F476598

General Info

Members Datasets Scaffolds Average Seq Length
708 232 1416 159

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10048889|Ga0207699_100488893
Length 188
Sequence VQDSSLTGTKLVLKCFKHFKCRLFRSRKPRVLRSEFTSRDVVQLTGITARQLQWWDERGIVVPARQGRRRLYSMEDLSEVAVICELRDRGFSLQRVRKVVRFLQHEFGTRLAETVSGGSDYHLLTDGRSLYLETSAQQIVDILKNARQPMLAICLSDTVRRVLASVQSGKKRSKPAGYVSAGRRKHAS

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
108 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
109 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.93
Rhizosphere 93.08
Stem 0
Stem Tuber 0
Unclassified 26.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10048889 3300025906 Bacteria 2486
2 LJNas_1000272 3300000546 Bacteria 8937
3 JGI24751J29686_10093839 3300002459 Bacteria 625
4 Ga0065712_10085279 3300005290 Bacteria 2694
5 Ga0065712_10215806 3300005290 Bacteria 1057
6 Ga0065715_10103416 3300005293 Bacteria 3036
7 Ga0070683_100005566 3300005329 Bacteria 10518
8 Ga0070683_100096613 3300005329 Bacteria 2779
9 Ga0070683_100134957 3300005329 Unclassified 2336
10 Ga0070683_100426329 3300005329 Bacteria 1265
11 Ga0070690_100635624 3300005330 Unclassified 814
12 Ga0070670_101464008 3300005331 Unclassified 627
13 Ga0068869_100002370 3300005334 Bacteria 11334
14 Ga0068869_100526688 3300005334 Bacteria 990
15 Ga0068869_100583491 3300005334 Unclassified 943
16 Ga0070680_100033598 3300005336 Unclassified 4136
17 Ga0070682_100032214 3300005337 Bacteria 3176
18 Ga0068868_100004794 3300005338 Bacteria 9494
19 Ga0068868_100020961 3300005338 Unclassified 4920
20 Ga0068868_100089504 3300005338 Bacteria 2478
21 Ga0068868_100707534 3300005338 Bacteria 902
22 Ga0070660_100023194 3300005339 Bacteria 4596
23 Ga0070689_100103270 3300005340 Bacteria 2259
24 Ga0070689_100103431 3300005340 Bacteria 2257
25 Ga0070691_10230677 3300005341 Unclassified 985
26 Ga0070687_100057813 3300005343 Bacteria 2035
27 Ga0070661_100050967 3300005344 Bacteria 3029
28 Ga0070661_100633111 3300005344 Bacteria 867
29 Ga0070669_100520407 3300005353 Unclassified 989
30 Ga0070675_101423635 3300005354 Unclassified 639
31 Ga0070671_100341399 3300005355 Unclassified 1278
32 Ga0070673_102112382 3300005364 Unclassified 535
33 Ga0070688_100111838 3300005365 Bacteria 1817
34 Ga0070709_10022872 3300005434 Bacteria 3663
35 Ga0070709_10039598 3300005434 Bacteria 2893
36 Ga0070709_10051506 3300005434 Bacteria 2584
37 Ga0070709_10052759 3300005434 Bacteria 2557
38 Ga0070709_10062417 3300005434 Bacteria 2376
39 Ga0070709_10162080 3300005434 Bacteria 1556
40 Ga0070709_10171836 3300005434 Unclassified 1515
41 Ga0070709_10231907 3300005434 Unclassified 1321
42 Ga0070709_10639471 3300005434 Bacteria 823
43 Ga0070714_100006809 3300005435 Bacteria 8857
44 Ga0070714_100043931 3300005435 Bacteria 3781
45 Ga0070714_100076844 3300005435 Bacteria 2900
46 Ga0070714_100173340 3300005435 Bacteria 1959
47 Ga0070714_100176732 3300005435 Bacteria 1940
48 Ga0070714_100182981 3300005435 Bacteria 1908
49 Ga0070714_100219157 3300005435 Bacteria 1748
50 Ga0070714_100251674 3300005435 Bacteria 1634
51 Ga0070714_100374507 3300005435 Bacteria 1341
52 Ga0070714_100515773 3300005435 Unclassified 1141
53 Ga0070714_100528679 3300005435 Unclassified 1127
54 Ga0070713_100003409 3300005436 Bacteria 10498
55 Ga0070713_100011360 3300005436 Bacteria 6484
56 Ga0070713_100079361 3300005436 Bacteria 2796
57 Ga0070713_100079989 3300005436 Bacteria 2786
58 Ga0070713_100124500 3300005436 Bacteria 2265
59 Ga0070713_100136726 3300005436 Bacteria 2166
60 Ga0070713_100275945 3300005436 Unclassified 1541
61 Ga0070713_100734208 3300005436 Unclassified 944
62 Ga0070710_10013298 3300005437 Bacteria 4118
63 Ga0070710_10647707 3300005437 Unclassified 740
64 Ga0070711_100007702 3300005439 Bacteria 6558
65 Ga0070711_100267695 3300005439 Bacteria 1347
66 Ga0070711_100545682 3300005439 Unclassified 961
67 Ga0070711_100731388 3300005439 Bacteria 835
68 Ga0070711_100778055 3300005439 Bacteria 810
69 Ga0070711_100962818 3300005439 Bacteria 731
70 Ga0070711_101477662 3300005439 Unclassified 592
71 Ga0070708_100000589 3300005445 Bacteria 27247
72 Ga0070708_100002277 3300005445 Bacteria 14852
73 Ga0070708_100020036 3300005445 Bacteria 5633
74 Ga0070708_100022011 3300005445 Bacteria 5403
75 Ga0070708_100082620 3300005445 Bacteria 2910
76 Ga0070708_100529372 3300005445 Bacteria 1112
77 Ga0070708_100665840 3300005445 Bacteria 980
78 Ga0070663_100124783 3300005455 Unclassified 1949
79 Ga0070678_100607077 3300005456 Unclassified 977
80 Ga0070662_100041416 3300005457 Bacteria 3286
81 Ga0070681_10000541 3300005458 Bacteria 31118
82 Ga0070681_10071843 3300005458 Bacteria 3425
83 Ga0070681_10181016 3300005458 Bacteria 2029
84 Ga0070681_10270643 3300005458 Bacteria 1610
85 Ga0070681_10295606 3300005458 Unclassified 1529
86 Ga0068867_100001820 3300005459 Bacteria 14857
87 Ga0068867_100140020 3300005459 Bacteria 1890
88 Ga0068867_100162772 3300005459 Bacteria 1761
89 Ga0068867_100213106 3300005459 Bacteria 1552
90 Ga0070685_10042283 3300005466 Bacteria 2600
91 Ga0070706_100000419 3300005467 Bacteria 51038
92 Ga0070706_100003128 3300005467 Bacteria 16367
93 Ga0070706_100045075 3300005467 Bacteria 4073
94 Ga0070706_100321027 3300005467 Bacteria 1444
95 Ga0070706_100429665 3300005467 Unclassified 1229
96 Ga0070706_100861298 3300005467 Unclassified 838
97 Ga0070706_100896775 3300005467 Bacteria 819
98 Ga0070706_101235139 3300005467 Bacteria 686
99 Ga0070707_100002885 3300005468 Bacteria 16352
100 Ga0070707_100101604 3300005468 Bacteria 2786
101 Ga0070707_100157406 3300005468 Bacteria 2213
102 Ga0070707_100264679 3300005468 Bacteria 1672
103 Ga0070707_100846518 3300005468 Unclassified 879
104 Ga0070698_100000809 3300005471 Bacteria 34141
105 Ga0070698_100177613 3300005471 Unclassified 2068
106 Ga0070698_100567769 3300005471 Unclassified 1074
107 Ga0070699_100003819 3300005518 Bacteria 13308
108 Ga0070699_100028521 3300005518 Bacteria 4814
109 Ga0070699_100064484 3300005518 Bacteria 3177
110 Ga0070699_100096949 3300005518 Bacteria 2583
111 Ga0070699_100192852 3300005518 Unclassified 1810
112 Ga0070699_100380405 3300005518 Bacteria 1274
113 Ga0070679_100003227 3300005530 Bacteria 14897
114 Ga0070679_100050666 3300005530 Bacteria 4136
115 Ga0070679_100169084 3300005530 Bacteria 2159
116 Ga0070679_100214016 3300005530 Bacteria 1890
117 Ga0070679_100337721 3300005530 Unclassified 1455
118 Ga0070684_100065092 3300005535 Bacteria 3199
119 Ga0070684_100670229 3300005535 Bacteria 966
120 Ga0070697_100000821 3300005536 Bacteria 23282
121 Ga0070697_100001136 3300005536 Bacteria 20136
122 Ga0070697_100002177 3300005536 Bacteria 15018
123 Ga0070697_100007613 3300005536 Bacteria 8430
124 Ga0070697_100011172 3300005536 Bacteria 7018
125 Ga0070697_100100583 3300005536 Bacteria 2401
126 Ga0070697_100193964 3300005536 Bacteria 1725
127 Ga0070697_100473707 3300005536 Unclassified 1093
128 Ga0068853_100015570 3300005539 Bacteria 6247
129 Ga0068853_100099902 3300005539 Bacteria 2564
130 Ga0068853_100180935 3300005539 Bacteria 1912
131 Ga0068853_100511266 3300005539 Bacteria 1135
132 Ga0068853_100549681 3300005539 Bacteria 1094
133 Ga0070695_100182454 3300005545 Unclassified 1488
134 Ga0070695_100934097 3300005545 Unclassified 702
135 Ga0070693_100017958 3300005547 Bacteria 3688
136 Ga0070693_100045848 3300005547 Unclassified 2480
137 Ga0070693_100078106 3300005547 Unclassified 1966
138 Ga0070693_100844016 3300005547 Bacteria 682
139 Ga0070665_100678152 3300005548 Bacteria 1044
140 Ga0070665_101916853 3300005548 Unclassified 598
141 Ga0070704_100505438 3300005549 Bacteria 1049
142 Ga0068855_100000427 3300005563 Bacteria 52063
143 Ga0068855_100003386 3300005563 Bacteria 19516
144 Ga0068855_100005274 3300005563 Bacteria 15778
145 Ga0068855_100069772 3300005563 Bacteria 4089
146 Ga0068855_100201805 3300005563 Bacteria 2238
147 Ga0068855_100220676 3300005563 Unclassified 2126
148 Ga0068855_101113689 3300005563 Bacteria 825
149 Ga0068855_101530868 3300005563 Bacteria 684
150 Ga0070664_100001749 3300005564 Bacteria 17386
151 Ga0070664_100058147 3300005564 Bacteria 3288
152 Ga0068857_100000136 3300005577 Bacteria 44769
153 Ga0068857_100000352 3300005577 Bacteria 31917
154 Ga0068857_101156089 3300005577 Unclassified 748
155 Ga0068854_100006132 3300005578 Bacteria 7629
156 Ga0068854_100557841 3300005578 Bacteria 972
157 Ga0068856_100000493 3300005614 Bacteria 43650
158 Ga0068856_100000913 3300005614 Bacteria 31587
159 Ga0068856_100003688 3300005614 Bacteria 15358
160 Ga0068856_100006174 3300005614 Bacteria 11753
161 Ga0068856_100037127 3300005614 Bacteria 4779
162 Ga0068856_100086860 3300005614 Bacteria 3108
163 Ga0068856_100553295 3300005614 Bacteria 1172
164 Ga0068856_100828474 3300005614 Unclassified 945
165 Ga0070702_100293866 3300005615 Bacteria 1121
166 Ga0068852_100221865 3300005616 Bacteria 1798
167 Ga0068852_100238645 3300005616 Unclassified 1736
168 Ga0068852_100343651 3300005616 Bacteria 1455
169 Ga0068852_101198171 3300005616 Unclassified 780
170 Ga0068859_100004990 3300005617 Bacteria 13479
171 Ga0068864_100006267 3300005618 Bacteria 9756
172 Ga0068866_10112071 3300005718 Bacteria 1524
173 Ga0068866_10139136 3300005718 Unclassified 1391
174 Ga0068870_10085270 3300005840 Bacteria 1755
175 Ga0068863_100043652 3300005841 Bacteria 4255
176 Ga0068863_100205518 3300005841 Bacteria 1895
177 Ga0068863_101239771 3300005841 Unclassified 752
178 Ga0068858_100004899 3300005842 Bacteria 13122
179 Ga0068858_100006486 3300005842 Bacteria 11388
180 Ga0068858_100012689 3300005842 Bacteria 7938
181 Ga0068858_100150059 3300005842 Bacteria 2191
182 Ga0068858_100193273 3300005842 Bacteria 1923
183 Ga0068858_100276002 3300005842 Bacteria 1600
184 Ga0068858_100486607 3300005842 Unclassified 1191
185 Ga0068858_100782404 3300005842 Bacteria 930
186 Ga0068860_100165500 3300005843 Unclassified 2134
187 Ga0068860_100228207 3300005843 Bacteria 1809
188 Ga0068860_100749590 3300005843 Unclassified 988
189 Ga0068860_100902756 3300005843 Unclassified 900
190 Ga0081540_1033718 3300005983 Bacteria 2774
191 Ga0081540_1112660 3300005983 Bacteria 1146
192 Ga0070717_10007704 3300006028 Bacteria 8010
193 Ga0070717_10054398 3300006028 Bacteria 3301
194 Ga0070717_10055551 3300006028 Bacteria 3268
195 Ga0070717_10061548 3300006028 Bacteria 3111
196 Ga0070717_10119813 3300006028 Unclassified 2253
197 Ga0070717_10236394 3300006028 Bacteria 1610
198 Ga0070717_10337504 3300006028 Unclassified 1345
199 Ga0070717_10496290 3300006028 Unclassified 1103
200 Ga0070717_10656186 3300006028 Bacteria 952
201 Ga0070717_11170502 3300006028 Bacteria 700
202 Ga0070715_10005301 3300006163 Bacteria 4291
203 Ga0070715_10021699 3300006163 Bacteria 2494
204 Ga0070715_10086442 3300006163 Bacteria 1434
205 Ga0070715_10452082 3300006163 Unclassified 725
206 Ga0070716_100007884 3300006173 Bacteria 5270
207 Ga0070716_100014507 3300006173 Bacteria 4036
208 Ga0070716_100046502 3300006173 Bacteria 2443
209 Ga0070716_100059465 3300006173 Bacteria 2203
210 Ga0070716_100190666 3300006173 Unclassified 1354
211 Ga0070716_100238567 3300006173 Unclassified 1231
212 Ga0070716_100295913 3300006173 Bacteria 1124
213 Ga0070716_100354115 3300006173 Bacteria 1040
214 Ga0070716_100425044 3300006173 Bacteria 962
215 Ga0070716_100642169 3300006173 Bacteria 804
216 Ga0070716_101224626 3300006173 Unclassified 604
217 Ga0070712_100000706 3300006175 Bacteria 19671
218 Ga0070712_100030065 3300006175 Bacteria 3647
219 Ga0070712_100054133 3300006175 Bacteria 2804
220 Ga0070712_100160782 3300006175 Bacteria 1734
221 Ga0070712_100242325 3300006175 Unclassified 1437
222 Ga0070712_100431446 3300006175 Bacteria 1094
223 Ga0070712_100614855 3300006175 Unclassified 921
224 Ga0070712_101246285 3300006175 Unclassified 647
225 Ga0097621_100000815 3300006237 Bacteria 21996
226 Ga0097621_100002310 3300006237 Bacteria 13062
227 Ga0097621_100003639 3300006237 Bacteria 10649
228 Ga0097621_100071826 3300006237 Bacteria 2861
229 Ga0097621_100635138 3300006237 Unclassified 978
230 Ga0097621_100897084 3300006237 Unclassified 825
231 Ga0068871_100000014 3300006358 Bacteria 101648
232 Ga0068871_100000048 3300006358 Bacteria 66152
233 Ga0068871_100002644 3300006358 Bacteria 12239
234 Ga0068871_100102906 3300006358 Bacteria 2394
235 Ga0068871_100295554 3300006358 Unclassified 1420
236 Ga0068871_100590210 3300006358 Bacteria 1009
237 Ga0068871_101274802 3300006358 Unclassified 691
238 Ga0075433_10000204 3300006852 Bacteria 33250
239 Ga0075433_10018650 3300006852 Bacteria 5771
240 Ga0075434_100000087 3300006871 Bacteria 50514
241 Ga0075434_100000823 3300006871 Bacteria 24645
242 Ga0075434_101097525 3300006871 Unclassified 809
243 Ga0068865_100030005 3300006881 Bacteria 3613
244 Ga0068865_100095854 3300006881 Bacteria 2162
245 Ga0068865_101010902 3300006881 Unclassified 728
246 Ga0075436_100000746 3300006914 Bacteria 21522
247 Ga0075436_100006591 3300006914 Bacteria 7957
248 Ga0075436_100079617 3300006914 Bacteria 2270
249 Ga0075436_100178005 3300006914 Bacteria 1503
250 Ga0097620_100004990 3300006931 Bacteria 13479
251 Ga0075435_100000998 3300007076 Bacteria 17932
252 Ga0075435_100114351 3300007076 Bacteria 2247
253 Ga0099795_10012174 3300007788 Bacteria 2599
254 Ga0099795_10273098 3300007788 Unclassified 736
255 Ga0099795_10350103 3300007788 Unclassified 661
256 Ga0105250_10409339 3300009092 Bacteria 603
257 Ga0105240_10011653 3300009093 Bacteria 12222
258 Ga0105240_10056667 3300009093 Bacteria 4903
259 Ga0105240_10084281 3300009093 Bacteria 3897
260 Ga0105240_10129465 3300009093 Bacteria 3029
261 Ga0105240_10148511 3300009093 Bacteria 2794
262 Ga0105240_10271243 3300009093 Bacteria 1953
263 Ga0105240_10574609 3300009093 Bacteria 1244
264 Ga0105240_11006250 3300009093 Bacteria 891
265 Ga0105245_10064900 3300009098 Bacteria 3300
266 Ga0105245_10263028 3300009098 Bacteria 1680
267 Ga0105245_11784308 3300009098 Bacteria 668
268 Ga0105247_10036207 3300009101 Bacteria 3009
269 Ga0114129_10348935 3300009147 Unclassified 1961
270 Ga0105241_10008984 3300009174 Bacteria 7349
271 Ga0105241_10027802 3300009174 Bacteria 4211
272 Ga0105241_10046051 3300009174 Bacteria 3311
273 Ga0105241_10076168 3300009174 Bacteria 2615
274 Ga0105241_10126144 3300009174 Bacteria 2067
275 Ga0105241_10227314 3300009174 Unclassified 1571
276 Ga0105241_10235132 3300009174 Unclassified 1546
277 Ga0105241_11130102 3300009174 Unclassified 739
278 Ga0105242_10198063 3300009176 Bacteria 1782
279 Ga0105242_10359983 3300009176 Bacteria 1346
280 Ga0105242_10657163 3300009176 Bacteria 1020
281 Ga0105248_10024837 3300009177 Bacteria 6662
282 Ga0105248_10051809 3300009177 Bacteria 4605
283 Ga0105248_10118084 3300009177 Bacteria 2991
284 Ga0105248_10191379 3300009177 Unclassified 2305
285 Ga0105237_10017022 3300009545 Bacteria 7545
286 Ga0105237_10042971 3300009545 Bacteria 4555
287 Ga0105237_10206616 3300009545 Bacteria 1964
288 Ga0105237_10291395 3300009545 Unclassified 1635
289 Ga0105237_11728855 3300009545 Unclassified 633
290 Ga0105238_10000135 3300009551 Bacteria 81026
291 Ga0105238_10303748 3300009551 Bacteria 1580
292 Ga0105238_10864265 3300009551 Bacteria 922
293 Ga0105238_11322544 3300009551 Bacteria 747
294 Ga0105249_10483911 3300009553 Bacteria 1281
295 Ga0099796_10122148 3300010159 Unclassified 1002
296 Ga0105239_10055738 3300010375 Bacteria 4335
297 Ga0105239_10076881 3300010375 Bacteria 3672
298 Ga0105239_10093774 3300010375 Unclassified 3315
299 Ga0105246_10341213 3300011119 Unclassified 1224
300 Ga0105246_10531679 3300011119 Unclassified 1004
301 Ga0105246_10587727 3300011119 Bacteria 960
302 Ga0157373_10016494 3300013100 Bacteria 5386
303 Ga0157373_10062539 3300013100 Bacteria 2637
304 Ga0157373_10074756 3300013100 Bacteria 2390
305 Ga0157373_10134873 3300013100 Bacteria 1736
306 Ga0157371_10045209 3300013102 Bacteria 3134
307 Ga0157371_10140406 3300013102 Bacteria 1721
308 Ga0157371_10681294 3300013102 Bacteria 769
309 Ga0157370_10056323 3300013104 Bacteria 3742
310 Ga0157370_10212081 3300013104 Unclassified 1795
311 Ga0157370_10357092 3300013104 Bacteria 1347
312 Ga0157370_10748146 3300013104 Unclassified 891
313 Ga0157369_10000034 3300013105 Bacteria 200710
314 Ga0157369_10003121 3300013105 Bacteria 19795
315 Ga0157369_10029870 3300013105 Bacteria 6019
316 Ga0157369_10053964 3300013105 Bacteria 4341
317 Ga0157369_10077614 3300013105 Bacteria 3560
318 Ga0157369_10106777 3300013105 Bacteria 2979
319 Ga0157369_10185994 3300013105 Bacteria 2184
320 Ga0157369_10255642 3300013105 Unclassified 1828
321 Ga0157369_10323851 3300013105 Unclassified 1602
322 Ga0157369_10339555 3300013105 Bacteria 1560
323 Ga0157369_11434355 3300013105 Bacteria 703
324 Ga0157374_10000112 3300013296 Bacteria 74313
325 Ga0157374_10000183 3300013296 Bacteria 58330
326 Ga0157374_10000210 3300013296 Bacteria 53686
327 Ga0157374_10032743 3300013296 Bacteria 4736
328 Ga0157374_10054096 3300013296 Bacteria 3743
329 Ga0157374_10841086 3300013296 Bacteria 934
330 Ga0157378_10000107 3300013297 Bacteria 79357
331 Ga0157378_10000127 3300013297 Bacteria 74509
332 Ga0157378_10000344 3300013297 Bacteria 45774
333 Ga0157378_10007947 3300013297 Bacteria 9258
334 Ga0157378_10031865 3300013297 Bacteria 4656
335 Ga0157378_10359219 3300013297 Bacteria 1425
336 Ga0157378_11104711 3300013297 Unclassified 830
337 Ga0163162_10011789 3300013306 Bacteria 8525
338 Ga0163162_10032187 3300013306 Bacteria 5206
339 Ga0163162_10065064 3300013306 Bacteria 3692
340 Ga0163162_11183056 3300013306 Bacteria 867
341 Ga0157372_10000059 3300013307 Bacteria 124697
342 Ga0157372_10000153 3300013307 Bacteria 74783
343 Ga0157372_10000219 3300013307 Bacteria 63587
344 Ga0157372_10022234 3300013307 Bacteria 6861
345 Ga0157372_10022946 3300013307 Bacteria 6760
346 Ga0157372_10029279 3300013307 Bacteria 6011
347 Ga0157372_10036934 3300013307 Bacteria 5386
348 Ga0157372_10077024 3300013307 Bacteria 3766
349 Ga0157372_10140053 3300013307 Bacteria 2786
350 Ga0157372_10438360 3300013307 Unclassified 1523
351 Ga0157372_10728862 3300013307 Bacteria 1153
352 Ga0157375_10035144 3300013308 Bacteria 4781
353 Ga0163163_10219526 3300014325 Unclassified 1950
354 Ga0163163_10327928 3300014325 Bacteria 1585
355 Ga0163163_10404854 3300014325 Bacteria 1423
356 Ga0163163_10518366 3300014325 Unclassified 1254
357 Ga0163163_11375302 3300014325 Unclassified 768
358 Ga0157380_11391924 3300014326 Unclassified 752
359 Ga0182008_10108604 3300014497 Bacteria 1374
360 Ga0157377_10060505 3300014745 Bacteria 2162
361 Ga0157379_10078071 3300014968 Bacteria 2965
362 Ga0157376_10006705 3300014969 Bacteria 8150
363 Ga0157376_10223409 3300014969 Bacteria 1746
364 Ga0157376_10231478 3300014969 Bacteria 1717
365 Ga0157376_11279702 3300014969 Unclassified 763
366 Ga0157376_12801869 3300014969 Bacteria 527
367 Ga0182006_1063038 3300015261 Bacteria 1393
368 Ga0182007_10049579 3300015262 Unclassified 1387
369 Ga0213874_10030658 3300021377 Unclassified 1551
370 Ga0224569_101080 3300022732 Bacteria 2322
371 Ga0224571_100046 3300022734 Bacteria 4101
372 Ga0224572_1010191 3300024225 Unclassified 1763
373 Ga0224572_1023521 3300024225 Unclassified 1183
374 Ga0224572_1033178 3300024225 Unclassified 982
375 Ga0228598_1000883 3300024227 Bacteria 6489
376 Ga0228598_1042898 3300024227 Bacteria 894
377 Ga0207697_10164265 3300025315 Bacteria 969
378 Ga0207656_10470494 3300025321 Unclassified 636
379 Ga0207692_10028083 3300025898 Bacteria 2657
380 Ga0207692_10314510 3300025898 Unclassified 957
381 Ga0207692_10328420 3300025898 Unclassified 938
382 Ga0207692_10529811 3300025898 Unclassified 750
383 Ga0207642_10010730 3300025899 Unclassified 3243
384 Ga0207642_10083382 3300025899 Bacteria 1559
385 Ga0207710_10059430 3300025900 Bacteria 1730
386 Ga0207647_10006365 3300025904 Bacteria 8585
387 Ga0207647_10247857 3300025904 Bacteria 1022
388 Ga0207685_10007553 3300025905 Bacteria 3037
389 Ga0207685_10021473 3300025905 Bacteria 2164
390 Ga0207685_10036248 3300025905 Bacteria 1807
391 Ga0207685_10043052 3300025905 Bacteria 1699
392 Ga0207685_10048347 3300025905 Bacteria 1629
393 Ga0207699_10010814 3300025906 Bacteria 4593
394 Ga0207699_10064326 3300025906 Bacteria 2219
395 Ga0207699_10071962 3300025906 Bacteria 2116
396 Ga0207699_10326374 3300025906 Bacteria 1078
397 Ga0207699_10377333 3300025906 Unclassified 1006
398 Ga0207699_10564230 3300025906 Unclassified 827
399 Ga0207643_10083520 3300025908 Bacteria 1853
400 Ga0207705_10609541 3300025909 Unclassified 849
401 Ga0207684_10002115 3300025910 Bacteria 20363
402 Ga0207684_10012532 3300025910 Bacteria 7368
403 Ga0207684_10161907 3300025910 Unclassified 1927
404 Ga0207684_10236760 3300025910 Bacteria 1575
405 Ga0207684_10284691 3300025910 Bacteria 1425
406 Ga0207684_11012169 3300025910 Bacteria 695
407 Ga0207654_10009789 3300025911 Bacteria 4876
408 Ga0207654_10118539 3300025911 Unclassified 1658
409 Ga0207654_10135577 3300025911 Unclassified 1563
410 Ga0207654_10190729 3300025911 Bacteria 1343
411 Ga0207707_10007076 3300025912 Bacteria 9778
412 Ga0207707_10187187 3300025912 Bacteria 1807
413 Ga0207707_10461324 3300025912 Bacteria 1086
414 Ga0207695_10040434 3300025913 Bacteria 4999
415 Ga0207695_10042028 3300025913 Bacteria 4887
416 Ga0207695_10109971 3300025913 Bacteria 2737
417 Ga0207695_10387197 3300025913 Bacteria 1283
418 Ga0207695_10732183 3300025913 Bacteria 869
419 Ga0207671_10037257 3300025914 Bacteria 3607
420 Ga0207671_10043424 3300025914 Bacteria 3324
421 Ga0207671_11090352 3300025914 Unclassified 627
422 Ga0207693_10000020 3300025915 Bacteria 132847
423 Ga0207693_10053056 3300025915 Bacteria 3181
424 Ga0207693_10195203 3300025915 Bacteria 1593
425 Ga0207693_10250346 3300025915 Bacteria 1390
426 Ga0207693_10259696 3300025915 Bacteria 1362
427 Ga0207693_10465933 3300025915 Bacteria 987
428 Ga0207663_10068721 3300025916 Bacteria 2277
429 Ga0207663_10141197 3300025916 Bacteria 1678
430 Ga0207663_10294517 3300025916 Bacteria 1210
431 Ga0207663_10434630 3300025916 Bacteria 1010
432 Ga0207663_10606769 3300025916 Bacteria 860
433 Ga0207663_10615020 3300025916 Unclassified 855
434 Ga0207663_10644367 3300025916 Bacteria 836
435 Ga0207660_10131873 3300025917 Unclassified 1903
436 Ga0207649_10190492 3300025920 Unclassified 1442
437 Ga0207649_10533981 3300025920 Bacteria 896
438 Ga0207652_10076495 3300025921 Bacteria 2919
439 Ga0207652_10181617 3300025921 Bacteria 1891
440 Ga0207652_10263896 3300025921 Bacteria 1553
441 Ga0207652_10274096 3300025921 Bacteria 1522
442 Ga0207646_10001256 3300025922 Bacteria 31771
443 Ga0207646_10037248 3300025922 Bacteria 4386
444 Ga0207646_10147295 3300025922 Bacteria 2122
445 Ga0207646_10283512 3300025922 Bacteria 1497
446 Ga0207646_10605239 3300025922 Unclassified 983
447 Ga0207694_10000722 3300025924 Bacteria 29682
448 Ga0207694_10335469 3300025924 Unclassified 1250
449 Ga0207694_10524209 3300025924 Unclassified 993
450 Ga0207694_10903875 3300025924 Bacteria 747
451 Ga0207650_10018347 3300025925 Bacteria 4909
452 Ga0207650_10478952 3300025925 Unclassified 1038
453 Ga0207687_10038123 3300025927 Bacteria 3283
454 Ga0207700_10007543 3300025928 Bacteria 6659
455 Ga0207700_10201753 3300025928 Bacteria 1676
456 Ga0207700_10203197 3300025928 Bacteria 1671
457 Ga0207700_10220334 3300025928 Bacteria 1608
458 Ga0207700_10227492 3300025928 Bacteria 1584
459 Ga0207700_10364091 3300025928 Bacteria 1261
460 Ga0207700_10695715 3300025928 Unclassified 907
461 Ga0207700_11451912 3300025928 Unclassified 609
462 Ga0207664_10004405 3300025929 Bacteria 9534
463 Ga0207664_10044138 3300025929 Bacteria 3490
464 Ga0207664_10238812 3300025929 Bacteria 1582
465 Ga0207664_10296182 3300025929 Bacteria 1422
466 Ga0207664_10402552 3300025929 Bacteria 1217
467 Ga0207664_10747604 3300025929 Bacteria 879
468 Ga0207664_10993767 3300025929 Bacteria 752
469 Ga0207644_10186689 3300025931 Bacteria 1628
470 Ga0207644_10253470 3300025931 Unclassified 1405
471 Ga0207706_10390407 3300025933 Bacteria 1207
472 Ga0207686_10307293 3300025934 Bacteria 1180
473 Ga0207686_10320490 3300025934 Bacteria 1158
474 Ga0207670_10265232 3300025936 Bacteria 1333
475 Ga0207704_10030891 3300025938 Bacteria 3010
476 Ga0207704_10053536 3300025938 Unclassified 2454
477 Ga0207665_10001326 3300025939 Bacteria 16683
478 Ga0207665_10011897 3300025939 Bacteria 5715
479 Ga0207665_10058051 3300025939 Bacteria 2615
480 Ga0207665_10066208 3300025939 Bacteria 2458
481 Ga0207665_10080382 3300025939 Bacteria 2242
482 Ga0207665_10107163 3300025939 Bacteria 1959
483 Ga0207665_10374707 3300025939 Unclassified 1079
484 Ga0207665_10385265 3300025939 Unclassified 1065
485 Ga0207665_10832090 3300025939 Bacteria 730
486 Ga0207711_10050499 3300025941 Bacteria 3561
487 Ga0207711_10212194 3300025941 Bacteria 1768
488 Ga0207711_10368252 3300025941 Bacteria 1332
489 Ga0207711_10592666 3300025941 Unclassified 1034
490 Ga0207689_10000586 3300025942 Bacteria 34709
491 Ga0207689_10017696 3300025942 Bacteria 6022
492 Ga0207661_10012939 3300025944 Bacteria 6087
493 Ga0207661_10072868 3300025944 Bacteria 2811
494 Ga0207661_10462538 3300025944 Bacteria 1156
495 Ga0207661_10875050 3300025944 Unclassified 827
496 Ga0207679_10001953 3300025945 Bacteria 12799
497 Ga0207679_10577326 3300025945 Unclassified 1011
498 Ga0207667_10002755 3300025949 Bacteria 21728
499 Ga0207667_10003317 3300025949 Bacteria 19862
500 Ga0207667_10015892 3300025949 Bacteria 8524
501 Ga0207667_10112192 3300025949 Bacteria 2811
502 Ga0207667_10181377 3300025949 Unclassified 2162
503 Ga0207667_10366352 3300025949 Unclassified 1469
504 Ga0207667_11469483 3300025949 Unclassified 653
505 Ga0207640_10012268 3300025981 Bacteria 4876
506 Ga0207640_10073636 3300025981 Bacteria 2309
507 Ga0207640_10104847 3300025981 Bacteria 1991
508 Ga0207640_10298615 3300025981 Unclassified 1273
509 Ga0207677_10007230 3300026023 Bacteria 6119
510 Ga0207677_10010319 3300026023 Bacteria 5283
511 Ga0207677_10067381 3300026023 Bacteria 2508
512 Ga0207677_10182709 3300026023 Unclassified 1651
513 Ga0207677_10506830 3300026023 Unclassified 1044
514 Ga0207703_10004306 3300026035 Bacteria 11702
515 Ga0207703_10006757 3300026035 Bacteria 9149
516 Ga0207703_10049368 3300026035 Unclassified 3402
517 Ga0207703_10127012 3300026035 Bacteria 2197
518 Ga0207703_10173401 3300026035 Bacteria 1899
519 Ga0207703_11328108 3300026035 Bacteria 692
520 Ga0207639_10006481 3300026041 Bacteria 7959
521 Ga0207639_10084038 3300026041 Bacteria 2528
522 Ga0207639_10154179 3300026041 Bacteria 1928
523 Ga0207639_11129997 3300026041 Unclassified 735
524 Ga0207678_10021833 3300026067 Bacteria 5615
525 Ga0207702_10000171 3300026078 Bacteria 77495
526 Ga0207702_10017783 3300026078 Bacteria 5884
527 Ga0207702_10036388 3300026078 Bacteria 4117
528 Ga0207702_10051835 3300026078 Bacteria 3470
529 Ga0207702_10075111 3300026078 Bacteria 2919
530 Ga0207702_10648382 3300026078 Bacteria 1038
531 Ga0207702_10757076 3300026078 Unclassified 959
532 Ga0207641_10020365 3300026088 Bacteria 5448
533 Ga0207641_10053213 3300026088 Bacteria 3431
534 Ga0207641_10205299 3300026088 Bacteria 1819
535 Ga0207641_11496969 3300026088 Unclassified 676
536 Ga0207648_10029658 3300026089 Bacteria 4851
537 Ga0207648_10159325 3300026089 Bacteria 1993
538 Ga0207676_10047882 3300026095 Bacteria 3315
539 Ga0207676_10434431 3300026095 Unclassified 1234
540 Ga0207674_10000126 3300026116 Bacteria 88965
541 Ga0207674_10000230 3300026116 Bacteria 69765
542 Ga0207674_10243817 3300026116 Unclassified 1744
543 Ga0207683_10638437 3300026121 Unclassified 986
544 Ga0207683_10714610 3300026121 Unclassified 929
545 Ga0207698_10026384 3300026142 Unclassified 4109
546 Ga0207698_10193641 3300026142 Bacteria 1814
547 Ga0207698_10436420 3300026142 Bacteria 1261
548 Ga0207698_11893769 3300026142 Unclassified 611
549 Ga0265356_1011565 3300028017 Bacteria 975
550 Ga0265356_1011992 3300028017 Unclassified 955
551 Ga0268266_10804055 3300028379 Unclassified 908
552 Ga0268265_10170126 3300028380 Bacteria 1861
553 Ga0268264_10018809 3300028381 Bacteria 5649
554 Ga0268264_10019071 3300028381 Bacteria 5608
555 Ga0268264_10701962 3300028381 Unclassified 1005
556 Ga0265338_10067098 3300028800 Bacteria 3101
557 Ga0265762_1000421 3300030760 Bacteria 7339
558 Ga0265760_10003252 3300031090 Bacteria 4762
559 Ga0265760_10006628 3300031090 Bacteria 3312
560 Ga0265760_10039783 3300031090 Bacteria 1400
561 Ga0373926_0031676 3300035083 Bacteria 1865
562 Ga0373934_0246104 3300035086 Unclassified 739
563 Ga0373940_0112067 3300035088 Bacteria 838
564 Ga0373944_0364099 3300035089 Bacteria 552
565 Ga0373923_0092484 3300035111 Bacteria 1325
566 Ga0373956_0294594 3300035119 Unclassified 773
567 Ga0373943_0029368 3300035170 Bacteria 2597
568 Ga0373943_0266709 3300035170 Bacteria 965
569 Ga0373961_0036890 3300035241 Bacteria 1394
570 Ga0373931_0062901 3300035691 Bacteria 2005
571 Ga0373931_0102032 3300035691 Bacteria 1615
572 Ga0373931_0162761 3300035691 Bacteria 1309
573 Ga0373935_0155504 3300035692 Bacteria 1555
574 Ga0373935_0564413 3300035692 Unclassified 830
575 Ga0373935_1240014 3300035692 Unclassified 556
576 Ga0373927_0141747 3300035695 Bacteria 1572
577 Ga0373927_0197850 3300035695 Unclassified 1319
578 Ga0373927_0982261 3300035695 Unclassified 557
579 Ga0373933_0258636 3300035724 Bacteria 1122
580 Ga0373947_0028509 3300035725 Bacteria 3275
581 Ga0373947_0125557 3300035725 Bacteria 1634
582 Ga0373947_0135751 3300035725 Bacteria 1574
583 Ga0373937_0050107 3300036401 Unclassified 3824
584 Ga0373937_0475286 3300036401 Unclassified 1187
585 Ga0373937_0963850 3300036401 Unclassified 802
586 Ga0373937_1213143 3300036401 Bacteria 703
587 Ga0373937_1569103 3300036401 Bacteria 606
588 Ga0373925_0002744 3300037068 Bacteria 13935
589 Ga0373925_0030380 3300037068 Bacteria 3965
590 Ga0373925_0647901 3300037068 Unclassified 870
591 Ga0373925_0721007 3300037068 Bacteria 822
592 Ga0395905_0045188 3300037471 Bacteria 4131
593 Ga0395905_0076396 3300037471 Bacteria 3139
594 Ga0395905_0103414 3300037471 Bacteria 2674
595 Ga0395905_1386514 3300037471 Unclassified 607
596 Ga0436364_0178451 3300037853 Bacteria 1010
597 Ga0436364_1095476 3300037853 Unclassified 1132
598 Ga0436365_0960820 3300039437 Bacteria 1629
599 Ga0436365_1490804 3300039437 Unclassified 680
600 Ga0436360_0002355 3300039438 Bacteria 1326
601 Ga0436361_0928472 3300039447 Bacteria 1072
602 Ga0436363_0292830 3300039450 Unclassified 607
603 Ga0436363_0324942 3300039450 Bacteria 3830
604 Ga0451577_0142650 3300042876 Unclassified 2153
605 Ga0466966_0199273 3300044684 Unclassified 1212
606 Ga0466961_0083862 3300044693 Bacteria 2016
607 Ga0466963_0010025 3300044694 Bacteria 5728
608 Ga0466963_0011570 3300044694 Bacteria 5373
609 Ga0466963_0336779 3300044694 Unclassified 1062
610 Ga0466964_0115421 3300044706 Bacteria 1203
611 Ga0466957_0258805 3300044842 Bacteria 1159
612 Ga0466957_0348716 3300044842 Unclassified 1004
613 Ga0451576_0039199 3300045051 Bacteria 5014
614 Ga0451576_0076805 3300045051 Bacteria 3476
615 Ga0451576_0970034 3300045051 Bacteria 891
616 Ga0451576_2606494 3300045051 Unclassified 515
617 Ga0466958_0558409 3300045836 Unclassified 744
618 Ga0466967_0003556 3300045976 Bacteria 10208
619 Ga0466967_0045756 3300045976 Bacteria 3804
620 Ga0466967_0524022 3300045976 Unclassified 1165
621 Ga0466967_1320372 3300045976 Unclassified 718
622 Ga0495590_0210669 3300046457 Unclassified 716
623 Ga0495580_0000936 3300046472 Bacteria 25491
624 Ga0495580_0013261 3300046472 Bacteria 6299
625 Ga0495580_0014233 3300046472 Bacteria 6039
626 Ga0495580_0036120 3300046472 Bacteria 3548
627 Ga0495580_0203052 3300046472 Archaea 1365
628 Ga0495580_0253611 3300046472 Bacteria 1204
629 Ga0495580_0339885 3300046472 Bacteria 1018
630 Ga0495580_0462830 3300046472 Unclassified 850
631 Ga0495580_0672563 3300046472 Unclassified 679
632 Ga0495582_0066374 3300046473 Bacteria 1993
633 Ga0495582_0214476 3300046473 Bacteria 1101
634 Ga0495639_0029076 3300046475 Bacteria 2452
635 Ga0495584_0132636 3300046491 Unclassified 1264
636 Ga0495608_0334334 3300046511 Unclassified 934
637 Ga0495628_0681129 3300046516 Bacteria 728
638 Ga0495630_0032207 3300046517 Bacteria 3905
639 Ga0495666_0014306 3300046526 Bacteria 3954
640 Ga0495587_0301291 3300046536 Bacteria 896
641 Ga0495587_0581580 3300046536 Unclassified 617
642 Ga0495657_0536559 3300046675 Bacteria 680
643 Ga0495599_0722893 3300046678 Unclassified 573
644 Ga0495669_0220482 3300046684 Bacteria 909
645 Ga0495669_0345813 3300046684 Unclassified 719
646 Ga0495674_0050350 3300047319 Unclassified 3676
647 Ga0495674_0133803 3300047319 Bacteria 2088
648 Ga0495674_0175666 3300047319 Bacteria 1785
649 Ga0495674_0474914 3300047319 Bacteria 1003
650 Ga0495675_0136180 3300047444 Bacteria 1524
651 Ga0495675_0331302 3300047444 Unclassified 899
652 Ga0495602_0087875 3300048088 Bacteria 2589
653 Ga0496100_0016893 3300048903 Bacteria 4294
654 Ga0496100_0068002 3300048903 Unclassified 2368
655 Ga0496100_0238297 3300048903 Unclassified 1341
656 Ga0496101_0249589 3300048904 Bacteria 1382
657 Ga0496102_0060928 3300048905 Bacteria 3452
658 Ga0496102_0119330 3300048905 Bacteria 2462
659 Ga0496102_0416171 3300048905 Unclassified 1262
660 Ga0496102_0539385 3300048905 Unclassified 1089
661 Ga0496102_1120603 3300048905 Bacteria 707
662 Ga0496103_0020673 3300048906 Bacteria 3956
663 Ga0496103_0134917 3300048906 Unclassified 1577
664 Ga0496104_0011263 3300048907 Bacteria 8005
665 Ga0496104_0014124 3300048907 Bacteria 7209
666 Ga0496104_0020787 3300048907 Bacteria 6020
667 Ga0496104_0052992 3300048907 Bacteria 3833
668 Ga0496104_1374951 3300048907 Unclassified 609
669 Ga0496105_0116323 3300048908 Bacteria 2206
670 Ga0496105_0171582 3300048908 Unclassified 1778
671 Ga0496105_0250155 3300048908 Unclassified 1436
672 Ga0496106_0011666 3300048909 Bacteria 6492
673 Ga0496106_0038848 3300048909 Bacteria 3564
674 Ga0496106_0273642 3300048909 Unclassified 1352
675 Ga0496107_0125210 3300048910 Bacteria 1895
676 Ga0496107_0327342 3300048910 Unclassified 1140
677 Ga0496109_0138547 3300048912 Bacteria 2275
678 Ga0496109_0931145 3300048912 Unclassified 807
679 Ga0496110_0363414 3300048913 Bacteria 1319
680 Ga0496111_0102561 3300048914 Unclassified 2103
681 Ga0496111_0772517 3300048914 Unclassified 696
682 Ga0496112_0009231 3300048915 Bacteria 8866
683 Ga0496112_0011890 3300048915 Bacteria 7973
684 Ga0496112_0012866 3300048915 Bacteria 7703
685 Ga0496112_0023709 3300048915 Bacteria 5870
686 Ga0496112_0028596 3300048915 Bacteria 5382
687 Ga0496112_0170587 3300048915 Bacteria 2141
688 Ga0496113_0064459 3300048916 Bacteria 2770
689 Ga0496113_0675932 3300048916 Bacteria 825
690 Ga0496114_0165662 3300048917 Bacteria 1924
691 Ga0496114_0496908 3300048917 Unclassified 1079
692 Ga0496115_0159831 3300048918 Unclassified 1862
693 Ga0496115_0375320 3300048918 Bacteria 1157
694 Ga0496115_0497636 3300048918 Unclassified 980
695 nmdc:mga05p37_313951_c1 3300050507 Unclassified 1857
696 nmdc:mga0n895_1001883_c1 3300050512 Unclassified 817
697 nmdc:mga0n895_128_c1 3300050512 Bacteria 45048
698 nmdc:mga0n895_428_c1 3300050512 Bacteria 28233
699 nmdc:mga0n895_74040_c1 3300050512 Bacteria 3382
700 nmdc:mga0rr50_106_c1 3300050513 Bacteria 46345
701 nmdc:mga0rr50_1454246_c1 3300050513 Unclassified 580
702 nmdc:mga0rr50_44679_c1 3300050513 Bacteria 3251
703 nmdc:mga08x19_2388_c1 3300050514 Bacteria 11383
704 nmdc:mga08x19_3180_c1 3300050514 Bacteria 9853
705 nmdc:mga08x19_42798_c1 3300050514 Bacteria 2888
706 nmdc:mga0a205_5600_c1 3300050515 Bacteria 11319
707 nmdc:mga0a205_5673_c1 3300050515 Bacteria 5803
708 Ga0495612_0197853 3300053078 Bacteria 886
709 Ga0207699_10048889
710 LJNas_1000272
711 JGI24751J29686_10093839
712 Ga0065712_10085279
713 Ga0065712_10215806
714 Ga0065715_10103416
715 Ga0070683_100005566
716 Ga0070683_100096613
717 Ga0070683_100134957
718 Ga0070683_100426329
719 Ga0070690_100635624
720 Ga0070670_101464008
721 Ga0068869_100002370
722 Ga0068869_100526688
723 Ga0068869_100583491
724 Ga0070680_100033598
725 Ga0070682_100032214
726 Ga0068868_100004794
727 Ga0068868_100020961
728 Ga0068868_100089504
729 Ga0068868_100707534
730 Ga0070660_100023194
731 Ga0070689_100103270
732 Ga0070689_100103431
733 Ga0070691_10230677
734 Ga0070687_100057813
735 Ga0070661_100050967
736 Ga0070661_100633111
737 Ga0070669_100520407
738 Ga0070675_101423635
739 Ga0070671_100341399
740 Ga0070673_102112382
741 Ga0070688_100111838
742 Ga0070709_10022872
743 Ga0070709_10039598
744 Ga0070709_10051506
745 Ga0070709_10052759
746 Ga0070709_10062417
747 Ga0070709_10162080
748 Ga0070709_10171836
749 Ga0070709_10231907
750 Ga0070709_10639471
751 Ga0070714_100006809
752 Ga0070714_100043931
753 Ga0070714_100076844
754 Ga0070714_100173340
755 Ga0070714_100176732
756 Ga0070714_100182981
757 Ga0070714_100219157
758 Ga0070714_100251674
759 Ga0070714_100374507
760 Ga0070714_100515773
761 Ga0070714_100528679
762 Ga0070713_100003409
763 Ga0070713_100011360
764 Ga0070713_100079361
765 Ga0070713_100079989
766 Ga0070713_100124500
767 Ga0070713_100136726
768 Ga0070713_100275945
769 Ga0070713_100734208
770 Ga0070710_10013298
771 Ga0070710_10647707
772 Ga0070711_100007702
773 Ga0070711_100267695
774 Ga0070711_100545682
775 Ga0070711_100731388
776 Ga0070711_100778055
777 Ga0070711_100962818
778 Ga0070711_101477662
779 Ga0070708_100000589
780 Ga0070708_100002277
781 Ga0070708_100020036
782 Ga0070708_100022011
783 Ga0070708_100082620
784 Ga0070708_100529372
785 Ga0070708_100665840
786 Ga0070663_100124783
787 Ga0070678_100607077
788 Ga0070662_100041416
789 Ga0070681_10000541
790 Ga0070681_10071843
791 Ga0070681_10181016
792 Ga0070681_10270643
793 Ga0070681_10295606
794 Ga0068867_100001820
795 Ga0068867_100140020
796 Ga0068867_100162772
797 Ga0068867_100213106
798 Ga0070685_10042283
799 Ga0070706_100000419
800 Ga0070706_100003128
801 Ga0070706_100045075
802 Ga0070706_100321027
803 Ga0070706_100429665
804 Ga0070706_100861298
805 Ga0070706_100896775
806 Ga0070706_101235139
807 Ga0070707_100002885
808 Ga0070707_100101604
809 Ga0070707_100157406
810 Ga0070707_100264679
811 Ga0070707_100846518
812 Ga0070698_100000809
813 Ga0070698_100177613
814 Ga0070698_100567769
815 Ga0070699_100003819
816 Ga0070699_100028521
817 Ga0070699_100064484
818 Ga0070699_100096949
819 Ga0070699_100192852
820 Ga0070699_100380405
821 Ga0070679_100003227
822 Ga0070679_100050666
823 Ga0070679_100169084
824 Ga0070679_100214016
825 Ga0070679_100337721
826 Ga0070684_100065092
827 Ga0070684_100670229
828 Ga0070697_100000821
829 Ga0070697_100001136
830 Ga0070697_100002177
831 Ga0070697_100007613
832 Ga0070697_100011172
833 Ga0070697_100100583
834 Ga0070697_100193964
835 Ga0070697_100473707
836 Ga0068853_100015570
837 Ga0068853_100099902
838 Ga0068853_100180935
839 Ga0068853_100511266
840 Ga0068853_100549681
841 Ga0070695_100182454
842 Ga0070695_100934097
843 Ga0070693_100017958
844 Ga0070693_100045848
845 Ga0070693_100078106
846 Ga0070693_100844016
847 Ga0070665_100678152
848 Ga0070665_101916853
849 Ga0070704_100505438
850 Ga0068855_100000427
851 Ga0068855_100003386
852 Ga0068855_100005274
853 Ga0068855_100069772
854 Ga0068855_100201805
855 Ga0068855_100220676
856 Ga0068855_101113689
857 Ga0068855_101530868
858 Ga0070664_100001749
859 Ga0070664_100058147
860 Ga0068857_100000136
861 Ga0068857_100000352
862 Ga0068857_101156089
863 Ga0068854_100006132
864 Ga0068854_100557841
865 Ga0068856_100000493
866 Ga0068856_100000913
867 Ga0068856_100003688
868 Ga0068856_100006174
869 Ga0068856_100037127
870 Ga0068856_100086860
871 Ga0068856_100553295
872 Ga0068856_100828474
873 Ga0070702_100293866
874 Ga0068852_100221865
875 Ga0068852_100238645
876 Ga0068852_100343651
877 Ga0068852_101198171
878 Ga0068859_100004990
879 Ga0068864_100006267
880 Ga0068866_10112071
881 Ga0068866_10139136
882 Ga0068870_10085270
883 Ga0068863_100043652
884 Ga0068863_100205518
885 Ga0068863_101239771
886 Ga0068858_100004899
887 Ga0068858_100006486
888 Ga0068858_100012689
889 Ga0068858_100150059
890 Ga0068858_100193273
891 Ga0068858_100276002
892 Ga0068858_100486607
893 Ga0068858_100782404
894 Ga0068860_100165500
895 Ga0068860_100228207
896 Ga0068860_100749590
897 Ga0068860_100902756
898 Ga0081540_1033718
899 Ga0081540_1112660
900 Ga0070717_10007704
901 Ga0070717_10054398
902 Ga0070717_10055551
903 Ga0070717_10061548
904 Ga0070717_10119813
905 Ga0070717_10236394
906 Ga0070717_10337504
907 Ga0070717_10496290
908 Ga0070717_10656186
909 Ga0070717_11170502
910 Ga0070715_10005301
911 Ga0070715_10021699
912 Ga0070715_10086442
913 Ga0070715_10452082
914 Ga0070716_100007884
915 Ga0070716_100014507
916 Ga0070716_100046502
917 Ga0070716_100059465
918 Ga0070716_100190666
919 Ga0070716_100238567
920 Ga0070716_100295913
921 Ga0070716_100354115
922 Ga0070716_100425044
923 Ga0070716_100642169
924 Ga0070716_101224626
925 Ga0070712_100000706
926 Ga0070712_100030065
927 Ga0070712_100054133
928 Ga0070712_100160782
929 Ga0070712_100242325
930 Ga0070712_100431446
931 Ga0070712_100614855
932 Ga0070712_101246285
933 Ga0097621_100000815
934 Ga0097621_100002310
935 Ga0097621_100003639
936 Ga0097621_100071826
937 Ga0097621_100635138
938 Ga0097621_100897084
939 Ga0068871_100000014
940 Ga0068871_100000048
941 Ga0068871_100002644
942 Ga0068871_100102906
943 Ga0068871_100295554
944 Ga0068871_100590210
945 Ga0068871_101274802
946 Ga0075433_10000204
947 Ga0075433_10018650
948 Ga0075434_100000087
949 Ga0075434_100000823
950 Ga0075434_101097525
951 Ga0068865_100030005
952 Ga0068865_100095854
953 Ga0068865_101010902
954 Ga0075436_100000746
955 Ga0075436_100006591
956 Ga0075436_100079617
957 Ga0075436_100178005
958 Ga0097620_100004990
959 Ga0075435_100000998
960 Ga0075435_100114351
961 Ga0099795_10012174
962 Ga0099795_10273098
963 Ga0099795_10350103
964 Ga0105250_10409339
965 Ga0105240_10011653
966 Ga0105240_10056667
967 Ga0105240_10084281
968 Ga0105240_10129465
969 Ga0105240_10148511
970 Ga0105240_10271243
971 Ga0105240_10574609
972 Ga0105240_11006250
973 Ga0105245_10064900
974 Ga0105245_10263028
975 Ga0105245_11784308
976 Ga0105247_10036207
977 Ga0114129_10348935
978 Ga0105241_10008984
979 Ga0105241_10027802
980 Ga0105241_10046051
981 Ga0105241_10076168
982 Ga0105241_10126144
983 Ga0105241_10227314
984 Ga0105241_10235132
985 Ga0105241_11130102
986 Ga0105242_10198063
987 Ga0105242_10359983
988 Ga0105242_10657163
989 Ga0105248_10024837
990 Ga0105248_10051809
991 Ga0105248_10118084
992 Ga0105248_10191379
993 Ga0105237_10017022
994 Ga0105237_10042971
995 Ga0105237_10206616
996 Ga0105237_10291395
997 Ga0105237_11728855
998 Ga0105238_10000135
999 Ga0105238_10303748
1000 Ga0105238_10864265
1001 Ga0105238_11322544
1002 Ga0105249_10483911
1003 Ga0099796_10122148
1004 Ga0105239_10055738
1005 Ga0105239_10076881
1006 Ga0105239_10093774
1007 Ga0105246_10341213
1008 Ga0105246_10531679
1009 Ga0105246_10587727
1010 Ga0157373_10016494
1011 Ga0157373_10062539
1012 Ga0157373_10074756
1013 Ga0157373_10134873
1014 Ga0157371_10045209
1015 Ga0157371_10140406
1016 Ga0157371_10681294
1017 Ga0157370_10056323
1018 Ga0157370_10212081
1019 Ga0157370_10357092
1020 Ga0157370_10748146
1021 Ga0157369_10000034
1022 Ga0157369_10003121
1023 Ga0157369_10029870
1024 Ga0157369_10053964
1025 Ga0157369_10077614
1026 Ga0157369_10106777
1027 Ga0157369_10185994
1028 Ga0157369_10255642
1029 Ga0157369_10323851
1030 Ga0157369_10339555
1031 Ga0157369_11434355
1032 Ga0157374_10000112
1033 Ga0157374_10000183
1034 Ga0157374_10000210
1035 Ga0157374_10032743
1036 Ga0157374_10054096
1037 Ga0157374_10841086
1038 Ga0157378_10000107
1039 Ga0157378_10000127
1040 Ga0157378_10000344
1041 Ga0157378_10007947
1042 Ga0157378_10031865
1043 Ga0157378_10359219
1044 Ga0157378_11104711
1045 Ga0163162_10011789
1046 Ga0163162_10032187
1047 Ga0163162_10065064
1048 Ga0163162_11183056
1049 Ga0157372_10000059
1050 Ga0157372_10000153
1051 Ga0157372_10000219
1052 Ga0157372_10022234
1053 Ga0157372_10022946
1054 Ga0157372_10029279
1055 Ga0157372_10036934
1056 Ga0157372_10077024
1057 Ga0157372_10140053
1058 Ga0157372_10438360
1059 Ga0157372_10728862
1060 Ga0157375_10035144
1061 Ga0163163_10219526
1062 Ga0163163_10327928
1063 Ga0163163_10404854
1064 Ga0163163_10518366
1065 Ga0163163_11375302
1066 Ga0157380_11391924
1067 Ga0182008_10108604
1068 Ga0157377_10060505
1069 Ga0157379_10078071
1070 Ga0157376_10006705
1071 Ga0157376_10223409
1072 Ga0157376_10231478
1073 Ga0157376_11279702
1074 Ga0157376_12801869
1075 Ga0182006_1063038
1076 Ga0182007_10049579
1077 Ga0213874_10030658
1078 Ga0224569_101080
1079 Ga0224571_100046
1080 Ga0224572_1010191
1081 Ga0224572_1023521
1082 Ga0224572_1033178
1083 Ga0228598_1000883
1084 Ga0228598_1042898
1085 Ga0207697_10164265
1086 Ga0207656_10470494
1087 Ga0207692_10028083
1088 Ga0207692_10314510
1089 Ga0207692_10328420
1090 Ga0207692_10529811
1091 Ga0207642_10010730
1092 Ga0207642_10083382
1093 Ga0207710_10059430
1094 Ga0207647_10006365
1095 Ga0207647_10247857
1096 Ga0207685_10007553
1097 Ga0207685_10021473
1098 Ga0207685_10036248
1099 Ga0207685_10043052
1100 Ga0207685_10048347
1101 Ga0207699_10010814
1102 Ga0207699_10064326
1103 Ga0207699_10071962
1104 Ga0207699_10326374
1105 Ga0207699_10377333
1106 Ga0207699_10564230
1107 Ga0207643_10083520
1108 Ga0207705_10609541
1109 Ga0207684_10002115
1110 Ga0207684_10012532
1111 Ga0207684_10161907
1112 Ga0207684_10236760
1113 Ga0207684_10284691
1114 Ga0207684_11012169
1115 Ga0207654_10009789
1116 Ga0207654_10118539
1117 Ga0207654_10135577
1118 Ga0207654_10190729
1119 Ga0207707_10007076
1120 Ga0207707_10187187
1121 Ga0207707_10461324
1122 Ga0207695_10040434
1123 Ga0207695_10042028
1124 Ga0207695_10109971
1125 Ga0207695_10387197
1126 Ga0207695_10732183
1127 Ga0207671_10037257
1128 Ga0207671_10043424
1129 Ga0207671_11090352
1130 Ga0207693_10000020
1131 Ga0207693_10053056
1132 Ga0207693_10195203
1133 Ga0207693_10250346
1134 Ga0207693_10259696
1135 Ga0207693_10465933
1136 Ga0207663_10068721
1137 Ga0207663_10141197
1138 Ga0207663_10294517
1139 Ga0207663_10434630
1140 Ga0207663_10606769
1141 Ga0207663_10615020
1142 Ga0207663_10644367
1143 Ga0207660_10131873
1144 Ga0207649_10190492
1145 Ga0207649_10533981
1146 Ga0207652_10076495
1147 Ga0207652_10181617
1148 Ga0207652_10263896
1149 Ga0207652_10274096
1150 Ga0207646_10001256
1151 Ga0207646_10037248
1152 Ga0207646_10147295
1153 Ga0207646_10283512
1154 Ga0207646_10605239
1155 Ga0207694_10000722
1156 Ga0207694_10335469
1157 Ga0207694_10524209
1158 Ga0207694_10903875
1159 Ga0207650_10018347
1160 Ga0207650_10478952
1161 Ga0207687_10038123
1162 Ga0207700_10007543
1163 Ga0207700_10201753
1164 Ga0207700_10203197
1165 Ga0207700_10220334
1166 Ga0207700_10227492
1167 Ga0207700_10364091
1168 Ga0207700_10695715
1169 Ga0207700_11451912
1170 Ga0207664_10004405
1171 Ga0207664_10044138
1172 Ga0207664_10238812
1173 Ga0207664_10296182
1174 Ga0207664_10402552
1175 Ga0207664_10747604
1176 Ga0207664_10993767
1177 Ga0207644_10186689
1178 Ga0207644_10253470
1179 Ga0207706_10390407
1180 Ga0207686_10307293
1181 Ga0207686_10320490
1182 Ga0207670_10265232
1183 Ga0207704_10030891
1184 Ga0207704_10053536
1185 Ga0207665_10001326
1186 Ga0207665_10011897
1187 Ga0207665_10058051
1188 Ga0207665_10066208
1189 Ga0207665_10080382
1190 Ga0207665_10107163
1191 Ga0207665_10374707
1192 Ga0207665_10385265
1193 Ga0207665_10832090
1194 Ga0207711_10050499
1195 Ga0207711_10212194
1196 Ga0207711_10368252
1197 Ga0207711_10592666
1198 Ga0207689_10000586
1199 Ga0207689_10017696
1200 Ga0207661_10012939
1201 Ga0207661_10072868
1202 Ga0207661_10462538
1203 Ga0207661_10875050
1204 Ga0207679_10001953
1205 Ga0207679_10577326
1206 Ga0207667_10002755
1207 Ga0207667_10003317
1208 Ga0207667_10015892
1209 Ga0207667_10112192
1210 Ga0207667_10181377
1211 Ga0207667_10366352
1212 Ga0207667_11469483
1213 Ga0207640_10012268
1214 Ga0207640_10073636
1215 Ga0207640_10104847
1216 Ga0207640_10298615
1217 Ga0207677_10007230
1218 Ga0207677_10010319
1219 Ga0207677_10067381
1220 Ga0207677_10182709
1221 Ga0207677_10506830
1222 Ga0207703_10004306
1223 Ga0207703_10006757
1224 Ga0207703_10049368
1225 Ga0207703_10127012
1226 Ga0207703_10173401
1227 Ga0207703_11328108
1228 Ga0207639_10006481
1229 Ga0207639_10084038
1230 Ga0207639_10154179
1231 Ga0207639_11129997
1232 Ga0207678_10021833
1233 Ga0207702_10000171
1234 Ga0207702_10017783
1235 Ga0207702_10036388
1236 Ga0207702_10051835
1237 Ga0207702_10075111
1238 Ga0207702_10648382
1239 Ga0207702_10757076
1240 Ga0207641_10020365
1241 Ga0207641_10053213
1242 Ga0207641_10205299
1243 Ga0207641_11496969
1244 Ga0207648_10029658
1245 Ga0207648_10159325
1246 Ga0207676_10047882
1247 Ga0207676_10434431
1248 Ga0207674_10000126
1249 Ga0207674_10000230
1250 Ga0207674_10243817
1251 Ga0207683_10638437
1252 Ga0207683_10714610
1253 Ga0207698_10026384
1254 Ga0207698_10193641
1255 Ga0207698_10436420
1256 Ga0207698_11893769
1257 Ga0265356_1011565
1258 Ga0265356_1011992
1259 Ga0268266_10804055
1260 Ga0268265_10170126
1261 Ga0268264_10018809
1262 Ga0268264_10019071
1263 Ga0268264_10701962
1264 Ga0265338_10067098
1265 Ga0265762_1000421
1266 Ga0265760_10003252
1267 Ga0265760_10006628
1268 Ga0265760_10039783
1269 Ga0373926_0031676
1270 Ga0373934_0246104
1271 Ga0373940_0112067
1272 Ga0373944_0364099
1273 Ga0373923_0092484
1274 Ga0373956_0294594
1275 Ga0373943_0029368
1276 Ga0373943_0266709
1277 Ga0373961_0036890
1278 Ga0373931_0062901
1279 Ga0373931_0102032
1280 Ga0373931_0162761
1281 Ga0373935_0155504
1282 Ga0373935_0564413
1283 Ga0373935_1240014
1284 Ga0373927_0141747
1285 Ga0373927_0197850
1286 Ga0373927_0982261
1287 Ga0373933_0258636
1288 Ga0373947_0028509
1289 Ga0373947_0125557
1290 Ga0373947_0135751
1291 Ga0373937_0050107
1292 Ga0373937_0475286
1293 Ga0373937_0963850
1294 Ga0373937_1213143
1295 Ga0373937_1569103
1296 Ga0373925_0002744
1297 Ga0373925_0030380
1298 Ga0373925_0647901
1299 Ga0373925_0721007
1300 Ga0395905_0045188
1301 Ga0395905_0076396
1302 Ga0395905_0103414
1303 Ga0395905_1386514
1304 Ga0436364_0178451
1305 Ga0436364_1095476
1306 Ga0436365_0960820
1307 Ga0436365_1490804
1308 Ga0436360_0002355
1309 Ga0436361_0928472
1310 Ga0436363_0292830
1311 Ga0436363_0324942
1312 Ga0451577_0142650
1313 Ga0466966_0199273
1314 Ga0466961_0083862
1315 Ga0466963_0010025
1316 Ga0466963_0011570
1317 Ga0466963_0336779
1318 Ga0466964_0115421
1319 Ga0466957_0258805
1320 Ga0466957_0348716
1321 Ga0451576_0039199
1322 Ga0451576_0076805
1323 Ga0451576_0970034
1324 Ga0451576_2606494
1325 Ga0466958_0558409
1326 Ga0466967_0003556
1327 Ga0466967_0045756
1328 Ga0466967_0524022
1329 Ga0466967_1320372
1330 Ga0495590_0210669
1331 Ga0495580_0000936
1332 Ga0495580_0013261
1333 Ga0495580_0014233
1334 Ga0495580_0036120
1335 Ga0495580_0203052
1336 Ga0495580_0253611
1337 Ga0495580_0339885
1338 Ga0495580_0462830
1339 Ga0495580_0672563
1340 Ga0495582_0066374
1341 Ga0495582_0214476
1342 Ga0495639_0029076
1343 Ga0495584_0132636
1344 Ga0495608_0334334
1345 Ga0495628_0681129
1346 Ga0495630_0032207
1347 Ga0495666_0014306
1348 Ga0495587_0301291
1349 Ga0495587_0581580
1350 Ga0495657_0536559
1351 Ga0495599_0722893
1352 Ga0495669_0220482
1353 Ga0495669_0345813
1354 Ga0495674_0050350
1355 Ga0495674_0133803
1356 Ga0495674_0175666
1357 Ga0495674_0474914
1358 Ga0495675_0136180
1359 Ga0495675_0331302
1360 Ga0495602_0087875
1361 Ga0496100_0016893
1362 Ga0496100_0068002
1363 Ga0496100_0238297
1364 Ga0496101_0249589
1365 Ga0496102_0060928
1366 Ga0496102_0119330
1367 Ga0496102_0416171
1368 Ga0496102_0539385
1369 Ga0496102_1120603
1370 Ga0496103_0020673
1371 Ga0496103_0134917
1372 Ga0496104_0011263
1373 Ga0496104_0014124
1374 Ga0496104_0020787
1375 Ga0496104_0052992
1376 Ga0496104_1374951
1377 Ga0496105_0116323
1378 Ga0496105_0171582
1379 Ga0496105_0250155
1380 Ga0496106_0011666
1381 Ga0496106_0038848
1382 Ga0496106_0273642
1383 Ga0496107_0125210
1384 Ga0496107_0327342
1385 Ga0496109_0138547
1386 Ga0496109_0931145
1387 Ga0496110_0363414
1388 Ga0496111_0102561
1389 Ga0496111_0772517
1390 Ga0496112_0009231
1391 Ga0496112_0011890
1392 Ga0496112_0012866
1393 Ga0496112_0023709
1394 Ga0496112_0028596
1395 Ga0496112_0170587
1396 Ga0496113_0064459
1397 Ga0496113_0675932
1398 Ga0496114_0165662
1399 Ga0496114_0496908
1400 Ga0496115_0159831
1401 Ga0496115_0375320
1402 Ga0496115_0497636
1403 nmdc:mga05p37_313951_c1
1404 nmdc:mga0n895_1001883_c1
1405 nmdc:mga0n895_128_c1
1406 nmdc:mga0n895_428_c1
1407 nmdc:mga0n895_74040_c1
1408 nmdc:mga0rr50_106_c1
1409 nmdc:mga0rr50_1454246_c1
1410 nmdc:mga0rr50_44679_c1
1411 nmdc:mga08x19_2388_c1
1412 nmdc:mga08x19_3180_c1
1413 nmdc:mga08x19_42798_c1
1414 nmdc:mga0a205_5600_c1
1415 nmdc:mga0a205_5673_c1
1416 Ga0495612_0197853

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

36

103

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.9542 5 74
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.9202 5 75
6vbw-assembly1.cif.gz_I cryo-em structure of cascade-tniq-dsdna ternary complex 0.914 4 32
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.9057 5 64
6jni-assembly3.cif.gz_E crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9048 5 72
ID Description Score Start End Superfamily
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9542 5 74 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.903 2 68 1.10.1660.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8965 5 49 1.10.10.10
3pl5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.8964 41 72 3.40.50.10440
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8791 5 78 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A2V9VAG4-F1-model_v4 MerR family transcriptional regulator 0.9687 1 141 GO:0003677
GO:0003700
AF-D1CHH3-F1-model_v4 Transcriptional regulator, MerR family 0.9651 1 77 GO:0003677
GO:0006355
AF-Q1IS29-F1-model_v4 Transcriptional regulator, MerR family 0.9622 1 140 GO:0003677
GO:0003700
AF-A0A7C2RYC8-F1-model_v4 MerR family transcriptional regulator 0.9615 4 77
AF-A0A3C0KZV5-F1-model_v4 HTH merR-type domain-containing protein 0.949 3 72 GO:0003677
GO:0006355

Map