | 3139 |
| 594 | Ga0395905_0103414 | 3300037471 | Bacteria | 2674 |
| 595 | Ga0395905_1386514 | 3300037471 | Unclassified | 607 |
| 596 | Ga0436364_0178451 | 3300037853 | Bacteria | 1010 |
| 597 | Ga0436364_1095476 | 3300037853 | Unclassified | 1132 |
| 598 | Ga0436365_0960820 | 3300039437 | Bacteria | 1629 |
| 599 | Ga0436365_1490804 | 3300039437 | Unclassified | 680 |
| 600 | Ga0436360_0002355 | 3300039438 | Bacteria | 1326 |
| 601 | Ga0436361_0928472 | 3300039447 | Bacteria | 1072 |
| 602 | Ga0436363_0292830 | 3300039450 | Unclassified | 607 |
| 603 | Ga0436363_0324942 | 3300039450 | Bacteria | 3830 |
| 604 | Ga0451577_0142650 | 3300042876 | Unclassified | 2153 |
| 605 | Ga0466966_0199273 | 3300044684 | Unclassified | 1212 |
| 606 | Ga0466961_0083862 | 3300044693 | Bacteria | 2016 |
| 607 | Ga0466963_0010025 | 3300044694 | Bacteria | 5728 |
| 608 | Ga0466963_0011570 | 3300044694 | Bacteria | 5373 |
| 609 | Ga0466963_0336779 | 3300044694 | Unclassified | 1062 |
| 610 | Ga0466964_0115421 | 3300044706 | Bacteria | 1203 |
| 611 | Ga0466957_0258805 | 3300044842 | Bacteria | 1159 |
| 612 | Ga0466957_0348716 | 3300044842 | Unclassified | 1004 |
| 613 | Ga0451576_0039199 | 3300045051 | Bacteria | 5014 |
| 614 | Ga0451576_0076805 | 3300045051 | Bacteria | 3476 |
| 615 | Ga0451576_0970034 | 3300045051 | Bacteria | 891 |
| 616 | Ga0451576_2606494 | 3300045051 | Unclassified | 515 |
| 617 | Ga0466958_0558409 | 3300045836 | Unclassified | 744 |
| 618 | Ga0466967_0003556 | 3300045976 | Bacteria | 10208 |
| 619 | Ga0466967_0045756 | 3300045976 | Bacteria | 3804 |
| 620 | Ga0466967_0524022 | 3300045976 | Unclassified | 1165 |
| 621 | Ga0466967_1320372 | 3300045976 | Unclassified | 718 |
| 622 | Ga0495590_0210669 | 3300046457 | Unclassified | 716 |
| 623 | Ga0495580_0000936 | 3300046472 | Bacteria | 25491 |
| 624 | Ga0495580_0013261 | 3300046472 | Bacteria | 6299 |
| 625 | Ga0495580_0014233 | 3300046472 | Bacteria | 6039 |
| 626 | Ga0495580_0036120 | 3300046472 | Bacteria | 3548 |
| 627 | Ga0495580_0203052 | 3300046472 | Archaea | 1365 |
| 628 | Ga0495580_0253611 | 3300046472 | Bacteria | 1204 |
| 629 | Ga0495580_0339885 | 3300046472 | Bacteria | 1018 |
| 630 | Ga0495580_0462830 | 3300046472 | Unclassified | 850 |
| 631 | Ga0495580_0672563 | 3300046472 | Unclassified | 679 |
| 632 | Ga0495582_0066374 | 3300046473 | Bacteria | 1993 |
| 633 | Ga0495582_0214476 | 3300046473 | Bacteria | 1101 |
| 634 | Ga0495639_0029076 | 3300046475 | Bacteria | 2452 |
| 635 | Ga0495584_0132636 | 3300046491 | Unclassified | 1264 |
| 636 | Ga0495608_0334334 | 3300046511 | Unclassified | 934 |
| 637 | Ga0495628_0681129 | 3300046516 | Bacteria | 728 |
| 638 | Ga0495630_0032207 | 3300046517 | Bacteria | 3905 |
| 639 | Ga0495666_0014306 | 3300046526 | Bacteria | 3954 |
| 640 | Ga0495587_0301291 | 3300046536 | Bacteria | 896 |
| 641 | Ga0495587_0581580 | 3300046536 | Unclassified | 617 |
| 642 | Ga0495657_0536559 | 3300046675 | Bacteria | 680 |
| 643 | Ga0495599_0722893 | 3300046678 | Unclassified | 573 |
| 644 | Ga0495669_0220482 | 3300046684 | Bacteria | 909 |
| 645 | Ga0495669_0345813 | 3300046684 | Unclassified | 719 |
| 646 | Ga0495674_0050350 | 3300047319 | Unclassified | 3676 |
| 647 | Ga0495674_0133803 | 3300047319 | Bacteria | 2088 |
| 648 | Ga0495674_0175666 | 3300047319 | Bacteria | 1785 |
| 649 | Ga0495674_0474914 | 3300047319 | Bacteria | 1003 |
| 650 | Ga0495675_0136180 | 3300047444 | Bacteria | 1524 |
| 651 | Ga0495675_0331302 | 3300047444 | Unclassified | 899 |
| 652 | Ga0495602_0087875 | 3300048088 | Bacteria | 2589 |
| 653 | Ga0496100_0016893 | 3300048903 | Bacteria | 4294 |
| 654 | Ga0496100_0068002 | 3300048903 | Unclassified | 2368 |
| 655 | Ga0496100_0238297 | 3300048903 | Unclassified | 1341 |
| 656 | Ga0496101_0249589 | 3300048904 | Bacteria | 1382 |
| 657 | Ga0496102_0060928 | 3300048905 | Bacteria | 3452 |
| 658 | Ga0496102_0119330 | 3300048905 | Bacteria | 2462 |
| 659 | Ga0496102_0416171 | 3300048905 | Unclassified | 1262 |
| 660 | Ga0496102_0539385 | 3300048905 | Unclassified | 1089 |
| 661 | Ga0496102_1120603 | 3300048905 | Bacteria | 707 |
| 662 | Ga0496103_0020673 | 3300048906 | Bacteria | 3956 |
| 663 | Ga0496103_0134917 | 3300048906 | Unclassified | 1577 |
| 664 | Ga0496104_0011263 | 3300048907 | Bacteria | 8005 |
| 665 | Ga0496104_0014124 | 3300048907 | Bacteria | 7209 |
| 666 | Ga0496104_0020787 | 3300048907 | Bacteria | 6020 |
| 667 | Ga0496104_0052992 | 3300048907 | Bacteria | 3833 |
| 668 | Ga0496104_1374951 | 3300048907 | Unclassified | 609 |
| 669 | Ga0496105_0116323 | 3300048908 | Bacteria | 2206 |
| 670 | Ga0496105_0171582 | 3300048908 | Unclassified | 1778 |
| 671 | Ga0496105_0250155 | 3300048908 | Unclassified | 1436 |
| 672 | Ga0496106_0011666 | 3300048909 | Bacteria | 6492 |
| 673 | Ga0496106_0038848 | 3300048909 | Bacteria | 3564 |
| 674 | Ga0496106_0273642 | 3300048909 | Unclassified | 1352 |
| 675 | Ga0496107_0125210 | 3300048910 | Bacteria | 1895 |
| 676 | Ga0496107_0327342 | 3300048910 | Unclassified | 1140 |
| 677 | Ga0496109_0138547 | 3300048912 | Bacteria | 2275 |
| 678 | Ga0496109_0931145 | 3300048912 | Unclassified | 807 |
| 679 | Ga0496110_0363414 | 3300048913 | Bacteria | 1319 |
| 680 | Ga0496111_0102561 | 3300048914 | Unclassified | 2103 |
| 681 | Ga0496111_0772517 | 3300048914 | Unclassified | 696 |
| 682 | Ga0496112_0009231 | 3300048915 | Bacteria | 8866 |
| 683 | Ga0496112_0011890 | 3300048915 | Bacteria | 7973 |
| 684 | Ga0496112_0012866 | 3300048915 | Bacteria | 7703 |
| 685 | Ga0496112_0023709 | 3300048915 | Bacteria | 5870 |
| 686 | Ga0496112_0028596 | 3300048915 | Bacteria | 5382 |
| 687 | Ga0496112_0170587 | 3300048915 | Bacteria | 2141 |
| 688 | Ga0496113_0064459 | 3300048916 | Bacteria | 2770 |
| 689 | Ga0496113_0675932 | 3300048916 | Bacteria | 825 |
| 690 | Ga0496114_0165662 | 3300048917 | Bacteria | 1924 |
| 691 | Ga0496114_0496908 | 3300048917 | Unclassified | 1079 |
| 692 | Ga0496115_0159831 | 3300048918 | Unclassified | 1862 |
| 693 | Ga0496115_0375320 | 3300048918 | Bacteria | 1157 |
| 694 | Ga0496115_0497636 | 3300048918 | Unclassified | 980 |
| 695 | nmdc:mga05p37_313951_c1 | 3300050507 | Unclassified | 1857 |
| 696 | nmdc:mga0n895_1001883_c1 | 3300050512 | Unclassified | 817 |
| 697 | nmdc:mga0n895_128_c1 | 3300050512 | Bacteria | 45048 |
| 698 | nmdc:mga0n895_428_c1 | 3300050512 | Bacteria | 28233 |
| 699 | nmdc:mga0n895_74040_c1 | 3300050512 | Bacteria | 3382 |
| 700 | nmdc:mga0rr50_106_c1 | 3300050513 | Bacteria | 46345 |
| 701 | nmdc:mga0rr50_1454246_c1 | 3300050513 | Unclassified | 580 |
| 702 | nmdc:mga0rr50_44679_c1 | 3300050513 | Bacteria | 3251 |
| 703 | nmdc:mga08x19_2388_c1 | 3300050514 | Bacteria | 11383 |
| 704 | nmdc:mga08x19_3180_c1 | 3300050514 | Bacteria | 9853 |
| 705 | nmdc:mga08x19_42798_c1 | 3300050514 | Bacteria | 2888 |
| 706 | nmdc:mga0a205_5600_c1 | 3300050515 | Bacteria | 11319 |
| 707 | nmdc:mga0a205_5673_c1 | 3300050515 | Bacteria | 5803 |
| 708 | Ga0495612_0197853 | 3300053078 | Bacteria | 886 |
| 709 | Ga0207699_10048889 | |||
| 710 | LJNas_1000272 | |||
| 711 | JGI24751J29686_10093839 | |||
| 712 | Ga0065712_10085279 | |||
| 713 | Ga0065712_10215806 | |||
| 714 | Ga0065715_10103416 | |||
| 715 | Ga0070683_100005566 | |||
| 716 | Ga0070683_100096613 | |||
| 717 | Ga0070683_100134957 | |||
| 718 | Ga0070683_100426329 | |||
| 719 | Ga0070690_100635624 | |||
| 720 | Ga0070670_101464008 | |||
| 721 | Ga0068869_100002370 | |||
| 722 | Ga0068869_100526688 | |||
| 723 | Ga0068869_100583491 | |||
| 724 | Ga0070680_100033598 | |||
| 725 | Ga0070682_100032214 | |||
| 726 | Ga0068868_100004794 | |||
| 727 | Ga0068868_100020961 | |||
| 728 | Ga0068868_100089504 | |||
| 729 | Ga0068868_100707534 | |||
| 730 | Ga0070660_100023194 | |||
| 731 | Ga0070689_100103270 | |||
| 732 | Ga0070689_100103431 | |||
| 733 | Ga0070691_10230677 | |||
| 734 | Ga0070687_100057813 | |||
| 735 | Ga0070661_100050967 | |||
| 736 | Ga0070661_100633111 | |||
| 737 | Ga0070669_100520407 | |||
| 738 | Ga0070675_101423635 | |||
| 739 | Ga0070671_100341399 | |||
| 740 | Ga0070673_102112382 | |||
| 741 | Ga0070688_100111838 | |||
| 742 | Ga0070709_10022872 | |||
| 743 | Ga0070709_10039598 | |||
| 744 | Ga0070709_10051506 | |||
| 745 | Ga0070709_10052759 | |||
| 746 | Ga0070709_10062417 | |||
| 747 | Ga0070709_10162080 | |||
| 748 | Ga0070709_10171836 | |||
| 749 | Ga0070709_10231907 | |||
| 750 | Ga0070709_10639471 | |||
| 751 | Ga0070714_100006809 | |||
| 752 | Ga0070714_100043931 | |||
| 753 | Ga0070714_100076844 | |||
| 754 | Ga0070714_100173340 | |||
| 755 | Ga0070714_100176732 | |||
| 756 | Ga0070714_100182981 | |||
| 757 | Ga0070714_100219157 | |||
| 758 | Ga0070714_100251674 | |||
| 759 | Ga0070714_100374507 | |||
| 760 | Ga0070714_100515773 | |||
| 761 | Ga0070714_100528679 | |||
| 762 | Ga0070713_100003409 | |||
| 763 | Ga0070713_100011360 | |||
| 764 | Ga0070713_100079361 | |||
| 765 | Ga0070713_100079989 | |||
| 766 | Ga0070713_100124500 | |||
| 767 | Ga0070713_100136726 | |||
| 768 | Ga0070713_100275945 | |||
| 769 | Ga0070713_100734208 | |||
| 770 | Ga0070710_10013298 | |||
| 771 | Ga0070710_10647707 | |||
| 772 | Ga0070711_100007702 | |||
| 773 | Ga0070711_100267695 | |||
| 774 | Ga0070711_100545682 | |||
| 775 | Ga0070711_100731388 | |||
| 776 | Ga0070711_100778055 | |||
| 777 | Ga0070711_100962818 | |||
| 778 | Ga0070711_101477662 | |||
| 779 | Ga0070708_100000589 | |||
| 780 | Ga0070708_100002277 | |||
| 781 | Ga0070708_100020036 | |||
| 782 | Ga0070708_100022011 | |||
| 783 | Ga0070708_100082620 | |||
| 784 | Ga0070708_100529372 | |||
| 785 | Ga0070708_100665840 | |||
| 786 | Ga0070663_100124783 | |||
| 787 | Ga0070678_100607077 | |||
| 788 | Ga0070662_100041416 | |||
| 789 | Ga0070681_10000541 | |||
| 790 | Ga0070681_10071843 | |||
| 791 | Ga0070681_10181016 | |||
| 792 | Ga0070681_10270643 | |||
| 793 | Ga0070681_10295606 | |||
| 794 | Ga0068867_100001820 | |||
| 795 | Ga0068867_100140020 | |||
| 796 | Ga0068867_100162772 | |||
| 797 | Ga0068867_100213106 | |||
| 798 | Ga0070685_10042283 | |||
| 799 | Ga0070706_100000419 | |||
| 800 | Ga0070706_100003128 | |||
| 801 | Ga0070706_100045075 | |||
| 802 | Ga0070706_100321027 | |||
| 803 | Ga0070706_100429665 | |||
| 804 | Ga0070706_100861298 | |||
| 805 | Ga0070706_100896775 | |||
| 806 | Ga0070706_101235139 | |||
| 807 | Ga0070707_100002885 | |||
| 808 | Ga0070707_100101604 | |||
| 809 | Ga0070707_100157406 | |||
| 810 | Ga0070707_100264679 | |||
| 811 | Ga0070707_100846518 | |||
| 812 | Ga0070698_100000809 | |||
| 813 | Ga0070698_100177613 | |||
| 814 | Ga0070698_100567769 | |||
| 815 | Ga0070699_100003819 | |||
| 816 | Ga0070699_100028521 | |||
| 817 | Ga0070699_100064484 | |||
| 818 | Ga0070699_100096949 | |||
| 819 | Ga0070699_100192852 | |||
| 820 | Ga0070699_100380405 | |||
| 821 | Ga0070679_100003227 | |||
| 822 | Ga0070679_100050666 | |||
| 823 | Ga0070679_100169084 | |||
| 824 | Ga0070679_100214016 | |||
| 825 | Ga0070679_100337721 | |||
| 826 | Ga0070684_100065092 | |||
| 827 | Ga0070684_100670229 | |||
| 828 | Ga0070697_100000821 | |||
| 829 | Ga0070697_100001136 | |||
| 830 | Ga0070697_100002177 | |||
| 831 | Ga0070697_100007613 | |||
| 832 | Ga0070697_100011172 | |||
| 833 | Ga0070697_100100583 | |||
| 834 | Ga0070697_100193964 | |||
| 835 | Ga0070697_100473707 | |||
| 836 | Ga0068853_100015570 | |||
| 837 | Ga0068853_100099902 | |||
| 838 | Ga0068853_100180935 | |||
| 839 | Ga0068853_100511266 | |||
| 840 | Ga0068853_100549681 | |||
| 841 | Ga0070695_100182454 | |||
| 842 | Ga0070695_100934097 | |||
| 843 | Ga0070693_100017958 | |||
| 844 | Ga0070693_100045848 | |||
| 845 | Ga0070693_100078106 | |||
| 846 | Ga0070693_100844016 | |||
| 847 | Ga0070665_100678152 | |||
| 848 | Ga0070665_101916853 | |||
| 849 | Ga0070704_100505438 | |||
| 850 | Ga0068855_100000427 | |||
| 851 | Ga0068855_100003386 | |||
| 852 | Ga0068855_100005274 | |||
| 853 | Ga0068855_100069772 | |||
| 854 | Ga0068855_100201805 | |||
| 855 | Ga0068855_100220676 | |||
| 856 | Ga0068855_101113689 | |||
| 857 | Ga0068855_101530868 | |||
| 858 | Ga0070664_100001749 | |||
| 859 | Ga0070664_100058147 | |||
| 860 | Ga0068857_100000136 | |||
| 861 | Ga0068857_100000352 | |||
| 862 | Ga0068857_101156089 | |||
| 863 | Ga0068854_100006132 | |||
| 864 | Ga0068854_100557841 | |||
| 865 | Ga0068856_100000493 | |||
| 866 | Ga0068856_100000913 | |||
| 867 | Ga0068856_100003688 | |||
| 868 | Ga0068856_100006174 | |||
| 869 | Ga0068856_100037127 | |||
| 870 | Ga0068856_100086860 | |||
| 871 | Ga0068856_100553295 | |||
| 872 | Ga0068856_100828474 | |||
| 873 | Ga0070702_100293866 | |||
| 874 | Ga0068852_100221865 | |||
| 875 | Ga0068852_100238645 | |||
| 876 | Ga0068852_100343651 | |||
| 877 | Ga0068852_101198171 | |||
| 878 | Ga0068859_100004990 | |||
| 879 | Ga0068864_100006267 | |||
| 880 | Ga0068866_10112071 | |||
| 881 | Ga0068866_10139136 | |||
| 882 | Ga0068870_10085270 | |||
| 883 | Ga0068863_100043652 | |||
| 884 | Ga0068863_100205518 | |||
| 885 | Ga0068863_101239771 | |||
| 886 | Ga0068858_100004899 | |||
| 887 | Ga0068858_100006486 | |||
| 888 | Ga0068858_100012689 | |||
| 889 | Ga0068858_100150059 | |||
| 890 | Ga0068858_100193273 | |||
| 891 | Ga0068858_100276002 | |||
| 892 | Ga0068858_100486607 | |||
| 893 | Ga0068858_100782404 | |||
| 894 | Ga0068860_100165500 | |||
| 895 | Ga0068860_100228207 | |||
| 896 | Ga0068860_100749590 | |||
| 897 | Ga0068860_100902756 | |||
| 898 | Ga0081540_1033718 | |||
| 899 | Ga0081540_1112660 | |||
| 900 | Ga0070717_10007704 | |||
| 901 | Ga0070717_10054398 | |||
| 902 | Ga0070717_10055551 | |||
| 903 | Ga0070717_10061548 | |||
| 904 | Ga0070717_10119813 | |||
| 905 | Ga0070717_10236394 | |||
| 906 | Ga0070717_10337504 | |||
| 907 | Ga0070717_10496290 | |||
| 908 | Ga0070717_10656186 | |||
| 909 | Ga0070717_11170502 | |||
| 910 | Ga0070715_10005301 | |||
| 911 | Ga0070715_10021699 | |||
| 912 | Ga0070715_10086442 | |||
| 913 | Ga0070715_10452082 | |||
| 914 | Ga0070716_100007884 | |||
| 915 | Ga0070716_100014507 | |||
| 916 | Ga0070716_100046502 | |||
| 917 | Ga0070716_100059465 | |||
| 918 | Ga0070716_100190666 | |||
| 919 | Ga0070716_100238567 | |||
| 920 | Ga0070716_100295913 | |||
| 921 | Ga0070716_100354115 | |||
| 922 | Ga0070716_100425044 | |||
| 923 | Ga0070716_100642169 | |||
| 924 | Ga0070716_101224626 | |||
| 925 | Ga0070712_100000706 | |||
| 926 | Ga0070712_100030065 | |||
| 927 | Ga0070712_100054133 | |||
| 928 | Ga0070712_100160782 | |||
| 929 | Ga0070712_100242325 | |||
| 930 | Ga0070712_100431446 | |||
| 931 | Ga0070712_100614855 | |||
| 932 | Ga0070712_101246285 | |||
| 933 | Ga0097621_100000815 | |||
| 934 | Ga0097621_100002310 | |||
| 935 | Ga0097621_100003639 | |||
| 936 | Ga0097621_100071826 | |||
| 937 | Ga0097621_100635138 | |||
| 938 | Ga0097621_100897084 | |||
| 939 | Ga0068871_100000014 | |||
| 940 | Ga0068871_100000048 | |||
| 941 | Ga0068871_100002644 | |||
| 942 | Ga0068871_100102906 | |||
| 943 | Ga0068871_100295554 | |||
| 944 | Ga0068871_100590210 | |||
| 945 | Ga0068871_101274802 | |||
| 946 | Ga0075433_10000204 | |||
| 947 | Ga0075433_10018650 | |||
| 948 | Ga0075434_100000087 | |||
| 949 | Ga0075434_100000823 | |||
| 950 | Ga0075434_101097525 | |||
| 951 | Ga0068865_100030005 | |||
| 952 | Ga0068865_100095854 | |||
| 953 | Ga0068865_101010902 | |||
| 954 | Ga0075436_100000746 | |||
| 955 | Ga0075436_100006591 | |||
| 956 | Ga0075436_100079617 | |||
| 957 | Ga0075436_100178005 | |||
| 958 | Ga0097620_100004990 | |||
| 959 | Ga0075435_100000998 | |||
| 960 | Ga0075435_100114351 | |||
| 961 | Ga0099795_10012174 | |||
| 962 | Ga0099795_10273098 | |||
| 963 | Ga0099795_10350103 | |||
| 964 | Ga0105250_10409339 | |||
| 965 | Ga0105240_10011653 | |||
| 966 | Ga0105240_10056667 | |||
| 967 | Ga0105240_10084281 | |||
| 968 | Ga0105240_10129465 | |||
| 969 | Ga0105240_10148511 | |||
| 970 | Ga0105240_10271243 | |||
| 971 | Ga0105240_10574609 | |||
| 972 | Ga0105240_11006250 | |||
| 973 | Ga0105245_10064900 | |||
| 974 | Ga0105245_10263028 | |||
| 975 | Ga0105245_11784308 | |||
| 976 | Ga0105247_10036207 | |||
| 977 | Ga0114129_10348935 | |||
| 978 | Ga0105241_10008984 | |||
| 979 | Ga0105241_10027802 | |||
| 980 | Ga0105241_10046051 | |||
| 981 | Ga0105241_10076168 | |||
| 982 | Ga0105241_10126144 | |||
| 983 | Ga0105241_10227314 | |||
| 984 | Ga0105241_10235132 | |||
| 985 | Ga0105241_11130102 | |||
| 986 | Ga0105242_10198063 | |||
| 987 | Ga0105242_10359983 | |||
| 988 | Ga0105242_10657163 | |||
| 989 | Ga0105248_10024837 | |||
| 990 | Ga0105248_10051809 | |||
| 991 | Ga0105248_10118084 | |||
| 992 | Ga0105248_10191379 | |||
| 993 | Ga0105237_10017022 | |||
| 994 | Ga0105237_10042971 | |||
| 995 | Ga0105237_10206616 | |||
| 996 | Ga0105237_10291395 | |||
| 997 | Ga0105237_11728855 | |||
| 998 | Ga0105238_10000135 | |||
| 999 | Ga0105238_10303748 | |||
| 1000 | Ga0105238_10864265 | |||
| 1001 | Ga0105238_11322544 | |||
| 1002 | Ga0105249_10483911 | |||
| 1003 | Ga0099796_10122148 | |||
| 1004 | Ga0105239_10055738 | |||
| 1005 | Ga0105239_10076881 | |||
| 1006 | Ga0105239_10093774 | |||
| 1007 | Ga0105246_10341213 | |||
| 1008 | Ga0105246_10531679 | |||
| 1009 | Ga0105246_10587727 | |||
| 1010 | Ga0157373_10016494 | |||
| 1011 | Ga0157373_10062539 | |||
| 1012 | Ga0157373_10074756 | |||
| 1013 | Ga0157373_10134873 | |||
| 1014 | Ga0157371_10045209 | |||
| 1015 | Ga0157371_10140406 | |||
| 1016 | Ga0157371_10681294 | |||
| 1017 | Ga0157370_10056323 | |||
| 1018 | Ga0157370_10212081 | |||
| 1019 | Ga0157370_10357092 | |||
| 1020 | Ga0157370_10748146 | |||
| 1021 | Ga0157369_10000034 | |||
| 1022 | Ga0157369_10003121 | |||
| 1023 | Ga0157369_10029870 | |||
| 1024 | Ga0157369_10053964 | |||
| 1025 | Ga0157369_10077614 | |||
| 1026 | Ga0157369_10106777 | |||
| 1027 | Ga0157369_10185994 | |||
| 1028 | Ga0157369_10255642 | |||
| 1029 | Ga0157369_10323851 | |||
| 1030 | Ga0157369_10339555 | |||
| 1031 | Ga0157369_11434355 | |||
| 1032 | Ga0157374_10000112 | |||
| 1033 | Ga0157374_10000183 | |||
| 1034 | Ga0157374_10000210 | |||
| 1035 | Ga0157374_10032743 | |||
| 1036 | Ga0157374_10054096 | |||
| 1037 | Ga0157374_10841086 | |||
| 1038 | Ga0157378_10000107 | |||
| 1039 | Ga0157378_10000127 | |||
| 1040 | Ga0157378_10000344 | |||
| 1041 | Ga0157378_10007947 | |||
| 1042 | Ga0157378_10031865 | |||
| 1043 | Ga0157378_10359219 | |||
| 1044 | Ga0157378_11104711 | |||
| 1045 | Ga0163162_10011789 | |||
| 1046 | Ga0163162_10032187 | |||
| 1047 | Ga0163162_10065064 | |||
| 1048 | Ga0163162_11183056 | |||
| 1049 | Ga0157372_10000059 | |||
| 1050 | Ga0157372_10000153 | |||
| 1051 | Ga0157372_10000219 | |||
| 1052 | Ga0157372_10022234 | |||
| 1053 | Ga0157372_10022946 | |||
| 1054 | Ga0157372_10029279 | |||
| 1055 | Ga0157372_10036934 | |||
| 1056 | Ga0157372_10077024 | |||
| 1057 | Ga0157372_10140053 | |||
| 1058 | Ga0157372_10438360 | |||
| 1059 | Ga0157372_10728862 | |||
| 1060 | Ga0157375_10035144 | |||
| 1061 | Ga0163163_10219526 | |||
| 1062 | Ga0163163_10327928 | |||
| 1063 | Ga0163163_10404854 | |||
| 1064 | Ga0163163_10518366 | |||
| 1065 | Ga0163163_11375302 | |||
| 1066 | Ga0157380_11391924 | |||
| 1067 | Ga0182008_10108604 | |||
| 1068 | Ga0157377_10060505 | |||
| 1069 | Ga0157379_10078071 | |||
| 1070 | Ga0157376_10006705 | |||
| 1071 | Ga0157376_10223409 | |||
| 1072 | Ga0157376_10231478 | |||
| 1073 | Ga0157376_11279702 | |||
| 1074 | Ga0157376_12801869 | |||
| 1075 | Ga0182006_1063038 | |||
| 1076 | Ga0182007_10049579 | |||
| 1077 | Ga0213874_10030658 | |||
| 1078 | Ga0224569_101080 | |||
| 1079 | Ga0224571_100046 | |||
| 1080 | Ga0224572_1010191 | |||
| 1081 | Ga0224572_1023521 | |||
| 1082 | Ga0224572_1033178 | |||
| 1083 | Ga0228598_1000883 | |||
| 1084 | Ga0228598_1042898 | |||
| 1085 | Ga0207697_10164265 | |||
| 1086 | Ga0207656_10470494 | |||
| 1087 | Ga0207692_10028083 | |||
| 1088 | Ga0207692_10314510 | |||
| 1089 | Ga0207692_10328420 | |||
| 1090 | Ga0207692_10529811 | |||
| 1091 | Ga0207642_10010730 | |||
| 1092 | Ga0207642_10083382 | |||
| 1093 | Ga0207710_10059430 | |||
| 1094 | Ga0207647_10006365 | |||
| 1095 | Ga0207647_10247857 | |||
| 1096 | Ga0207685_10007553 | |||
| 1097 | Ga0207685_10021473 | |||
| 1098 | Ga0207685_10036248 | |||
| 1099 | Ga0207685_10043052 | |||
| 1100 | Ga0207685_10048347 | |||
| 1101 | Ga0207699_10010814 | |||
| 1102 | Ga0207699_10064326 | |||
| 1103 | Ga0207699_10071962 | |||
| 1104 | Ga0207699_10326374 | |||
| 1105 | Ga0207699_10377333 | |||
| 1106 | Ga0207699_10564230 | |||
| 1107 | Ga0207643_10083520 | |||
| 1108 | Ga0207705_10609541 | |||
| 1109 | Ga0207684_10002115 | |||
| 1110 | Ga0207684_10012532 | |||
| 1111 | Ga0207684_10161907 | |||
| 1112 | Ga0207684_10236760 | |||
| 1113 | Ga0207684_10284691 | |||
| 1114 | Ga0207684_11012169 | |||
| 1115 | Ga0207654_10009789 | |||
| 1116 | Ga0207654_10118539 | |||
| 1117 | Ga0207654_10135577 | |||
| 1118 | Ga0207654_10190729 | |||
| 1119 | Ga0207707_10007076 | |||
| 1120 | Ga0207707_10187187 | |||
| 1121 | Ga0207707_10461324 | |||
| 1122 | Ga0207695_10040434 | |||
| 1123 | Ga0207695_10042028 | |||
| 1124 | Ga0207695_10109971 | |||
| 1125 | Ga0207695_10387197 | |||
| 1126 | Ga0207695_10732183 | |||
| 1127 | Ga0207671_10037257 | |||
| 1128 | Ga0207671_10043424 | |||
| 1129 | Ga0207671_11090352 | |||
| 1130 | Ga0207693_10000020 | |||
| 1131 | Ga0207693_10053056 | |||
| 1132 | Ga0207693_10195203 | |||
| 1133 | Ga0207693_10250346 | |||
| 1134 | Ga0207693_10259696 | |||
| 1135 | Ga0207693_10465933 | |||
| 1136 | Ga0207663_10068721 | |||
| 1137 | Ga0207663_10141197 | |||
| 1138 | Ga0207663_10294517 | |||
| 1139 | Ga0207663_10434630 | |||
| 1140 | Ga0207663_10606769 | |||
| 1141 | Ga0207663_10615020 | |||
| 1142 | Ga0207663_10644367 | |||
| 1143 | Ga0207660_10131873 | |||
| 1144 | Ga0207649_10190492 | |||
| 1145 | Ga0207649_10533981 | |||
| 1146 | Ga0207652_10076495 | |||
| 1147 | Ga0207652_10181617 | |||
| 1148 | Ga0207652_10263896 | |||
| 1149 | Ga0207652_10274096 | |||
| 1150 | Ga0207646_10001256 | |||
| 1151 | Ga0207646_10037248 | |||
| 1152 | Ga0207646_10147295 | |||
| 1153 | Ga0207646_10283512 | |||
| 1154 | Ga0207646_10605239 | |||
| 1155 | Ga0207694_10000722 | |||
| 1156 | Ga0207694_10335469 | |||
| 1157 | Ga0207694_10524209 | |||
| 1158 | Ga0207694_10903875 | |||
| 1159 | Ga0207650_10018347 | |||
| 1160 | Ga0207650_10478952 | |||
| 1161 | Ga0207687_10038123 | |||
| 1162 | Ga0207700_10007543 | |||
| 1163 | Ga0207700_10201753 | |||
| 1164 | Ga0207700_10203197 | |||
| 1165 | Ga0207700_10220334 | |||
| 1166 | Ga0207700_10227492 | |||
| 1167 | Ga0207700_10364091 | |||
| 1168 | Ga0207700_10695715 | |||
| 1169 | Ga0207700_11451912 | |||
| 1170 | Ga0207664_10004405 | |||
| 1171 | Ga0207664_10044138 | |||
| 1172 | Ga0207664_10238812 | |||
| 1173 | Ga0207664_10296182 | |||
| 1174 | Ga0207664_10402552 | |||
| 1175 | Ga0207664_10747604 | |||
| 1176 | Ga0207664_10993767 | |||
| 1177 | Ga0207644_10186689 | |||
| 1178 | Ga0207644_10253470 | |||
| 1179 | Ga0207706_10390407 | |||
| 1180 | Ga0207686_10307293 | |||
| 1181 | Ga0207686_10320490 | |||
| 1182 | Ga0207670_10265232 | |||
| 1183 | Ga0207704_10030891 | |||
| 1184 | Ga0207704_10053536 | |||
| 1185 | Ga0207665_10001326 | |||
| 1186 | Ga0207665_10011897 | |||
| 1187 | Ga0207665_10058051 | |||
| 1188 | Ga0207665_10066208 | |||
| 1189 | Ga0207665_10080382 | |||
| 1190 | Ga0207665_10107163 | |||
| 1191 | Ga0207665_10374707 | |||
| 1192 | Ga0207665_10385265 | |||
| 1193 | Ga0207665_10832090 | |||
| 1194 | Ga0207711_10050499 | |||
| 1195 | Ga0207711_10212194 | |||
| 1196 | Ga0207711_10368252 | |||
| 1197 | Ga0207711_10592666 | |||
| 1198 | Ga0207689_10000586 | |||
| 1199 | Ga0207689_10017696 | |||
| 1200 | Ga0207661_10012939 | |||
| 1201 | Ga0207661_10072868 | |||
| 1202 | Ga0207661_10462538 | |||
| 1203 | Ga0207661_10875050 | |||
| 1204 | Ga0207679_10001953 | |||
| 1205 | Ga0207679_10577326 | |||
| 1206 | Ga0207667_10002755 | |||
| 1207 | Ga0207667_10003317 | |||
| 1208 | Ga0207667_10015892 | |||
| 1209 | Ga0207667_10112192 | |||
| 1210 | Ga0207667_10181377 | |||
| 1211 | Ga0207667_10366352 | |||
| 1212 | Ga0207667_11469483 | |||
| 1213 | Ga0207640_10012268 | |||
| 1214 | Ga0207640_10073636 | |||
| 1215 | Ga0207640_10104847 | |||
| 1216 | Ga0207640_10298615 | |||
| 1217 | Ga0207677_10007230 | |||
| 1218 | Ga0207677_10010319 | |||
| 1219 | Ga0207677_10067381 | |||
| 1220 | Ga0207677_10182709 | |||
| 1221 | Ga0207677_10506830 | |||
| 1222 | Ga0207703_10004306 | |||
| 1223 | Ga0207703_10006757 | |||
| 1224 | Ga0207703_10049368 | |||
| 1225 | Ga0207703_10127012 | |||
| 1226 | Ga0207703_10173401 | |||
| 1227 | Ga0207703_11328108 | |||
| 1228 | Ga0207639_10006481 | |||
| 1229 | Ga0207639_10084038 | |||
| 1230 | Ga0207639_10154179 | |||
| 1231 | Ga0207639_11129997 | |||
| 1232 | Ga0207678_10021833 | |||
| 1233 | Ga0207702_10000171 | |||
| 1234 | Ga0207702_10017783 | |||
| 1235 | Ga0207702_10036388 | |||
| 1236 | Ga0207702_10051835 | |||
| 1237 | Ga0207702_10075111 | |||
| 1238 | Ga0207702_10648382 | |||
| 1239 | Ga0207702_10757076 | |||
| 1240 | Ga0207641_10020365 | |||
| 1241 | Ga0207641_10053213 | |||
| 1242 | Ga0207641_10205299 | |||
| 1243 | Ga0207641_11496969 | |||
| 1244 | Ga0207648_10029658 | |||
| 1245 | Ga0207648_10159325 | |||
| 1246 | Ga0207676_10047882 | |||
| 1247 | Ga0207676_10434431 | |||
| 1248 | Ga0207674_10000126 | |||
| 1249 | Ga0207674_10000230 | |||
| 1250 | Ga0207674_10243817 | |||
| 1251 | Ga0207683_10638437 | |||
| 1252 | Ga0207683_10714610 | |||
| 1253 | Ga0207698_10026384 | |||
| 1254 | Ga0207698_10193641 | |||
| 1255 | Ga0207698_10436420 | |||
| 1256 | Ga0207698_11893769 | |||
| 1257 | Ga0265356_1011565 | |||
| 1258 | Ga0265356_1011992 | |||
| 1259 | Ga0268266_10804055 | |||
| 1260 | Ga0268265_10170126 | |||
| 1261 | Ga0268264_10018809 | |||
| 1262 | Ga0268264_10019071 | |||
| 1263 | Ga0268264_10701962 | |||
| 1264 | Ga0265338_10067098 | |||
| 1265 | Ga0265762_1000421 | |||
| 1266 | Ga0265760_10003252 | |||
| 1267 | Ga0265760_10006628 | |||
| 1268 | Ga0265760_10039783 | |||
| 1269 | Ga0373926_0031676 | |||
| 1270 | Ga0373934_0246104 | |||
| 1271 | Ga0373940_0112067 | |||
| 1272 | Ga0373944_0364099 | |||
| 1273 | Ga0373923_0092484 | |||
| 1274 | Ga0373956_0294594 | |||
| 1275 | Ga0373943_0029368 | |||
| 1276 | Ga0373943_0266709 | |||
| 1277 | Ga0373961_0036890 | |||
| 1278 | Ga0373931_0062901 | |||
| 1279 | Ga0373931_0102032 | |||
| 1280 | Ga0373931_0162761 | |||
| 1281 | Ga0373935_0155504 | |||
| 1282 | Ga0373935_0564413 | |||
| 1283 | Ga0373935_1240014 | |||
| 1284 | Ga0373927_0141747 | |||
| 1285 | Ga0373927_0197850 | |||
| 1286 | Ga0373927_0982261 | |||
| 1287 | Ga0373933_0258636 | |||
| 1288 | Ga0373947_0028509 | |||
| 1289 | Ga0373947_0125557 | |||
| 1290 | Ga0373947_0135751 | |||
| 1291 | Ga0373937_0050107 | |||
| 1292 | Ga0373937_0475286 | |||
| 1293 | Ga0373937_0963850 | |||
| 1294 | Ga0373937_1213143 | |||
| 1295 | Ga0373937_1569103 | |||
| 1296 | Ga0373925_0002744 | |||
| 1297 | Ga0373925_0030380 | |||
| 1298 | Ga0373925_0647901 | |||
| 1299 | Ga0373925_0721007 | |||
| 1300 | Ga0395905_0045188 | |||
| 1301 | Ga0395905_0076396 | |||
| 1302 | Ga0395905_0103414 | |||
| 1303 | Ga0395905_1386514 | |||
| 1304 | Ga0436364_0178451 | |||
| 1305 | Ga0436364_1095476 | |||
| 1306 | Ga0436365_0960820 | |||
| 1307 | Ga0436365_1490804 | |||
| 1308 | Ga0436360_0002355 | |||
| 1309 | Ga0436361_0928472 | |||
| 1310 | Ga0436363_0292830 | |||
| 1311 | Ga0436363_0324942 | |||
| 1312 | Ga0451577_0142650 | |||
| 1313 | Ga0466966_0199273 | |||
| 1314 | Ga0466961_0083862 | |||
| 1315 | Ga0466963_0010025 | |||
| 1316 | Ga0466963_0011570 | |||
| 1317 | Ga0466963_0336779 | |||
| 1318 | Ga0466964_0115421 | |||
| 1319 | Ga0466957_0258805 | |||
| 1320 | Ga0466957_0348716 | |||
| 1321 | Ga0451576_0039199 | |||
| 1322 | Ga0451576_0076805 | |||
| 1323 | Ga0451576_0970034 | |||
| 1324 | Ga0451576_2606494 | |||
| 1325 | Ga0466958_0558409 | |||
| 1326 | Ga0466967_0003556 | |||
| 1327 | Ga0466967_0045756 | |||
| 1328 | Ga0466967_0524022 | |||
| 1329 | Ga0466967_1320372 | |||
| 1330 | Ga0495590_0210669 | |||
| 1331 | Ga0495580_0000936 | |||
| 1332 | Ga0495580_0013261 | |||
| 1333 | Ga0495580_0014233 | |||
| 1334 | Ga0495580_0036120 | |||
| 1335 | Ga0495580_0203052 | |||
| 1336 | Ga0495580_0253611 | |||
| 1337 | Ga0495580_0339885 | |||
| 1338 | Ga0495580_0462830 | |||
| 1339 | Ga0495580_0672563 | |||
| 1340 | Ga0495582_0066374 | |||
| 1341 | Ga0495582_0214476 | |||
| 1342 | Ga0495639_0029076 | |||
| 1343 | Ga0495584_0132636 | |||
| 1344 | Ga0495608_0334334 | |||
| 1345 | Ga0495628_0681129 | |||
| 1346 | Ga0495630_0032207 | |||
| 1347 | Ga0495666_0014306 | |||
| 1348 | Ga0495587_0301291 | |||
| 1349 | Ga0495587_0581580 | |||
| 1350 | Ga0495657_0536559 | |||
| 1351 | Ga0495599_0722893 | |||
| 1352 | Ga0495669_0220482 | |||
| 1353 | Ga0495669_0345813 | |||
| 1354 | Ga0495674_0050350 | |||
| 1355 | Ga0495674_0133803 | |||
| 1356 | Ga0495674_0175666 | |||
| 1357 | Ga0495674_0474914 | |||
| 1358 | Ga0495675_0136180 | |||
| 1359 | Ga0495675_0331302 | |||
| 1360 | Ga0495602_0087875 | |||
| 1361 | Ga0496100_0016893 | |||
| 1362 | Ga0496100_0068002 | |||
| 1363 | Ga0496100_0238297 | |||
| 1364 | Ga0496101_0249589 | |||
| 1365 | Ga0496102_0060928 | |||
| 1366 | Ga0496102_0119330 | |||
| 1367 | Ga0496102_0416171 | |||
| 1368 | Ga0496102_0539385 | |||
| 1369 | Ga0496102_1120603 | |||
| 1370 | Ga0496103_0020673 | |||
| 1371 | Ga0496103_0134917 | |||
| 1372 | Ga0496104_0011263 | |||
| 1373 | Ga0496104_0014124 | |||
| 1374 | Ga0496104_0020787 | |||
| 1375 | Ga0496104_0052992 | |||
| 1376 | Ga0496104_1374951 | |||
| 1377 | Ga0496105_0116323 | |||
| 1378 | Ga0496105_0171582 | |||
| 1379 | Ga0496105_0250155 | |||
| 1380 | Ga0496106_0011666 | |||
| 1381 | Ga0496106_0038848 | |||
| 1382 | Ga0496106_0273642 | |||
| 1383 | Ga0496107_0125210 | |||
| 1384 | Ga0496107_0327342 | |||
| 1385 | Ga0496109_0138547 | |||
| 1386 | Ga0496109_0931145 | |||
| 1387 | Ga0496110_0363414 | |||
| 1388 | Ga0496111_0102561 | |||
| 1389 | Ga0496111_0772517 | |||
| 1390 | Ga0496112_0009231 | |||
| 1391 | Ga0496112_0011890 | |||
| 1392 | Ga0496112_0012866 | |||
| 1393 | Ga0496112_0023709 | |||
| 1394 | Ga0496112_0028596 | |||
| 1395 | Ga0496112_0170587 | |||
| 1396 | Ga0496113_0064459 | |||
| 1397 | Ga0496113_0675932 | |||
| 1398 | Ga0496114_0165662 | |||
| 1399 | Ga0496114_0496908 | |||
| 1400 | Ga0496115_0159831 | |||
| 1401 | Ga0496115_0375320 | |||
| 1402 | Ga0496115_0497636 | |||
| 1403 | nmdc:mga05p37_313951_c1 | |||
| 1404 | nmdc:mga0n895_1001883_c1 | |||
| 1405 | nmdc:mga0n895_128_c1 | |||
| 1406 | nmdc:mga0n895_428_c1 | |||
| 1407 | nmdc:mga0n895_74040_c1 | |||
| 1408 | nmdc:mga0rr50_106_c1 | |||
| 1409 | nmdc:mga0rr50_1454246_c1 | |||
| 1410 | nmdc:mga0rr50_44679_c1 | |||
| 1411 | nmdc:mga08x19_2388_c1 | |||
| 1412 | nmdc:mga08x19_3180_c1 | |||
| 1413 | nmdc:mga08x19_42798_c1 | |||
| 1414 | nmdc:mga0a205_5600_c1 | |||
| 1415 | nmdc:mga0a205_5673_c1 | |||
| 1416 | Ga0495612_0197853 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r4e-assembly1.cif.gz_A | structure of glnr-dna complex | 0.9542 | 5 | 74 |
| 4r4e-assembly1.cif.gz_B | structure of glnr-dna complex | 0.9202 | 5 | 75 |
| 6vbw-assembly1.cif.gz_I | cryo-em structure of cascade-tniq-dsdna ternary complex | 0.914 | 4 | 32 |
| 7tec-assembly1.cif.gz_A-2 | structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom | 0.9057 | 5 | 64 |
| 6jni-assembly3.cif.gz_E | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.9048 | 5 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9542 | 5 | 74 | 1.10.1660.10 |
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.903 | 2 | 68 | 1.10.1660.10 |
| af_P9WKT7_24_74_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8965 | 5 | 49 | 1.10.10.10 |
| 3pl5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.8964 | 41 | 72 | 3.40.50.10440 |
| 4r22B00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8791 | 5 | 78 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9VAG4-F1-model_v4 | MerR family transcriptional regulator | 0.9687 | 1 | 141 |
GO:0003677
GO:0003700 |
| AF-D1CHH3-F1-model_v4 | Transcriptional regulator, MerR family | 0.9651 | 1 | 77 |
GO:0003677
GO:0006355 |
| AF-Q1IS29-F1-model_v4 | Transcriptional regulator, MerR family | 0.9622 | 1 | 140 |
GO:0003677
GO:0003700 |
| AF-A0A7C2RYC8-F1-model_v4 | MerR family transcriptional regulator | 0.9615 | 4 | 77 |
|
| AF-A0A3C0KZV5-F1-model_v4 | HTH merR-type domain-containing protein | 0.949 | 3 | 72 |
GO:0003677
GO:0006355 |