F476528
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 323 | 707 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100030759|Ga0070698_1000307592 |
| Length | 232 |
| Sequence | MREARSDRFEPRRLGSVETSSQTAGRAYPVRFDVEYPDRDLDRLTTAFRIFVAIPILIVAGAVGGHQSTYQAGRHGWTVATGAGGLVVLAPLLMIVFRQKYPRWWYDWNLELQRFSSRVGVYLALMDDRYPSTDEHQSVSLDFPYPDVKTDLNRWLPLVKWLLAIPHYVVLIFLWLAALVSVIIAWFAILFTGRYPRGLFDFVLGVFRWTNRVIGYAFVLVTDEYPPFRLSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 239 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.61 |
| Rhizosphere | 88.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10074723 | 3300001979 | Bacteria | 899 |
| 2 | JGI24744J21845_10005541 | 3300002077 | Bacteria | 2612 |
| 3 | JGI24033J26618_1015790 | 3300002155 | Bacteria | 935 |
| 4 | JGI24751J29686_10036987 | 3300002459 | Bacteria | 1011 |
| 5 | JGI25406J46586_10002793 | 3300003203 | Bacteria | 8211 |
| 6 | Ga0070658_10004588 | 3300005327 | Bacteria | 11224 |
| 7 | Ga0070676_10515296 | 3300005328 | Bacteria | 851 |
| 8 | Ga0070683_100002243 | 3300005329 | Bacteria | 15326 |
| 9 | Ga0070683_100838581 | 3300005329 | Bacteria | 881 |
| 10 | Ga0070690_100052433 | 3300005330 | Bacteria | 2608 |
| 11 | Ga0070690_100450003 | 3300005330 | Bacteria | 955 |
| 12 | Ga0070670_100060122 | 3300005331 | Bacteria | 3262 |
| 13 | Ga0068869_100004228 | 3300005334 | Bacteria | 8909 |
| 14 | Ga0070666_10109394 | 3300005335 | Bacteria | 1910 |
| 15 | Ga0070666_10281271 | 3300005335 | Bacteria | 1183 |
| 16 | Ga0070680_100003234 | 3300005336 | Bacteria | 12124 |
| 17 | Ga0070680_100090747 | 3300005336 | Bacteria | 2529 |
| 18 | Ga0070682_100002451 | 3300005337 | Bacteria | 10247 |
| 19 | Ga0070682_100003625 | 3300005337 | Bacteria | 8562 |
| 20 | Ga0068868_100005180 | 3300005338 | Bacteria | 9150 |
| 21 | Ga0070660_100008595 | 3300005339 | Bacteria | 7148 |
| 22 | Ga0070660_100092259 | 3300005339 | Bacteria | 2390 |
| 23 | Ga0070660_100200978 | 3300005339 | Bacteria | 1616 |
| 24 | Ga0070689_100056419 | 3300005340 | Bacteria | 3045 |
| 25 | Ga0070689_100065108 | 3300005340 | Bacteria | 2838 |
| 26 | Ga0070691_10005633 | 3300005341 | Bacteria | 5706 |
| 27 | Ga0070687_100005734 | 3300005343 | Bacteria | 5039 |
| 28 | Ga0070661_100050120 | 3300005344 | Bacteria | 3055 |
| 29 | Ga0070661_100101051 | 3300005344 | Bacteria | 2145 |
| 30 | Ga0070692_10002446 | 3300005345 | Bacteria | 7213 |
| 31 | Ga0070692_10058446 | 3300005345 | Bacteria | 2025 |
| 32 | Ga0070668_100011757 | 3300005347 | Bacteria | 6518 |
| 33 | Ga0070675_100005835 | 3300005354 | Bacteria | 9430 |
| 34 | Ga0070671_100002212 | 3300005355 | Bacteria | 15019 |
| 35 | Ga0070671_100089380 | 3300005355 | Bacteria | 2579 |
| 36 | Ga0070673_100908437 | 3300005364 | Bacteria | 817 |
| 37 | Ga0070688_100091260 | 3300005365 | Bacteria | 1990 |
| 38 | Ga0070659_100039165 | 3300005366 | Bacteria | 3699 |
| 39 | Ga0070667_100342516 | 3300005367 | Bacteria | 1352 |
| 40 | Ga0070709_10050272 | 3300005434 | Bacteria | 2611 |
| 41 | Ga0070709_10145195 | 3300005434 | Bacteria | 1634 |
| 42 | Ga0070709_10821633 | 3300005434 | Bacteria | 731 |
| 43 | Ga0070714_100062094 | 3300005435 | Bacteria | 3211 |
| 44 | Ga0070713_100001480 | 3300005436 | Bacteria | 14974 |
| 45 | Ga0070713_100895068 | 3300005436 | Bacteria | 853 |
| 46 | Ga0070710_10009130 | 3300005437 | Bacteria | 4848 |
| 47 | Ga0070710_10105434 | 3300005437 | Bacteria | 1685 |
| 48 | Ga0070710_10344629 | 3300005437 | Bacteria | 985 |
| 49 | Ga0070701_10068936 | 3300005438 | Bacteria | 1885 |
| 50 | Ga0070701_10112118 | 3300005438 | Bacteria | 1525 |
| 51 | Ga0070711_100030904 | 3300005439 | Bacteria | 3550 |
| 52 | Ga0070705_100024691 | 3300005440 | Bacteria | 3248 |
| 53 | Ga0070705_100071486 | 3300005440 | Bacteria | 2099 |
| 54 | Ga0070705_100105433 | 3300005440 | Bacteria | 1790 |
| 55 | Ga0070700_100198343 | 3300005441 | Bacteria | 1408 |
| 56 | Ga0070700_100301661 | 3300005441 | Bacteria | 1169 |
| 57 | Ga0070694_100046715 | 3300005444 | Bacteria | 2908 |
| 58 | Ga0070694_100211481 | 3300005444 | Bacteria | 1451 |
| 59 | Ga0070708_100120157 | 3300005445 | Bacteria | 2423 |
| 60 | Ga0070708_100278337 | 3300005445 | Bacteria | 1575 |
| 61 | Ga0070708_100405356 | 3300005445 | Bacteria | 1286 |
| 62 | Ga0070708_100475849 | 3300005445 | Bacteria | 1178 |
| 63 | Ga0070708_100539011 | 3300005445 | Unclassified | 1101 |
| 64 | Ga0070663_100006626 | 3300005455 | Bacteria | 6982 |
| 65 | Ga0070678_100001440 | 3300005456 | Bacteria | 12678 |
| 66 | Ga0070678_100008130 | 3300005456 | Bacteria | 6267 |
| 67 | Ga0070678_100140394 | 3300005456 | Bacteria | 1932 |
| 68 | Ga0070662_100005090 | 3300005457 | Bacteria | 8374 |
| 69 | Ga0070681_10480988 | 3300005458 | Bacteria | 1154 |
| 70 | Ga0070681_10523595 | 3300005458 | Bacteria | 1099 |
| 71 | Ga0068867_100002296 | 3300005459 | Bacteria | 13445 |
| 72 | Ga0070685_10008151 | 3300005466 | Bacteria | 5369 |
| 73 | Ga0070685_10032550 | 3300005466 | Bacteria | 2921 |
| 74 | Ga0070706_100000065 | 3300005467 | Bacteria | 125557 |
| 75 | Ga0070706_100006302 | 3300005467 | Bacteria | 11210 |
| 76 | Ga0070706_100066105 | 3300005467 | Bacteria | 3345 |
| 77 | Ga0070706_100092842 | 3300005467 | Bacteria | 2800 |
| 78 | Ga0070707_100000131 | 3300005468 | Bacteria | 70101 |
| 79 | Ga0070707_100003323 | 3300005468 | Bacteria | 15188 |
| 80 | Ga0070707_100008114 | 3300005468 | Bacteria | 9740 |
| 81 | Ga0070707_100024321 | 3300005468 | Bacteria | 5736 |
| 82 | Ga0070707_100131426 | 3300005468 | Bacteria | 2434 |
| 83 | Ga0070707_100242857 | 3300005468 | Bacteria | 1753 |
| 84 | Ga0070707_100428993 | 3300005468 | Bacteria | 1282 |
| 85 | Ga0070707_100622588 | 3300005468 | Bacteria | 1042 |
| 86 | Ga0070698_100000457 | 3300005471 | Bacteria | 43263 |
| 87 | Ga0070698_100000503 | 3300005471 | Bacteria | 41519 |
| 88 | Ga0070698_100026040 | 3300005471 | Bacteria | 6092 |
| 89 | Ga0070698_100030759 | 3300005471 | Bacteria | 5566 |
| 90 | Ga0070698_100203811 | 3300005471 | Bacteria | 1913 |
| 91 | Ga0070698_100329694 | 3300005471 | Bacteria | 1457 |
| 92 | Ga0070699_100000758 | 3300005518 | Bacteria | 29797 |
| 93 | Ga0070699_100012018 | 3300005518 | Bacteria | 7474 |
| 94 | Ga0070699_100021897 | 3300005518 | Bacteria | 5508 |
| 95 | Ga0070699_100071335 | 3300005518 | Bacteria | 3021 |
| 96 | Ga0070699_100096932 | 3300005518 | Bacteria | 2583 |
| 97 | Ga0070699_100196842 | 3300005518 | Bacteria | 1791 |
| 98 | Ga0070699_100233946 | 3300005518 | Bacteria | 1639 |
| 99 | Ga0070699_100339894 | 3300005518 | Bacteria | 1351 |
| 100 | Ga0070679_100028110 | 3300005530 | Bacteria | 5542 |
| 101 | Ga0070684_100003076 | 3300005535 | Bacteria | 12452 |
| 102 | Ga0070684_100488959 | 3300005535 | Bacteria | 1139 |
| 103 | Ga0070684_101057851 | 3300005535 | Bacteria | 762 |
| 104 | Ga0070697_100009116 | 3300005536 | Bacteria | 7751 |
| 105 | Ga0070697_100164640 | 3300005536 | Bacteria | 1875 |
| 106 | Ga0070697_100238156 | 3300005536 | Bacteria | 1553 |
| 107 | Ga0070697_100375430 | 3300005536 | Bacteria | 1231 |
| 108 | Ga0068853_100136108 | 3300005539 | Bacteria | 2202 |
| 109 | Ga0068853_100562788 | 3300005539 | Bacteria | 1081 |
| 110 | Ga0070672_100051493 | 3300005543 | Bacteria | 3211 |
| 111 | Ga0070672_100345727 | 3300005543 | Bacteria | 1267 |
| 112 | Ga0070686_100000541 | 3300005544 | Bacteria | 22572 |
| 113 | Ga0070695_100011574 | 3300005545 | Bacteria | 5278 |
| 114 | Ga0070695_100065136 | 3300005545 | Bacteria | 2372 |
| 115 | Ga0070695_100106767 | 3300005545 | Bacteria | 1894 |
| 116 | Ga0070696_100002148 | 3300005546 | Bacteria | 12975 |
| 117 | Ga0070696_100080603 | 3300005546 | Bacteria | 2305 |
| 118 | Ga0070696_100166306 | 3300005546 | Unclassified | 1628 |
| 119 | Ga0070696_100464609 | 3300005546 | Bacteria | 1001 |
| 120 | Ga0070693_100005315 | 3300005547 | Bacteria | 6172 |
| 121 | Ga0070693_100249090 | 3300005547 | Bacteria | 1177 |
| 122 | Ga0070665_100009491 | 3300005548 | Bacteria | 9842 |
| 123 | Ga0070665_100608723 | 3300005548 | Bacteria | 1105 |
| 124 | Ga0070704_100052427 | 3300005549 | Bacteria | 2878 |
| 125 | Ga0070704_100073129 | 3300005549 | Bacteria | 2496 |
| 126 | Ga0070704_100103505 | 3300005549 | Bacteria | 2151 |
| 127 | Ga0068855_100028546 | 3300005563 | Bacteria | 6675 |
| 128 | Ga0068855_100030312 | 3300005563 | Bacteria | 6470 |
| 129 | Ga0068855_100539765 | 3300005563 | Bacteria | 1263 |
| 130 | Ga0068855_100680326 | 3300005563 | Bacteria | 1103 |
| 131 | Ga0070664_100542920 | 3300005564 | Bacteria | 1074 |
| 132 | Ga0068857_100001706 | 3300005577 | Bacteria | 17670 |
| 133 | Ga0068857_100711963 | 3300005577 | Bacteria | 954 |
| 134 | Ga0068854_100277699 | 3300005578 | Bacteria | 1347 |
| 135 | Ga0068856_100002949 | 3300005614 | Bacteria | 17441 |
| 136 | Ga0068856_100019295 | 3300005614 | Bacteria | 6618 |
| 137 | Ga0068856_100056231 | 3300005614 | Bacteria | 3882 |
| 138 | Ga0068856_100380229 | 3300005614 | Bacteria | 1431 |
| 139 | Ga0070702_100000382 | 3300005615 | Bacteria | 15658 |
| 140 | Ga0070702_100004033 | 3300005615 | Bacteria | 6663 |
| 141 | Ga0068852_100051841 | 3300005616 | Bacteria | 3524 |
| 142 | Ga0068852_100056400 | 3300005616 | Bacteria | 3395 |
| 143 | Ga0068852_101166921 | 3300005616 | Unclassified | 791 |
| 144 | Ga0068859_100484160 | 3300005617 | Bacteria | 1333 |
| 145 | Ga0068859_101003495 | 3300005617 | Bacteria | 917 |
| 146 | Ga0068864_100006746 | 3300005618 | Bacteria | 9403 |
| 147 | Ga0068864_100209066 | 3300005618 | Bacteria | 1796 |
| 148 | Ga0068864_100361375 | 3300005618 | Bacteria | 1372 |
| 149 | Ga0068866_10002211 | 3300005718 | Bacteria | 8080 |
| 150 | Ga0068861_100008038 | 3300005719 | Bacteria | 7259 |
| 151 | Ga0068861_100042333 | 3300005719 | Bacteria | 3413 |
| 152 | Ga0068861_100120082 | 3300005719 | Bacteria | 2119 |
| 153 | Ga0068851_10048040 | 3300005834 | Bacteria | 2163 |
| 154 | Ga0068870_10000205 | 3300005840 | Bacteria | 21167 |
| 155 | Ga0068863_100035875 | 3300005841 | Bacteria | 4722 |
| 156 | Ga0068863_100174280 | 3300005841 | Bacteria | 2064 |
| 157 | Ga0068858_100578215 | 3300005842 | Bacteria | 1089 |
| 158 | Ga0068860_100015607 | 3300005843 | Bacteria | 7418 |
| 159 | Ga0068860_100080871 | 3300005843 | Bacteria | 3090 |
| 160 | Ga0068860_100647358 | 3300005843 | Bacteria | 1064 |
| 161 | Ga0068862_100054129 | 3300005844 | Bacteria | 3436 |
| 162 | Ga0081455_10001937 | 3300005937 | Bacteria | 24871 |
| 163 | Ga0081455_10007927 | 3300005937 | Bacteria | 11112 |
| 164 | Ga0081455_10023020 | 3300005937 | Bacteria | 5807 |
| 165 | Ga0081455_10027319 | 3300005937 | Bacteria | 5230 |
| 166 | Ga0081455_10534450 | 3300005937 | Bacteria | 779 |
| 167 | Ga0081538_10006131 | 3300005981 | Bacteria | 10668 |
| 168 | Ga0081538_10016642 | 3300005981 | Bacteria | 5625 |
| 169 | Ga0081538_10036742 | 3300005981 | Bacteria | 3190 |
| 170 | Ga0081538_10058845 | 3300005981 | Bacteria | 2225 |
| 171 | Ga0081540_1089031 | 3300005983 | Bacteria | 1363 |
| 172 | Ga0081539_10000409 | 3300005985 | Bacteria | 91550 |
| 173 | Ga0081539_10011230 | 3300005985 | Bacteria | 7122 |
| 174 | Ga0070717_10039636 | 3300006028 | Bacteria | 3834 |
| 175 | Ga0070717_10080248 | 3300006028 | Bacteria | 2737 |
| 176 | Ga0070717_10307536 | 3300006028 | Bacteria | 1410 |
| 177 | Ga0070717_10356165 | 3300006028 | Bacteria | 1309 |
| 178 | Ga0070717_10523614 | 3300006028 | Bacteria | 1073 |
| 179 | Ga0075432_10005834 | 3300006058 | Bacteria | 4190 |
| 180 | Ga0075432_10006844 | 3300006058 | Bacteria | 3884 |
| 181 | Ga0075432_10019965 | 3300006058 | Bacteria | 2292 |
| 182 | Ga0075432_10046682 | 3300006058 | Bacteria | 1521 |
| 183 | Ga0070716_100014134 | 3300006173 | Bacteria | 4084 |
| 184 | Ga0070716_100096027 | 3300006173 | Bacteria | 1806 |
| 185 | Ga0070716_100283573 | 3300006173 | Bacteria | 1144 |
| 186 | Ga0070716_100534585 | 3300006173 | Bacteria | 871 |
| 187 | Ga0070712_100005736 | 3300006175 | Bacteria | 7679 |
| 188 | Ga0070712_100866426 | 3300006175 | Bacteria | 777 |
| 189 | Ga0097621_100044929 | 3300006237 | Bacteria | 3566 |
| 190 | Ga0097621_100673223 | 3300006237 | Bacteria | 951 |
| 191 | Ga0068871_100371258 | 3300006358 | Bacteria | 1269 |
| 192 | Ga0075428_100047490 | 3300006844 | Bacteria | 4716 |
| 193 | Ga0075428_100080857 | 3300006844 | Bacteria | 3547 |
| 194 | Ga0075428_100654984 | 3300006844 | Bacteria | 1120 |
| 195 | Ga0075428_101182236 | 3300006844 | Bacteria | 806 |
| 196 | Ga0075430_100391474 | 3300006846 | Bacteria | 1147 |
| 197 | Ga0075431_100004110 | 3300006847 | Bacteria | 14214 |
| 198 | Ga0075431_100162565 | 3300006847 | Bacteria | 2295 |
| 199 | Ga0075431_100198408 | 3300006847 | Bacteria | 2054 |
| 200 | Ga0075433_10002396 | 3300006852 | Bacteria | 14261 |
| 201 | Ga0075433_10042872 | 3300006852 | Bacteria | 3927 |
| 202 | Ga0075433_10144164 | 3300006852 | Bacteria | 2117 |
| 203 | Ga0075433_10324913 | 3300006852 | Bacteria | 1361 |
| 204 | Ga0075433_10459580 | 3300006852 | Bacteria | 1122 |
| 205 | Ga0075434_100010463 | 3300006871 | Bacteria | 8698 |
| 206 | Ga0075434_100092515 | 3300006871 | Bacteria | 3027 |
| 207 | Ga0075434_100113934 | 3300006871 | Bacteria | 2716 |
| 208 | Ga0075434_100228877 | 3300006871 | Bacteria | 1878 |
| 209 | Ga0075434_100416616 | 3300006871 | Bacteria | 1364 |
| 210 | Ga0075434_100449101 | 3300006871 | Bacteria | 1310 |
| 211 | Ga0075429_100242417 | 3300006880 | Bacteria | 1579 |
| 212 | Ga0068865_100000372 | 3300006881 | Bacteria | 24843 |
| 213 | Ga0075436_100067131 | 3300006914 | Bacteria | 2479 |
| 214 | Ga0075436_100098847 | 3300006914 | Bacteria | 2031 |
| 215 | Ga0075436_100234205 | 3300006914 | Bacteria | 1305 |
| 216 | Ga0075436_100496273 | 3300006914 | Bacteria | 893 |
| 217 | Ga0097620_100484111 | 3300006931 | Bacteria | 1333 |
| 218 | Ga0097620_101003361 | 3300006931 | Bacteria | 917 |
| 219 | Ga0075435_100001480 | 3300007076 | Bacteria | 15092 |
| 220 | Ga0075435_100022943 | 3300007076 | Bacteria | 4818 |
| 221 | Ga0075435_100172070 | 3300007076 | Bacteria | 1827 |
| 222 | Ga0075435_100178253 | 3300007076 | Bacteria | 1795 |
| 223 | Ga0075435_100520787 | 3300007076 | Bacteria | 1029 |
| 224 | Ga0105240_11038394 | 3300009093 | Bacteria | 875 |
| 225 | Ga0111539_10000950 | 3300009094 | Bacteria | 37974 |
| 226 | Ga0111539_10020930 | 3300009094 | Bacteria | 8054 |
| 227 | Ga0111539_10067800 | 3300009094 | Bacteria | 4213 |
| 228 | Ga0105245_10003696 | 3300009098 | Bacteria | 13653 |
| 229 | Ga0105245_10010965 | 3300009098 | Bacteria | 7886 |
| 230 | Ga0105245_10013986 | 3300009098 | Bacteria | 6989 |
| 231 | Ga0105245_10072043 | 3300009098 | Bacteria | 3139 |
| 232 | Ga0105245_10088962 | 3300009098 | Bacteria | 2837 |
| 233 | Ga0105247_10010220 | 3300009101 | Bacteria | 5679 |
| 234 | Ga0114129_10041874 | 3300009147 | Bacteria | 6449 |
| 235 | Ga0114129_10069564 | 3300009147 | Bacteria | 4907 |
| 236 | Ga0114129_10133650 | 3300009147 | Bacteria | 3406 |
| 237 | Ga0114129_10345416 | 3300009147 | Bacteria | 1972 |
| 238 | Ga0114129_10570683 | 3300009147 | Bacteria | 1469 |
| 239 | Ga0105243_10000793 | 3300009148 | Bacteria | 30289 |
| 240 | Ga0105243_10208169 | 3300009148 | Bacteria | 1720 |
| 241 | Ga0105243_11064821 | 3300009148 | Bacteria | 815 |
| 242 | Ga0105241_10028278 | 3300009174 | Bacteria | 4178 |
| 243 | Ga0105241_10068929 | 3300009174 | Bacteria | 2742 |
| 244 | Ga0105242_10008195 | 3300009176 | Bacteria | 8029 |
| 245 | Ga0105242_10324106 | 3300009176 | Bacteria | 1414 |
| 246 | Ga0105242_10707678 | 3300009176 | Bacteria | 986 |
| 247 | Ga0105248_10048963 | 3300009177 | Bacteria | 4740 |
| 248 | Ga0105248_10139157 | 3300009177 | Bacteria | 2738 |
| 249 | Ga0105248_10532112 | 3300009177 | Bacteria | 1325 |
| 250 | Ga0105248_11324139 | 3300009177 | Bacteria | 815 |
| 251 | Ga0105237_10082301 | 3300009545 | Bacteria | 3210 |
| 252 | Ga0105238_10070609 | 3300009551 | Bacteria | 3491 |
| 253 | Ga0105238_10090098 | 3300009551 | Bacteria | 3054 |
| 254 | Ga0105238_10800676 | 3300009551 | Bacteria | 958 |
| 255 | Ga0105249_10001946 | 3300009553 | Bacteria | 17925 |
| 256 | Ga0105249_10025423 | 3300009553 | Bacteria | 5331 |
| 257 | Ga0105239_10002279 | 3300010375 | Bacteria | 24494 |
| 258 | Ga0105239_10063676 | 3300010375 | Bacteria | 4049 |
| 259 | Ga0105239_10266060 | 3300010375 | Bacteria | 1928 |
| 260 | Ga0105239_10268144 | 3300010375 | Bacteria | 1920 |
| 261 | Ga0105239_11170340 | 3300010375 | Bacteria | 886 |
| 262 | Ga0105246_10009444 | 3300011119 | Bacteria | 6010 |
| 263 | Ga0157373_10108843 | 3300013100 | Bacteria | 1949 |
| 264 | Ga0157371_10021950 | 3300013102 | Bacteria | 4685 |
| 265 | Ga0157371_10139754 | 3300013102 | Bacteria | 1725 |
| 266 | Ga0157370_10075643 | 3300013104 | Bacteria | 3174 |
| 267 | Ga0157369_10147677 | 3300013105 | Bacteria | 2485 |
| 268 | Ga0157374_10573924 | 3300013296 | Bacteria | 1137 |
| 269 | Ga0157378_10004177 | 3300013297 | Bacteria | 12749 |
| 270 | Ga0157378_10636324 | 3300013297 | Bacteria | 1081 |
| 271 | Ga0163162_10017450 | 3300013306 | Bacteria | 7023 |
| 272 | Ga0163162_10248705 | 3300013306 | Bacteria | 1910 |
| 273 | Ga0157372_10347315 | 3300013307 | Bacteria | 1728 |
| 274 | Ga0157375_10025598 | 3300013308 | Bacteria | 5486 |
| 275 | Ga0157375_10357089 | 3300013308 | Bacteria | 1627 |
| 276 | Ga0157375_11120480 | 3300013308 | Bacteria | 922 |
| 277 | Ga0163163_10062366 | 3300014325 | Bacteria | 3694 |
| 278 | Ga0157380_10045294 | 3300014326 | Unclassified | 3451 |
| 279 | Ga0182008_10073794 | 3300014497 | Bacteria | 1678 |
| 280 | Ga0157377_10004325 | 3300014745 | Bacteria | 6522 |
| 281 | Ga0157379_10030327 | 3300014968 | Bacteria | 4813 |
| 282 | Ga0157379_10866115 | 3300014968 | Bacteria | 855 |
| 283 | Ga0163161_10125838 | 3300017792 | Bacteria | 1930 |
| 284 | Ga0197907_11372322 | 3300020069 | Bacteria | 1352 |
| 285 | Ga0206355_1456876 | 3300020076 | Bacteria | 820 |
| 286 | Ga0206350_10218199 | 3300020080 | Bacteria | 1099 |
| 287 | Ga0213875_10000644 | 3300021388 | Bacteria | 27796 |
| 288 | Ga0207656_10062722 | 3300025321 | Bacteria | 1634 |
| 289 | Ga0207653_10014749 | 3300025885 | Bacteria | 2453 |
| 290 | Ga0207692_10005823 | 3300025898 | Bacteria | 4967 |
| 291 | Ga0207692_10136226 | 3300025898 | Bacteria | 1392 |
| 292 | Ga0207642_10216728 | 3300025899 | Unclassified | 1067 |
| 293 | Ga0207710_10040870 | 3300025900 | Bacteria | 2056 |
| 294 | Ga0207710_10177513 | 3300025900 | Bacteria | 1044 |
| 295 | Ga0207688_10193623 | 3300025901 | Bacteria | 1217 |
| 296 | Ga0207680_10146962 | 3300025903 | Bacteria | 1568 |
| 297 | Ga0207680_10272807 | 3300025903 | Bacteria | 1173 |
| 298 | Ga0207647_10160735 | 3300025904 | Bacteria | 1310 |
| 299 | Ga0207699_10151533 | 3300025906 | Bacteria | 1535 |
| 300 | Ga0207699_10477774 | 3300025906 | Bacteria | 897 |
| 301 | Ga0207699_10622902 | 3300025906 | Bacteria | 787 |
| 302 | Ga0207643_10000027 | 3300025908 | Bacteria | 99423 |
| 303 | Ga0207705_10056214 | 3300025909 | Bacteria | 2837 |
| 304 | Ga0207705_10465155 | 3300025909 | Bacteria | 981 |
| 305 | Ga0207684_10000071 | 3300025910 | Bacteria | 185783 |
| 306 | Ga0207684_10018854 | 3300025910 | Bacteria | 5902 |
| 307 | Ga0207684_10038969 | 3300025910 | Bacteria | 4032 |
| 308 | Ga0207684_10051955 | 3300025910 | Bacteria | 3477 |
| 309 | Ga0207684_10238217 | 3300025910 | Bacteria | 1570 |
| 310 | Ga0207654_10035180 | 3300025911 | Bacteria | 2789 |
| 311 | Ga0207707_10404181 | 3300025912 | Bacteria | 1172 |
| 312 | Ga0207671_10185819 | 3300025914 | Bacteria | 1619 |
| 313 | Ga0207693_10004357 | 3300025915 | Bacteria | 11970 |
| 314 | Ga0207693_10009922 | 3300025915 | Bacteria | 7741 |
| 315 | Ga0207693_10030056 | 3300025915 | Bacteria | 4289 |
| 316 | Ga0207663_10005856 | 3300025916 | Bacteria | 6234 |
| 317 | Ga0207663_10062908 | 3300025916 | Bacteria | 2361 |
| 318 | Ga0207660_10080347 | 3300025917 | Bacteria | 2394 |
| 319 | Ga0207660_10281095 | 3300025917 | Bacteria | 1321 |
| 320 | Ga0207660_10807580 | 3300025917 | Bacteria | 765 |
| 321 | Ga0207662_10080352 | 3300025918 | Bacteria | 1989 |
| 322 | Ga0207657_10017530 | 3300025919 | Bacteria | 6862 |
| 323 | Ga0207657_10109231 | 3300025919 | Bacteria | 2286 |
| 324 | Ga0207649_10003298 | 3300025920 | Bacteria | 8835 |
| 325 | Ga0207652_10492747 | 3300025921 | Bacteria | 1103 |
| 326 | Ga0207646_10000135 | 3300025922 | Bacteria | 100459 |
| 327 | Ga0207646_10000809 | 3300025922 | Bacteria | 40727 |
| 328 | Ga0207646_10003386 | 3300025922 | Bacteria | 18036 |
| 329 | Ga0207646_10015155 | 3300025922 | Bacteria | 7293 |
| 330 | Ga0207646_10033131 | 3300025922 | Bacteria | 4675 |
| 331 | Ga0207646_10180699 | 3300025922 | Bacteria | 1905 |
| 332 | Ga0207646_10316659 | 3300025922 | Bacteria | 1410 |
| 333 | Ga0207646_10536978 | 3300025922 | Bacteria | 1052 |
| 334 | Ga0207646_10890752 | 3300025922 | Bacteria | 790 |
| 335 | Ga0207694_10175535 | 3300025924 | Bacteria | 1736 |
| 336 | Ga0207650_10001414 | 3300025925 | Bacteria | 17301 |
| 337 | Ga0207650_10004873 | 3300025925 | Bacteria | 9170 |
| 338 | Ga0207659_10018351 | 3300025926 | Bacteria | 4586 |
| 339 | Ga0207687_10025966 | 3300025927 | Bacteria | 3921 |
| 340 | Ga0207687_10108393 | 3300025927 | Bacteria | 2056 |
| 341 | Ga0207687_10396027 | 3300025927 | Bacteria | 1135 |
| 342 | Ga0207687_10456279 | 3300025927 | Unclassified | 1061 |
| 343 | Ga0207700_10000022 | 3300025928 | Bacteria | 166246 |
| 344 | Ga0207700_10337043 | 3300025928 | Bacteria | 1310 |
| 345 | Ga0207664_10202591 | 3300025929 | Bacteria | 1714 |
| 346 | Ga0207644_10050042 | 3300025931 | Bacteria | 2994 |
| 347 | Ga0207644_10348164 | 3300025931 | Bacteria | 1202 |
| 348 | Ga0207690_10016743 | 3300025932 | Bacteria | 4467 |
| 349 | Ga0207706_10006899 | 3300025933 | Bacteria | 10501 |
| 350 | Ga0207706_10400723 | 3300025933 | Unclassified | 1190 |
| 351 | Ga0207686_10001561 | 3300025934 | Bacteria | 12935 |
| 352 | Ga0207709_10059247 | 3300025935 | Bacteria | 2383 |
| 353 | Ga0207709_10454498 | 3300025935 | Bacteria | 991 |
| 354 | Ga0207670_10034204 | 3300025936 | Bacteria | 3282 |
| 355 | Ga0207670_10075831 | 3300025936 | Bacteria | 2339 |
| 356 | Ga0207669_10005754 | 3300025937 | Bacteria | 5596 |
| 357 | Ga0207704_10045753 | 3300025938 | Bacteria | 2602 |
| 358 | Ga0207665_10023234 | 3300025939 | Bacteria | 4084 |
| 359 | Ga0207665_10025500 | 3300025939 | Bacteria | 3901 |
| 360 | Ga0207665_10039123 | 3300025939 | Bacteria | 3161 |
| 361 | Ga0207665_10288231 | 3300025939 | Bacteria | 1224 |
| 362 | Ga0207665_10368727 | 3300025939 | Bacteria | 1087 |
| 363 | Ga0207691_10027054 | 3300025940 | Bacteria | 5382 |
| 364 | Ga0207691_10210400 | 3300025940 | Bacteria | 1689 |
| 365 | Ga0207711_10104176 | 3300025941 | Bacteria | 2513 |
| 366 | Ga0207711_10121079 | 3300025941 | Bacteria | 2336 |
| 367 | Ga0207689_10004346 | 3300025942 | Bacteria | 12911 |
| 368 | Ga0207689_10185610 | 3300025942 | Bacteria | 1715 |
| 369 | Ga0207661_10007251 | 3300025944 | Bacteria | 7885 |
| 370 | Ga0207661_10012002 | 3300025944 | Bacteria | 6294 |
| 371 | Ga0207679_10009014 | 3300025945 | Bacteria | 6377 |
| 372 | Ga0207679_10238083 | 3300025945 | Bacteria | 1541 |
| 373 | Ga0207667_10026785 | 3300025949 | Bacteria | 6290 |
| 374 | Ga0207667_10048066 | 3300025949 | Bacteria | 4513 |
| 375 | Ga0207667_10079878 | 3300025949 | Bacteria | 3389 |
| 376 | Ga0207651_10037039 | 3300025960 | Bacteria | 3192 |
| 377 | Ga0207712_10001816 | 3300025961 | Bacteria | 14094 |
| 378 | Ga0207712_10028018 | 3300025961 | Bacteria | 3766 |
| 379 | Ga0207712_10069569 | 3300025961 | Bacteria | 2526 |
| 380 | Ga0207668_10026778 | 3300025972 | Bacteria | 3749 |
| 381 | Ga0207668_10119724 | 3300025972 | Bacteria | 1991 |
| 382 | Ga0207640_10439098 | 3300025981 | Unclassified | 1073 |
| 383 | Ga0207677_10056352 | 3300026023 | Bacteria | 2692 |
| 384 | Ga0207677_10098097 | 3300026023 | Bacteria | 2149 |
| 385 | Ga0207677_10103401 | 3300026023 | Bacteria | 2103 |
| 386 | Ga0207639_10189311 | 3300026041 | Bacteria | 1756 |
| 387 | Ga0207639_10375577 | 3300026041 | Bacteria | 1275 |
| 388 | Ga0207678_10000662 | 3300026067 | Bacteria | 31648 |
| 389 | Ga0207678_10190476 | 3300026067 | Bacteria | 1752 |
| 390 | Ga0207708_10000064 | 3300026075 | Bacteria | 85366 |
| 391 | Ga0207708_10067211 | 3300026075 | Bacteria | 2742 |
| 392 | Ga0207708_11147233 | 3300026075 | Bacteria | 678 |
| 393 | Ga0207702_10001188 | 3300026078 | Bacteria | 26420 |
| 394 | Ga0207702_10017568 | 3300026078 | Bacteria | 5917 |
| 395 | Ga0207702_10029148 | 3300026078 | Bacteria | 4591 |
| 396 | Ga0207641_10042523 | 3300026088 | Bacteria | 3812 |
| 397 | Ga0207641_11180233 | 3300026088 | Bacteria | 765 |
| 398 | Ga0207648_10000958 | 3300026089 | Bacteria | 32650 |
| 399 | Ga0207676_10011868 | 3300026095 | Bacteria | 6234 |
| 400 | Ga0207676_10607485 | 3300026095 | Bacteria | 1051 |
| 401 | Ga0207674_10000635 | 3300026116 | Bacteria | 45675 |
| 402 | Ga0207674_10519485 | 3300026116 | Bacteria | 1150 |
| 403 | Ga0207675_100001404 | 3300026118 | Bacteria | 24092 |
| 404 | Ga0207675_100052074 | 3300026118 | Bacteria | 3820 |
| 405 | Ga0207675_100108792 | 3300026118 | Bacteria | 2615 |
| 406 | Ga0207683_10000450 | 3300026121 | Bacteria | 38100 |
| 407 | Ga0207683_10002218 | 3300026121 | Bacteria | 17085 |
| 408 | Ga0207683_10102966 | 3300026121 | Bacteria | 2550 |
| 409 | Ga0207698_10025400 | 3300026142 | Bacteria | 4173 |
| 410 | Ga0207698_10040256 | 3300026142 | Bacteria | 3470 |
| 411 | Ga0207698_10392594 | 3300026142 | Bacteria | 1323 |
| 412 | Ga0207428_10002503 | 3300027907 | Bacteria | 18349 |
| 413 | Ga0207428_10008066 | 3300027907 | Bacteria | 9552 |
| 414 | Ga0207428_10060400 | 3300027907 | Bacteria | 3004 |
| 415 | Ga0268266_10058894 | 3300028379 | Bacteria | 3308 |
| 416 | Ga0268266_10172245 | 3300028379 | Bacteria | 1965 |
| 417 | Ga0268264_10465615 | 3300028381 | Bacteria | 1227 |
| 418 | Ga0265318_10009493 | 3300028577 | Bacteria | 4277 |
| 419 | Ga0265338_10084802 | 3300028800 | Bacteria | 2643 |
| 420 | Ga0265330_10032824 | 3300031235 | Bacteria | 2325 |
| 421 | Ga0265339_10124878 | 3300031249 | Bacteria | 1320 |
| 422 | Ga0307408_100448359 | 3300031548 | Bacteria | 1119 |
| 423 | Ga0307405_10022832 | 3300031731 | Bacteria | 3545 |
| 424 | Ga0307413_10090252 | 3300031824 | Bacteria | 1993 |
| 425 | Ga0307413_10215175 | 3300031824 | Unclassified | 1399 |
| 426 | Ga0307410_10474995 | 3300031852 | Bacteria | 1024 |
| 427 | Ga0307406_10088080 | 3300031901 | Bacteria | 2082 |
| 428 | Ga0307406_10120693 | 3300031901 | Bacteria | 1822 |
| 429 | Ga0307407_10051733 | 3300031903 | Bacteria | 2356 |
| 430 | Ga0307412_10117851 | 3300031911 | Bacteria | 1907 |
| 431 | Ga0307409_100007151 | 3300031995 | Bacteria | 6649 |
| 432 | Ga0307409_100400028 | 3300031995 | Bacteria | 1311 |
| 433 | Ga0307416_100014303 | 3300032002 | Bacteria | 5431 |
| 434 | Ga0307416_100134222 | 3300032002 | Bacteria | 2235 |
| 435 | Ga0307416_100152402 | 3300032002 | Bacteria | 2122 |
| 436 | Ga0307414_10511737 | 3300032004 | Bacteria | 1064 |
| 437 | Ga0307411_10063622 | 3300032005 | Bacteria | 2466 |
| 438 | Ga0307411_10959630 | 3300032005 | Unclassified | 763 |
| 439 | Ga0307415_100000170 | 3300032126 | Bacteria | 28895 |
| 440 | Ga0307415_100013125 | 3300032126 | Bacteria | 4823 |
| 441 | Ga0307415_100104075 | 3300032126 | Bacteria | 2090 |
| 442 | Ga0373938_0059829 | 3300034957 | Bacteria | 889 |
| 443 | Ga0373928_0036437 | 3300035084 | Bacteria | 1112 |
| 444 | Ga0373929_0067172 | 3300035085 | Bacteria | 851 |
| 445 | Ga0373934_0238799 | 3300035086 | Bacteria | 750 |
| 446 | Ga0373940_0086842 | 3300035088 | Bacteria | 932 |
| 447 | Ga0373951_0003761 | 3300035091 | Bacteria | 3655 |
| 448 | Ga0373932_0010164 | 3300035112 | Bacteria | 2274 |
| 449 | Ga0373941_0123104 | 3300035115 | Bacteria | 926 |
| 450 | Ga0373960_0010730 | 3300035121 | Bacteria | 2244 |
| 451 | Ga0373955_0078567 | 3300035172 | Bacteria | 1860 |
| 452 | Ga0373942_0036650 | 3300035207 | Bacteria | 1322 |
| 453 | Ga0373961_0020468 | 3300035241 | Bacteria | 1751 |
| 454 | Ga0373924_0110572 | 3300035410 | Bacteria | 1187 |
| 455 | Ga0373931_0012082 | 3300035691 | Bacteria | 4180 |
| 456 | Ga0373947_0021867 | 3300035725 | Bacteria | 3706 |
| 457 | Ga0373947_0027005 | 3300035725 | Bacteria | 3359 |
| 458 | Ga0373937_0005583 | 3300036401 | Bacteria | 10792 |
| 459 | Ga0373937_0146342 | 3300036401 | Bacteria | 2212 |
| 460 | Ga0373937_0238891 | 3300036401 | Bacteria | 1711 |
| 461 | Ga0395899_0020763 | 3300037312 | Bacteria | 4980 |
| 462 | Ga0395899_0034039 | 3300037312 | Bacteria | 3825 |
| 463 | Ga0395899_0076330 | 3300037312 | Bacteria | 2446 |
| 464 | Ga0395899_0093511 | 3300037312 | Bacteria | 2176 |
| 465 | Ga0395899_0149051 | 3300037312 | Bacteria | 1659 |
| 466 | Ga0395899_0156979 | 3300037312 | Bacteria | 1609 |
| 467 | Ga0395899_0173326 | 3300037312 | Bacteria | 1518 |
| 468 | Ga0395899_0182299 | 3300037312 | Bacteria | 1473 |
| 469 | Ga0395899_0200472 | 3300037312 | Bacteria | 1392 |
| 470 | Ga0395899_0202099 | 3300037312 | Bacteria | 1385 |
| 471 | Ga0395900_0001588 | 3300037418 | Bacteria | 26879 |
| 472 | Ga0395900_0024584 | 3300037418 | Bacteria | 6168 |
| 473 | Ga0395900_0040000 | 3300037418 | Bacteria | 4832 |
| 474 | Ga0395900_0053577 | 3300037418 | Bacteria | 4152 |
| 475 | Ga0395900_0076324 | 3300037418 | Bacteria | 3444 |
| 476 | Ga0395900_0093085 | 3300037418 | Bacteria | 3096 |
| 477 | Ga0395900_0105035 | 3300037418 | Bacteria | 2902 |
| 478 | Ga0395900_0130263 | 3300037418 | Bacteria | 2578 |
| 479 | Ga0395900_0154442 | 3300037418 | Bacteria | 2344 |
| 480 | Ga0395900_0378781 | 3300037418 | Bacteria | 1383 |
| 481 | Ga0395900_0978391 | 3300037418 | Bacteria | 767 |
| 482 | Ga0395898_0001845 | 3300037466 | Bacteria | 27238 |
| 483 | Ga0395898_0046606 | 3300037466 | Bacteria | 4258 |
| 484 | Ga0395898_0049301 | 3300037466 | Bacteria | 4126 |
| 485 | Ga0395898_0105884 | 3300037466 | Bacteria | 2697 |
| 486 | Ga0395898_0118250 | 3300037466 | Bacteria | 2539 |
| 487 | Ga0395898_0175463 | 3300037466 | Bacteria | 2048 |
| 488 | Ga0395898_0191259 | 3300037466 | Bacteria | 1955 |
| 489 | Ga0395898_0196032 | 3300037466 | Bacteria | 1929 |
| 490 | Ga0395898_0401017 | 3300037466 | Bacteria | 1308 |
| 491 | Ga0395898_0537557 | 3300037466 | Bacteria | 1110 |
| 492 | Ga0395898_0540746 | 3300037466 | Bacteria | 1107 |
| 493 | Ga0395905_0001761 | 3300037471 | Bacteria | 25226 |
| 494 | Ga0395905_0003142 | 3300037471 | Bacteria | 17794 |
| 495 | Ga0395905_0004600 | 3300037471 | Bacteria | 14275 |
| 496 | Ga0395905_0017743 | 3300037471 | Bacteria | 6758 |
| 497 | Ga0395905_0074199 | 3300037471 | Bacteria | 3188 |
| 498 | Ga0395905_0139218 | 3300037471 | Bacteria | 2283 |
| 499 | Ga0395905_0170827 | 3300037471 | Bacteria | 2042 |
| 500 | Ga0395905_0203318 | 3300037471 | Bacteria | 1857 |
| 501 | Ga0395905_0283583 | 3300037471 | Bacteria | 1543 |
| 502 | Ga0395905_0389631 | 3300037471 | Bacteria | 1288 |
| 503 | Ga0436364_0330965 | 3300037853 | Bacteria | 247749 |
| 504 | Ga0395901_0000944 | 3300038443 | Bacteria | 31637 |
| 505 | Ga0395901_0001597 | 3300038443 | Bacteria | 23455 |
| 506 | Ga0395901_0001828 | 3300038443 | Bacteria | 21979 |
| 507 | Ga0395901_0002386 | 3300038443 | Bacteria | 19104 |
| 508 | Ga0395901_0007239 | 3300038443 | Bacteria | 11192 |
| 509 | Ga0395901_0010987 | 3300038443 | Bacteria | 9175 |
| 510 | Ga0395901_0020676 | 3300038443 | Bacteria | 6737 |
| 511 | Ga0395901_0026394 | 3300038443 | Bacteria | 5963 |
| 512 | Ga0395901_0150318 | 3300038443 | Bacteria | 2447 |
| 513 | Ga0395901_0170858 | 3300038443 | Bacteria | 2281 |
| 514 | Ga0395901_0184487 | 3300038443 | Bacteria | 2188 |
| 515 | Ga0395901_0194422 | 3300038443 | Bacteria | 2127 |
| 516 | Ga0395901_0205304 | 3300038443 | Bacteria | 2064 |
| 517 | Ga0395901_0686070 | 3300038443 | Bacteria | 1023 |
| 518 | Ga0436365_1817076 | 3300039437 | Bacteria | 2629 |
| 519 | Ga0436362_0152248 | 3300039453 | Bacteria | 1171 |
| 520 | Ga0451800_0109780 | 3300041459 | Bacteria | 1186 |
| 521 | Ga0451853_2979489 | 3300041512 | Bacteria | 796 |
| 522 | Ga0439448_0002961 | 3300042005 | Bacteria | 4659 |
| 523 | Ga0439448_0014467 | 3300042005 | Bacteria | 2380 |
| 524 | Ga0439455_0036609 | 3300042012 | Bacteria | 1242 |
| 525 | Ga0439463_034037 | 3300042016 | Bacteria | 1289 |
| 526 | Ga0450905_013829 | 3300042142 | Bacteria | 1146 |
| 527 | Ga0439459_0000765 | 3300042438 | Bacteria | 4420 |
| 528 | Ga0439459_0009350 | 3300042438 | Bacteria | 1694 |
| 529 | Ga0439464_0002766 | 3300042439 | Bacteria | 4353 |
| 530 | Ga0450916_013031 | 3300042530 | Bacteria | 1068 |
| 531 | Ga0466963_0114373 | 3300044694 | Bacteria | 1854 |
| 532 | Ga0495592_0030952 | 3300046454 | Bacteria | 4047 |
| 533 | Ga0495592_0059128 | 3300046454 | Bacteria | 2824 |
| 534 | Ga0495603_0004890 | 3300046455 | Bacteria | 8013 |
| 535 | Ga0495641_0200192 | 3300046461 | Bacteria | 895 |
| 536 | Ga0495651_0003810 | 3300046462 | Bacteria | 11535 |
| 537 | Ga0495653_0151295 | 3300046463 | Bacteria | 1621 |
| 538 | Ga0495653_0155180 | 3300046463 | Bacteria | 1595 |
| 539 | Ga0495580_0154744 | 3300046472 | Bacteria | 1588 |
| 540 | Ga0495582_0056238 | 3300046473 | Unclassified | 2168 |
| 541 | Ga0495582_0275920 | 3300046473 | Bacteria | 965 |
| 542 | Ga0495639_0133001 | 3300046475 | Bacteria | 1192 |
| 543 | Ga0495662_0056754 | 3300046476 | Bacteria | 1891 |
| 544 | Ga0495584_0053086 | 3300046491 | Bacteria | 2040 |
| 545 | Ga0495585_0175912 | 3300046492 | Unclassified | 1103 |
| 546 | Ga0495596_0081266 | 3300046500 | Bacteria | 1258 |
| 547 | Ga0495596_0090933 | 3300046500 | Bacteria | 1185 |
| 548 | Ga0495607_0234524 | 3300046501 | Bacteria | 891 |
| 549 | Ga0495608_0351777 | 3300046511 | Bacteria | 907 |
| 550 | Ga0495608_0413445 | 3300046511 | Bacteria | 824 |
| 551 | Ga0495628_0412550 | 3300046516 | Bacteria | 985 |
| 552 | Ga0495630_0003481 | 3300046517 | Bacteria | 10940 |
| 553 | Ga0495644_0013612 | 3300046523 | Bacteria | 3120 |
| 554 | Ga0495663_0018550 | 3300046525 | Bacteria | 1982 |
| 555 | Ga0495666_0138915 | 3300046526 | Bacteria | 1133 |
| 556 | Ga0495642_0086189 | 3300046528 | Bacteria | 1326 |
| 557 | Ga0495642_0088507 | 3300046528 | Bacteria | 1309 |
| 558 | Ga0495652_0004743 | 3300046529 | Bacteria | 12943 |
| 559 | Ga0495652_0070688 | 3300046529 | Bacteria | 2916 |
| 560 | Ga0495652_0331336 | 3300046529 | Bacteria | 1097 |
| 561 | Ga0495640_0004494 | 3300046533 | Bacteria | 11122 |
| 562 | Ga0495587_0210582 | 3300046536 | Bacteria | 1098 |
| 563 | Ga0495598_0135787 | 3300046537 | Bacteria | 847 |
| 564 | Ga0495645_0149136 | 3300046543 | Bacteria | 1626 |
| 565 | Ga0495645_0462889 | 3300046543 | Bacteria | 798 |
| 566 | Ga0495667_0029407 | 3300046559 | Bacteria | 3699 |
| 567 | Ga0495667_0363708 | 3300046559 | Bacteria | 913 |
| 568 | Ga0495656_0172728 | 3300046615 | Bacteria | 1058 |
| 569 | Ga0495668_0052050 | 3300046616 | Bacteria | 2267 |
| 570 | Ga0495611_0204309 | 3300046648 | Bacteria | 921 |
| 571 | Ga0495659_0070461 | 3300046664 | Unclassified | 1309 |
| 572 | Ga0495657_0153751 | 3300046675 | Bacteria | 1427 |
| 573 | Ga0495599_0087043 | 3300046678 | Bacteria | 1951 |
| 574 | Ga0495647_0025564 | 3300046681 | Bacteria | 2158 |
| 575 | Ga0495613_0183097 | 3300046689 | Bacteria | 1483 |
| 576 | Ga0495589_0184908 | 3300046794 | Bacteria | 987 |
| 577 | Ga0495600_0228145 | 3300046809 | Bacteria | 1190 |
| 578 | Ga0495581_0000916 | 3300047315 | Bacteria | 15822 |
| 579 | Ga0495581_0074233 | 3300047315 | Bacteria | 1968 |
| 580 | Ga0495674_0004625 | 3300047319 | Bacteria | 13231 |
| 581 | Ga0495676_0005289 | 3300047321 | Bacteria | 11817 |
| 582 | Ga0495680_0004191 | 3300047322 | Bacteria | 13847 |
| 583 | Ga0495684_0025968 | 3300047471 | Bacteria | 4502 |
| 584 | Ga0496100_0025178 | 3300048903 | Bacteria | 3637 |
| 585 | Ga0496100_0032251 | 3300048903 | Bacteria | 3264 |
| 586 | Ga0496100_0056169 | 3300048903 | Bacteria | 2575 |
| 587 | Ga0496100_0289890 | 3300048903 | Bacteria | 1223 |
| 588 | Ga0496100_0795837 | 3300048903 | Bacteria | 741 |
| 589 | Ga0496101_0017284 | 3300048904 | Bacteria | 4891 |
| 590 | Ga0496101_0019616 | 3300048904 | Bacteria | 4618 |
| 591 | Ga0496101_0328773 | 3300048904 | Bacteria | 1200 |
| 592 | Ga0496101_0542711 | 3300048904 | Bacteria | 919 |
| 593 | Ga0496102_0002877 | 3300048905 | Bacteria | 14610 |
| 594 | Ga0496102_0008114 | 3300048905 | Bacteria | 8985 |
| 595 | Ga0496102_0035194 | 3300048905 | Bacteria | 4506 |
| 596 | Ga0496102_0175758 | 3300048905 | Bacteria | 2016 |
| 597 | Ga0496102_0725283 | 3300048905 | Bacteria | 917 |
| 598 | Ga0496102_0772702 | 3300048905 | Bacteria | 883 |
| 599 | Ga0496103_0001171 | 3300048906 | Bacteria | 18044 |
| 600 | Ga0496103_0031484 | 3300048906 | Bacteria | 3232 |
| 601 | Ga0496104_0001170 | 3300048907 | Bacteria | 22501 |
| 602 | Ga0496104_0018488 | 3300048907 | Bacteria | 6358 |
| 603 | Ga0496104_0022974 | 3300048907 | Bacteria | 5731 |
| 604 | Ga0496104_0061095 | 3300048907 | Bacteria | 3571 |
| 605 | Ga0496104_0309997 | 3300048907 | Bacteria | 1491 |
| 606 | Ga0496104_0525379 | 3300048907 | Bacteria | 1094 |
| 607 | Ga0496105_0006599 | 3300048908 | Bacteria | 8934 |
| 608 | Ga0496105_0076637 | 3300048908 | Bacteria | 2761 |
| 609 | Ga0496106_0003883 | 3300048909 | Bacteria | 11150 |
| 610 | Ga0496106_0008317 | 3300048909 | Bacteria | 7678 |
| 611 | Ga0496106_0075471 | 3300048909 | Bacteria | 2582 |
| 612 | Ga0496106_0301556 | 3300048909 | Bacteria | 1285 |
| 613 | Ga0496107_0002222 | 3300048910 | Bacteria | 12485 |
| 614 | Ga0496107_0022541 | 3300048910 | Bacteria | 4450 |
| 615 | Ga0496107_0056926 | 3300048910 | Bacteria | 2826 |
| 616 | Ga0496107_0634418 | 3300048910 | Bacteria | 788 |
| 617 | Ga0496108_0002125 | 3300048911 | Bacteria | 15875 |
| 618 | Ga0496108_0003219 | 3300048911 | Bacteria | 13130 |
| 619 | Ga0496108_0006937 | 3300048911 | Bacteria | 9169 |
| 620 | Ga0496108_0014703 | 3300048911 | Bacteria | 6388 |
| 621 | Ga0496108_0029825 | 3300048911 | Bacteria | 4520 |
| 622 | Ga0496108_0360393 | 3300048911 | Unclassified | 1269 |
| 623 | Ga0496109_0001268 | 3300048912 | Bacteria | 20981 |
| 624 | Ga0496109_0001362 | 3300048912 | Bacteria | 20254 |
| 625 | Ga0496109_0090273 | 3300048912 | Bacteria | 2833 |
| 626 | Ga0496110_0002646 | 3300048913 | Bacteria | 13499 |
| 627 | Ga0496110_0022246 | 3300048913 | Bacteria | 5380 |
| 628 | Ga0496110_0022752 | 3300048913 | Bacteria | 5326 |
| 629 | Ga0496110_0023256 | 3300048913 | Bacteria | 5269 |
| 630 | Ga0496110_0050221 | 3300048913 | Bacteria | 3662 |
| 631 | Ga0496110_0067361 | 3300048913 | Bacteria | 3168 |
| 632 | Ga0496110_0092570 | 3300048913 | Bacteria | 2705 |
| 633 | Ga0496110_0709967 | 3300048913 | Bacteria | 907 |
| 634 | Ga0496111_0001346 | 3300048914 | Bacteria | 13880 |
| 635 | Ga0496111_0003756 | 3300048914 | Bacteria | 9453 |
| 636 | Ga0496111_0016048 | 3300048914 | Bacteria | 5154 |
| 637 | Ga0496111_0035010 | 3300048914 | Bacteria | 3587 |
| 638 | Ga0496112_0000677 | 3300048915 | Bacteria | 23790 |
| 639 | Ga0496112_0003338 | 3300048915 | Bacteria | 13246 |
| 640 | Ga0496112_0043873 | 3300048915 | Bacteria | 4378 |
| 641 | Ga0496112_0097269 | 3300048915 | Bacteria | 2914 |
| 642 | Ga0496112_0338194 | 3300048915 | Bacteria | 1449 |
| 643 | Ga0496112_0451589 | 3300048915 | Bacteria | 1223 |
| 644 | Ga0496113_0000374 | 3300048916 | Bacteria | 21591 |
| 645 | Ga0496113_0044877 | 3300048916 | Bacteria | 3275 |
| 646 | Ga0496113_0339056 | 3300048916 | Bacteria | 1205 |
| 647 | Ga0496113_0850830 | 3300048916 | Bacteria | 723 |
| 648 | Ga0496114_0007583 | 3300048917 | Bacteria | 8580 |
| 649 | Ga0496114_0027132 | 3300048917 | Bacteria | 4690 |
| 650 | Ga0496114_0219079 | 3300048917 | Bacteria | 1670 |
| 651 | Ga0496114_0355510 | 3300048917 | Bacteria | 1296 |
| 652 | Ga0496114_0480196 | 3300048917 | Bacteria | 1100 |
| 653 | Ga0496114_0614747 | 3300048917 | Bacteria | 958 |
| 654 | Ga0496115_0003228 | 3300048918 | Bacteria | 11702 |
| 655 | Ga0496115_0053859 | 3300048918 | Bacteria | 3230 |
| 656 | Ga0496115_0070465 | 3300048918 | Bacteria | 2834 |
| 657 | Ga0496115_0199172 | 3300048918 | Bacteria | 1654 |
| 658 | Ga0501033_0531236 | 3300049570 | Bacteria | 812 |
| 659 | Ga0501038_0181048 | 3300049574 | Bacteria | 1700 |
| 660 | Ga0501040_0218672 | 3300049576 | Bacteria | 1355 |
| 661 | Ga0501041_0047479 | 3300049577 | Bacteria | 2614 |
| 662 | Ga0501067_0008277 | 3300049583 | Bacteria | 5775 |
| 663 | Ga0501069_0013951 | 3300049585 | Bacteria | 4291 |
| 664 | Ga0501070_0086193 | 3300049586 | Bacteria | 2600 |
| 665 | Ga0501071_0375810 | 3300049587 | Bacteria | 1083 |
| 666 | Ga0501076_0047063 | 3300049592 | Bacteria | 3409 |
| 667 | Ga0501077_0211244 | 3300049593 | Bacteria | 1233 |
| 668 | Ga0501077_0367920 | 3300049593 | Bacteria | 918 |
| 669 | Ga0501079_0355104 | 3300049741 | Bacteria | 1149 |
| 670 | Ga0501080_0200308 | 3300049742 | Bacteria | 1833 |
| 671 | Ga0501035_0168065 | 3300049822 | Bacteria | 1896 |
| 672 | Ga0501045_0274963 | 3300049824 | Bacteria | 1254 |
| 673 | nmdc:mga05p37_199377_c1 | 3300050507 | Bacteria | 2425 |
| 674 | nmdc:mga05p37_237163_c1 | 3300050507 | Bacteria | 2195 |
| 675 | nmdc:mga05p37_244585_c1 | 3300050507 | Bacteria | 2155 |
| 676 | nmdc:mga05p37_35575_c1 | 3300050507 | Bacteria | 6107 |
| 677 | nmdc:mga05p37_68914_c1 | 3300050507 | Bacteria | 4350 |
| 678 | nmdc:mga05p37_75325_c1 | 3300050507 | Bacteria | 4154 |
| 679 | nmdc:mga06r32_5438_c1 | 3300050510 | Bacteria | 11467 |
| 680 | nmdc:mga06r32_584315_c1 | 3300050510 | Bacteria | 1089 |
| 681 | nmdc:mga06r32_874901_c1 | 3300050510 | Bacteria | 856 |
| 682 | nmdc:mga08y16_43806_c1 | 3300050511 | Bacteria | 4690 |
| 683 | nmdc:mga08y16_44640_c1 | 3300050511 | Bacteria | 4644 |
| 684 | nmdc:mga08y16_66007_c1 | 3300050511 | Bacteria | 3777 |
| 685 | nmdc:mga0n895_290407_c1 | 3300050512 | Bacteria | 1658 |
| 686 | nmdc:mga0n895_349906_c1 | 3300050512 | Bacteria | 1497 |
| 687 | nmdc:mga0n895_40782_c1 | 3300050512 | Bacteria | 4511 |
| 688 | nmdc:mga0n895_4819_c1 | 3300050512 | Bacteria | 11169 |
| 689 | nmdc:mga0n895_59897_c1 | 3300050512 | Bacteria | 3757 |
| 690 | nmdc:mga0n895_671294_c1 | 3300050512 | Bacteria | 1034 |
| 691 | nmdc:mga0n895_85291_c1 | 3300050512 | Bacteria | 3153 |
| 692 | nmdc:mga0rr50_20862_c1 | 3300050513 | Bacteria | 4461 |
| 693 | nmdc:mga0rr50_23401_c1 | 3300050513 | Bacteria | 4260 |
| 694 | nmdc:mga0rr50_257295_c1 | 3300050513 | Bacteria | 1452 |
| 695 | nmdc:mga0rr50_468122_c1 | 3300050513 | Bacteria | 1070 |
| 696 | nmdc:mga0rr50_80442_c1 | 3300050513 | Bacteria | 2512 |
| 697 | nmdc:mga08x19_31888_c1 | 3300050514 | Bacteria | 3319 |
| 698 | nmdc:mga08x19_332557_c1 | 3300050514 | Bacteria | 1059 |
| 699 | nmdc:mga08x19_5782_c1 | 3300050514 | Bacteria | 7309 |
| 700 | nmdc:mga0a205_14964_c1 | 3300050515 | Bacteria | 7240 |
| 701 | nmdc:mga0a205_19434_c1 | 3300050515 | Bacteria | 6404 |
| 702 | nmdc:mga0a205_267466_c1 | 3300050515 | Bacteria | 1587 |
| 703 | nmdc:mga0a205_302354_c1 | 3300050515 | Bacteria | 1473 |
| 704 | nmdc:mga0a205_90836_c1 | 3300050515 | Bacteria | 2951 |
| 705 | Ga0501084_0023000 | 3300054114 | Bacteria | 5203 |
| 706 | Ga0501082_0060417 | 3300060353 | Bacteria | 3264 |
| 707 | Ga0530510_0059294 | 3300061734 | Bacteria | 2768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10890752 | Ga0207646_108907522 | 164 |
| 2 | 3300028577 | Ga0265318_10009493 | Ga0265318_100094935 | 164 |
| 3 | 3300028800 | Ga0265338_10084802 | Ga0265338_100848022 | 164 |
| 4 | 3300031235 | Ga0265330_10032824 | Ga0265330_100328242 | 164 |
| 5 | 3300048905 | Ga0496102_0725283 | Ga0496102_0725283_289_903 | 164 |
| 6 | 3300005546 | Ga0070696_100166306 | Ga0070696_1001663062 | 166 |
| 7 | 3300049574 | Ga0501038_0181048 | Ga0501038_0181048_414_1046 | 171 |
| 8 | 3300049576 | Ga0501040_0218672 | Ga0501040_0218672_538_1170 | 171 |
| 9 | 3300049577 | Ga0501041_0047479 | Ga0501041_0047479_830_1462 | 171 |
| 10 | 3300049587 | Ga0501071_0375810 | Ga0501071_0375810_46_678 | 171 |
| 11 | 3300049592 | Ga0501076_0047063 | Ga0501076_0047063_2204_2836 | 171 |
| 12 | 3300049593 | Ga0501077_0211244 | Ga0501077_0211244_472_1104 | 171 |
| 13 | 3300049741 | Ga0501079_0355104 | Ga0501079_0355104_462_1094 | 171 |
| 14 | 3300049822 | Ga0501035_0168065 | Ga0501035_0168065_1157_1789 | 171 |
| 15 | 3300049824 | Ga0501045_0274963 | Ga0501045_0274963_295_927 | 171 |
| 16 | 3300054114 | Ga0501084_0023000 | Ga0501084_0023000_4080_4712 | 171 |
| 17 | 3300060353 | Ga0501082_0060417 | Ga0501082_0060417_953_1585 | 171 |
| 18 | 3300048913 | Ga0496110_0067361 | Ga0496110_0067361_1180_1827 | 174 |
| 19 | 3300014497 | Ga0182008_10073794 | Ga0182008_100737942 | 182 |
| 20 | 3300005364 | Ga0070673_100908437 | Ga0070673_1009084371 | 183 |
| 21 | 3300005434 | Ga0070709_10050272 | Ga0070709_100502723 | 183 |
| 22 | 3300005436 | Ga0070713_100895068 | Ga0070713_1008950681 | 183 |
| 23 | 3300005437 | Ga0070710_10344629 | Ga0070710_103446292 | 183 |
| 24 | 3300005440 | Ga0070705_100105433 | Ga0070705_1001054333 | 183 |
| 25 | 3300005441 | Ga0070700_100301661 | Ga0070700_1003016611 | 183 |
| 26 | 3300005444 | Ga0070694_100211481 | Ga0070694_1002114811 | 183 |
| 27 | 3300005445 | Ga0070708_100278337 | Ga0070708_1002783372 | 183 |
| 28 | 3300005456 | Ga0070678_100140394 | Ga0070678_1001403942 | 183 |
| 29 | 3300005468 | Ga0070707_100622588 | Ga0070707_1006225883 | 183 |
| 30 | 3300005518 | Ga0070699_100233946 | Ga0070699_1002339463 | 183 |
| 31 | 3300005536 | Ga0070697_100375430 | Ga0070697_1003754302 | 183 |
| 32 | 3300005545 | Ga0070695_100011574 | Ga0070695_1000115744 | 183 |
| 33 | 3300005546 | Ga0070696_100002148 | Ga0070696_1000021483 | 183 |
| 34 | 3300005547 | Ga0070693_100249090 | Ga0070693_1002490901 | 183 |
| 35 | 3300005549 | Ga0070704_100103505 | Ga0070704_1001035053 | 183 |
| 36 | 3300006175 | Ga0070712_100005736 | Ga0070712_1000057364 | 183 |
| 37 | 3300009147 | Ga0114129_10345416 | Ga0114129_103454162 | 183 |
| 38 | 3300009148 | Ga0105243_10208169 | Ga0105243_102081691 | 183 |
| 39 | 3300009174 | Ga0105241_10068929 | Ga0105241_100689292 | 183 |
| 40 | 3300009176 | Ga0105242_10324106 | Ga0105242_103241063 | 183 |
| 41 | 3300010375 | Ga0105239_10268144 | Ga0105239_102681441 | 183 |
| 42 | 3300013297 | Ga0157378_10636324 | Ga0157378_106363241 | 183 |
| 43 | 3300013308 | Ga0157375_11120480 | Ga0157375_111204802 | 183 |
| 44 | 3300025885 | Ga0207653_10014749 | Ga0207653_100147491 | 183 |
| 45 | 3300025915 | Ga0207693_10004357 | Ga0207693_1000435712 | 183 |
| 46 | 3300025916 | Ga0207663_10062908 | Ga0207663_100629081 | 183 |
| 47 | 3300025917 | Ga0207660_10807580 | Ga0207660_108075801 | 183 |
| 48 | 3300025935 | Ga0207709_10454498 | Ga0207709_104544981 | 183 |
| 49 | 3300025939 | Ga0207665_10025500 | Ga0207665_100255003 | 183 |
| 50 | 3300026075 | Ga0207708_11147233 | Ga0207708_111472331 | 183 |
| 51 | 3300026121 | Ga0207683_10102966 | Ga0207683_101029663 | 183 |
| 52 | 3300034957 | Ga0373938_0059829 | Ga0373938_0059829_76_705 | 183 |
| 53 | 3300035084 | Ga0373928_0036437 | Ga0373928_0036437_426_1055 | 183 |
| 54 | 3300035085 | Ga0373929_0067172 | Ga0373929_0067172_92_721 | 183 |
| 55 | 3300035088 | Ga0373940_0086842 | Ga0373940_0086842_174_803 | 183 |
| 56 | 3300035091 | Ga0373951_0003761 | Ga0373951_0003761_1448_2077 | 183 |
| 57 | 3300035112 | Ga0373932_0010164 | Ga0373932_0010164_1499_2128 | 183 |
| 58 | 3300035115 | Ga0373941_0123104 | Ga0373941_0123104_283_912 | 183 |
| 59 | 3300035207 | Ga0373942_0036650 | Ga0373942_0036650_680_1309 | 183 |
| 60 | 3300035691 | Ga0373931_0012082 | Ga0373931_0012082_965_1594 | 183 |
| 61 | 3300048903 | Ga0496100_0032251 | Ga0496100_0032251_960_1589 | 183 |
| 62 | 3300048905 | Ga0496102_0002877 | Ga0496102_0002877_12913_13542 | 183 |
| 63 | 3300048907 | Ga0496104_0018488 | Ga0496104_0018488_4625_5254 | 183 |
| 64 | 3300048908 | Ga0496105_0076637 | Ga0496105_0076637_861_1490 | 183 |
| 65 | 3300048910 | Ga0496107_0002222 | Ga0496107_0002222_572_1201 | 183 |
| 66 | 3300048911 | Ga0496108_0003219 | Ga0496108_0003219_1190_1819 | 183 |
| 67 | 3300048913 | Ga0496110_0022246 | Ga0496110_0022246_4641_5270 | 183 |
| 68 | 3300048914 | Ga0496111_0035010 | Ga0496111_0035010_1539_2168 | 183 |
| 69 | 3300048915 | Ga0496112_0003338 | Ga0496112_0003338_262_891 | 183 |
| 70 | 3300048916 | Ga0496113_0339056 | Ga0496113_0339056_293_922 | 183 |
| 71 | 3300048917 | Ga0496114_0219079 | Ga0496114_0219079_795_1424 | 183 |
| 72 | 3300048918 | Ga0496115_0199172 | Ga0496115_0199172_510_1139 | 183 |
| 73 | 3300050512 | nmdc:mga0n895_349906_c1 | nmdc:mga0n895_349906_c1_549_1178 | 183 |
| 74 | 3300050513 | nmdc:mga0rr50_257295_c1 | nmdc:mga0rr50_257295_c1_301_930 | 183 |
| 75 | 3300050514 | nmdc:mga08x19_332557_c1 | nmdc:mga08x19_332557_c1_330_959 | 183 |
| 76 | 3300050515 | nmdc:mga0a205_302354_c1 | nmdc:mga0a205_302354_c1_248_877 | 183 |
| 77 | 3300006852 | Ga0075433_10042872 | Ga0075433_100428725 | 184 |
| 78 | 3300006871 | Ga0075434_100449101 | Ga0075434_1004491012 | 184 |
| 79 | 3300006914 | Ga0075436_100098847 | Ga0075436_1000988472 | 184 |
| 80 | 3300025939 | Ga0207665_10039123 | Ga0207665_100391234 | 184 |
| 81 | 3300037471 | Ga0395905_0389631 | Ga0395905_0389631_245_865 | 184 |
| 82 | 3300038443 | Ga0395901_0170858 | Ga0395901_0170858_759_1379 | 184 |
| 83 | 3300039453 | Ga0436362_0152248 | Ga0436362_0152248_241_867 | 184 |
| 84 | 3300046501 | Ga0495607_0234524 | Ga0495607_0234524_228_878 | 184 |
| 85 | 3300046523 | Ga0495644_0013612 | Ga0495644_0013612_1912_2562 | 184 |
| 86 | 3300050507 | nmdc:mga05p37_68914_c1 | nmdc:mga05p37_68914_c1_2590_3219 | 184 |
| 87 | 3300031903 | Ga0307407_10051733 | Ga0307407_100517332 | 185 |
| 88 | 3300037418 | Ga0395900_0040000 | Ga0395900_0040000_1355_2005 | 185 |
| 89 | 3300037418 | Ga0395900_0978391 | Ga0395900_0978391_26_709 | 185 |
| 90 | 3300038443 | Ga0395901_0010987 | Ga0395901_0010987_5234_5884 | 185 |
| 91 | 3300005518 | Ga0070699_100012018 | Ga0070699_1000120184 | 187 |
| 92 | 3300005937 | Ga0081455_10001937 | Ga0081455_100019374 | 187 |
| 93 | 3300006058 | Ga0075432_10019965 | Ga0075432_100199652 | 187 |
| 94 | 3300006844 | Ga0075428_100047490 | Ga0075428_1000474906 | 187 |
| 95 | 3300006852 | Ga0075433_10144164 | Ga0075433_101441644 | 187 |
| 96 | 3300006871 | Ga0075434_100416616 | Ga0075434_1004166163 | 187 |
| 97 | 3300006914 | Ga0075436_100067131 | Ga0075436_1000671315 | 187 |
| 98 | 3300007076 | Ga0075435_100178253 | Ga0075435_1001782534 | 187 |
| 99 | 3300009094 | Ga0111539_10000950 | Ga0111539_100009502 | 187 |
| 100 | 3300009147 | Ga0114129_10041874 | Ga0114129_100418746 | 187 |
| 101 | 3300036401 | Ga0373937_0238891 | Ga0373937_0238891_357_1010 | 187 |
| 102 | 3300046454 | Ga0495592_0059128 | Ga0495592_0059128_628_1251 | 187 |
| 103 | 3300046516 | Ga0495628_0412550 | Ga0495628_0412550_261_914 | 187 |
| 104 | 3300046529 | Ga0495652_0004743 | Ga0495652_0004743_3018_3641 | 187 |
| 105 | 3300046543 | Ga0495645_0149136 | Ga0495645_0149136_341_964 | 187 |
| 106 | 3300050507 | nmdc:mga05p37_75325_c1 | nmdc:mga05p37_75325_c1_146_799 | 187 |
| 107 | 3300050512 | nmdc:mga0n895_59897_c1 | nmdc:mga0n895_59897_c1_19_672 | 187 |
| 108 | 3300050513 | nmdc:mga0rr50_23401_c1 | nmdc:mga0rr50_23401_c1_424_1077 | 187 |
| 109 | 3300050514 | nmdc:mga08x19_31888_c1 | nmdc:mga08x19_31888_c1_859_1512 | 187 |
| 110 | 3300050515 | nmdc:mga0a205_90836_c1 | nmdc:mga0a205_90836_c1_2153_2806 | 187 |
| 111 | 3300006847 | Ga0075431_100198408 | Ga0075431_1001984083 | 188 |
| 112 | 3300009094 | Ga0111539_10067800 | Ga0111539_100678005 | 188 |
| 113 | 3300009176 | Ga0105242_10707678 | Ga0105242_107076782 | 188 |
| 114 | 3300027907 | Ga0207428_10060400 | Ga0207428_100604005 | 188 |
| 115 | 3300035086 | Ga0373934_0238799 | Ga0373934_0238799_108_731 | 188 |
| 116 | 3300048903 | Ga0496100_0289890 | Ga0496100_0289890_397_1047 | 188 |
| 117 | 3300050511 | nmdc:mga08y16_44640_c1 | nmdc:mga08y16_44640_c1_2286_2921 | 188 |
| 118 | 3300036401 | Ga0373937_0146342 | Ga0373937_0146342_809_1465 | 189 |
| 119 | 3300046463 | Ga0495653_0155180 | Ga0495653_0155180_293_949 | 189 |
| 120 | 3300046511 | Ga0495608_0413445 | Ga0495608_0413445_21_677 | 189 |
| 121 | 3300046525 | Ga0495663_0018550 | Ga0495663_0018550_635_1285 | 189 |
| 122 | 3300046528 | Ga0495642_0086189 | Ga0495642_0086189_271_921 | 189 |
| 123 | 3300046536 | Ga0495587_0210582 | Ga0495587_0210582_238_894 | 189 |
| 124 | 3300046559 | Ga0495667_0363708 | Ga0495667_0363708_196_852 | 189 |
| 125 | 3300046675 | Ga0495657_0153751 | Ga0495657_0153751_451_1107 | 189 |
| 126 | 3300049742 | Ga0501080_0200308 | Ga0501080_0200308_553_1197 | 189 |
| 127 | 3300005328 | Ga0070676_10515296 | Ga0070676_105152961 | 190 |
| 128 | 3300005981 | Ga0081538_10036742 | Ga0081538_100367423 | 190 |
| 129 | 3300006844 | Ga0075428_100080857 | Ga0075428_1000808572 | 190 |
| 130 | 3300006846 | Ga0075430_100391474 | Ga0075430_1003914742 | 190 |
| 131 | 3300025906 | Ga0207699_10151533 | Ga0207699_101515333 | 190 |
| 132 | 3300025906 | Ga0207699_10622902 | Ga0207699_106229021 | 190 |
| 133 | 3300031249 | Ga0265339_10124878 | Ga0265339_101248782 | 190 |
| 134 | 3300031731 | Ga0307405_10022832 | Ga0307405_100228326 | 190 |
| 135 | 3300031824 | Ga0307413_10215175 | Ga0307413_102151752 | 190 |
| 136 | 3300031901 | Ga0307406_10120693 | Ga0307406_101206932 | 190 |
| 137 | 3300031911 | Ga0307412_10117851 | Ga0307412_101178513 | 190 |
| 138 | 3300031995 | Ga0307409_100007151 | Ga0307409_1000071517 | 190 |
| 139 | 3300032002 | Ga0307416_100014303 | Ga0307416_1000143036 | 190 |
| 140 | 3300032005 | Ga0307411_10959630 | Ga0307411_109596301 | 190 |
| 141 | 3300032126 | Ga0307415_100000170 | Ga0307415_10000017025 | 190 |
| 142 | 3300046455 | Ga0495603_0004890 | Ga0495603_0004890_882_1550 | 190 |
| 143 | 3300048910 | Ga0496107_0634418 | Ga0496107_0634418_87_716 | 190 |
| 144 | 3300003203 | JGI25406J46586_10002793 | JGI25406J46586_1000279310 | 191 |
| 145 | 3300005535 | Ga0070684_101057851 | Ga0070684_1010578511 | 191 |
| 146 | 3300005546 | Ga0070696_100464609 | Ga0070696_1004646091 | 191 |
| 147 | 3300005937 | Ga0081455_10534450 | Ga0081455_105344501 | 191 |
| 148 | 3300005981 | Ga0081538_10006131 | Ga0081538_1000613110 | 191 |
| 149 | 3300005985 | Ga0081539_10000409 | Ga0081539_1000040981 | 191 |
| 150 | 3300006844 | Ga0075428_101182236 | Ga0075428_1011822361 | 191 |
| 151 | 3300006852 | Ga0075433_10459580 | Ga0075433_104595802 | 191 |
| 152 | 3300007076 | Ga0075435_100520787 | Ga0075435_1005207872 | 191 |
| 153 | 3300037418 | Ga0395900_0024584 | Ga0395900_0024584_2448_3101 | 191 |
| 154 | 3300037466 | Ga0395898_0001845 | Ga0395898_0001845_2990_3643 | 191 |
| 155 | 3300037471 | Ga0395905_0017743 | Ga0395905_0017743_3121_3774 | 191 |
| 156 | 3300038443 | Ga0395901_0000944 | Ga0395901_0000944_8766_9419 | 191 |
| 157 | 3300046454 | Ga0495592_0030952 | Ga0495592_0030952_766_1416 | 191 |
| 158 | 3300048918 | Ga0496115_0070465 | Ga0496115_0070465_679_1329 | 191 |
| 159 | 3300050507 | nmdc:mga05p37_199377_c1 | nmdc:mga05p37_199377_c1_141_770 | 191 |
| 160 | 3300050515 | nmdc:mga0a205_267466_c1 | nmdc:mga0a205_267466_c1_104_733 | 191 |
| 161 | 3300005981 | Ga0081538_10016642 | Ga0081538_100166426 | 192 |
| 162 | 3300010375 | Ga0105239_11170340 | Ga0105239_111703401 | 192 |
| 163 | 3300005329 | Ga0070683_100002243 | Ga0070683_10000224311 | 193 |
| 164 | 3300005340 | Ga0070689_100065108 | Ga0070689_1000651082 | 193 |
| 165 | 3300005468 | Ga0070707_100024321 | Ga0070707_1000243214 | 193 |
| 166 | 3300005535 | Ga0070684_100003076 | Ga0070684_1000030764 | 193 |
| 167 | 3300005577 | Ga0068857_100001706 | Ga0068857_1000017067 | 193 |
| 168 | 3300005618 | Ga0068864_100361375 | Ga0068864_1003613752 | 193 |
| 169 | 3300005843 | Ga0068860_100647358 | Ga0068860_1006473582 | 193 |
| 170 | 3300005937 | Ga0081455_10027319 | Ga0081455_100273197 | 193 |
| 171 | 3300025922 | Ga0207646_10033131 | Ga0207646_100331314 | 193 |
| 172 | 3300025936 | Ga0207670_10075831 | Ga0207670_100758312 | 193 |
| 173 | 3300025944 | Ga0207661_10007251 | Ga0207661_100072515 | 193 |
| 174 | 3300025945 | Ga0207679_10238083 | Ga0207679_102380831 | 193 |
| 175 | 3300026067 | Ga0207678_10190476 | Ga0207678_101904762 | 193 |
| 176 | 3300026088 | Ga0207641_11180233 | Ga0207641_111802331 | 193 |
| 177 | 3300026095 | Ga0207676_10607485 | Ga0207676_106074852 | 193 |
| 178 | 3300026116 | Ga0207674_10000635 | Ga0207674_1000063537 | 193 |
| 179 | 3300028381 | Ga0268264_10465615 | Ga0268264_104656152 | 193 |
| 180 | 3300048916 | Ga0496113_0850830 | Ga0496113_0850830_37_669 | 193 |
| 181 | 3300049570 | Ga0501033_0531236 | Ga0501033_0531236_150_785 | 193 |
| 182 | 3300005445 | Ga0070708_100120157 | Ga0070708_1001201572 | 194 |
| 183 | 3300005467 | Ga0070706_100006302 | Ga0070706_1000063027 | 194 |
| 184 | 3300005468 | Ga0070707_100131426 | Ga0070707_1001314263 | 194 |
| 185 | 3300005471 | Ga0070698_100203811 | Ga0070698_1002038113 | 194 |
| 186 | 3300025910 | Ga0207684_10051955 | Ga0207684_100519553 | 194 |
| 187 | 3300025922 | Ga0207646_10003386 | Ga0207646_1000338618 | 194 |
| 188 | 3300035725 | Ga0373947_0021867 | Ga0373947_0021867_1070_1735 | 194 |
| 189 | 3300048904 | Ga0496101_0542711 | Ga0496101_0542711_97_750 | 194 |
| 190 | 3300006871 | Ga0075434_100113934 | Ga0075434_1001139341 | 195 |
| 191 | 3300006914 | Ga0075436_100234205 | Ga0075436_1002342052 | 195 |
| 192 | 3300025922 | Ga0207646_10536978 | Ga0207646_105369781 | 195 |
| 193 | 3300049583 | Ga0501067_0008277 | Ga0501067_0008277_4888_5535 | 195 |
| 194 | 3300049585 | Ga0501069_0013951 | Ga0501069_0013951_414_1061 | 195 |
| 195 | 3300049586 | Ga0501070_0086193 | Ga0501070_0086193_1924_2571 | 195 |
| 196 | 3300050512 | nmdc:mga0n895_290407_c1 | nmdc:mga0n895_290407_c1_816_1481 | 195 |
| 197 | 3300061734 | Ga0530510_0059294 | Ga0530510_0059294_2018_2665 | 195 |
| 198 | 3300005457 | Ga0070662_100005090 | Ga0070662_1000050903 | 196 |
| 199 | 3300005545 | Ga0070695_100065136 | Ga0070695_1000651363 | 196 |
| 200 | 3300005563 | Ga0068855_100028546 | Ga0068855_1000285469 | 196 |
| 201 | 3300005719 | Ga0068861_100008038 | Ga0068861_1000080389 | 196 |
| 202 | 3300009093 | Ga0105240_11038394 | Ga0105240_110383942 | 196 |
| 203 | 3300009098 | Ga0105245_10013986 | Ga0105245_100139863 | 196 |
| 204 | 3300009553 | Ga0105249_10025423 | Ga0105249_100254233 | 196 |
| 205 | 3300010375 | Ga0105239_10266060 | Ga0105239_102660602 | 196 |
| 206 | 3300013306 | Ga0163162_10248705 | Ga0163162_102487052 | 196 |
| 207 | 3300017792 | Ga0163161_10125838 | Ga0163161_101258381 | 196 |
| 208 | 3300025927 | Ga0207687_10025966 | Ga0207687_100259666 | 196 |
| 209 | 3300025933 | Ga0207706_10006899 | Ga0207706_100068996 | 196 |
| 210 | 3300025949 | Ga0207667_10079878 | Ga0207667_100798785 | 196 |
| 211 | 3300025961 | Ga0207712_10028018 | Ga0207712_100280185 | 196 |
| 212 | 3300025972 | Ga0207668_10119724 | Ga0207668_101197242 | 196 |
| 213 | 3300026118 | Ga0207675_100001404 | Ga0207675_10000140416 | 196 |
| 214 | 3300035410 | Ga0373924_0110572 | Ga0373924_0110572_112_759 | 196 |
| 215 | 3300036401 | Ga0373937_0005583 | Ga0373937_0005583_3374_4021 | 196 |
| 216 | 3300037312 | Ga0395899_0034039 | Ga0395899_0034039_882_1529 | 196 |
| 217 | 3300037418 | Ga0395900_0130263 | Ga0395900_0130263_124_771 | 196 |
| 218 | 3300037466 | Ga0395898_0196032 | Ga0395898_0196032_1110_1757 | 196 |
| 219 | 3300037471 | Ga0395905_0203318 | Ga0395905_0203318_464_1111 | 196 |
| 220 | 3300037471 | Ga0395905_0283583 | Ga0395905_0283583_145_792 | 196 |
| 221 | 3300038443 | Ga0395901_0686070 | Ga0395901_0686070_208_855 | 196 |
| 222 | 3300048905 | Ga0496102_0772702 | Ga0496102_0772702_110_814 | 196 |
| 223 | 3300050512 | nmdc:mga0n895_671294_c1 | nmdc:mga0n895_671294_c1_386_997 | 196 |
| 224 | 3300002077 | JGI24744J21845_10005541 | JGI24744J21845_100055413 | 197 |
| 225 | 3300005330 | Ga0070690_100052433 | Ga0070690_1000524333 | 197 |
| 226 | 3300005335 | Ga0070666_10109394 | Ga0070666_101093942 | 197 |
| 227 | 3300005336 | Ga0070680_100090747 | Ga0070680_1000907473 | 197 |
| 228 | 3300005337 | Ga0070682_100003625 | Ga0070682_1000036251 | 197 |
| 229 | 3300005339 | Ga0070660_100008595 | Ga0070660_1000085954 | 197 |
| 230 | 3300005340 | Ga0070689_100056419 | Ga0070689_1000564192 | 197 |
| 231 | 3300005343 | Ga0070687_100005734 | Ga0070687_1000057345 | 197 |
| 232 | 3300005345 | Ga0070692_10058446 | Ga0070692_100584462 | 197 |
| 233 | 3300005347 | Ga0070668_100011757 | Ga0070668_1000117578 | 197 |
| 234 | 3300005355 | Ga0070671_100089380 | Ga0070671_1000893803 | 197 |
| 235 | 3300005365 | Ga0070688_100091260 | Ga0070688_1000912603 | 197 |
| 236 | 3300005434 | Ga0070709_10145195 | Ga0070709_101451953 | 197 |
| 237 | 3300005437 | Ga0070710_10009130 | Ga0070710_100091306 | 197 |
| 238 | 3300005438 | Ga0070701_10068936 | Ga0070701_100689363 | 197 |
| 239 | 3300005439 | Ga0070711_100030904 | Ga0070711_1000309045 | 197 |
| 240 | 3300005440 | Ga0070705_100024691 | Ga0070705_1000246912 | 197 |
| 241 | 3300005444 | Ga0070694_100046715 | Ga0070694_1000467153 | 197 |
| 242 | 3300005445 | Ga0070708_100475849 | Ga0070708_1004758492 | 197 |
| 243 | 3300005456 | Ga0070678_100001440 | Ga0070678_1000014402 | 197 |
| 244 | 3300005458 | Ga0070681_10523595 | Ga0070681_105235952 | 197 |
| 245 | 3300005459 | Ga0068867_100002296 | Ga0068867_10000229617 | 197 |
| 246 | 3300005466 | Ga0070685_10008151 | Ga0070685_100081515 | 197 |
| 247 | 3300005467 | Ga0070706_100066105 | Ga0070706_1000661053 | 197 |
| 248 | 3300005518 | Ga0070699_100339894 | Ga0070699_1003398942 | 197 |
| 249 | 3300005536 | Ga0070697_100164640 | Ga0070697_1001646403 | 197 |
| 250 | 3300005539 | Ga0068853_100136108 | Ga0068853_1001361082 | 197 |
| 251 | 3300005543 | Ga0070672_100051493 | Ga0070672_1000514933 | 197 |
| 252 | 3300005544 | Ga0070686_100000541 | Ga0070686_1000005412 | 197 |
| 253 | 3300005545 | Ga0070695_100106767 | Ga0070695_1001067672 | 197 |
| 254 | 3300005546 | Ga0070696_100080603 | Ga0070696_1000806032 | 197 |
| 255 | 3300005548 | Ga0070665_100009491 | Ga0070665_1000094912 | 197 |
| 256 | 3300005549 | Ga0070704_100073129 | Ga0070704_1000731294 | 197 |
| 257 | 3300005614 | Ga0068856_100002949 | Ga0068856_10000294921 | 197 |
| 258 | 3300005614 | Ga0068856_100380229 | Ga0068856_1003802291 | 197 |
| 259 | 3300005615 | Ga0070702_100004033 | Ga0070702_1000040337 | 197 |
| 260 | 3300005616 | Ga0068852_101166921 | Ga0068852_1011669211 | 197 |
| 261 | 3300005617 | Ga0068859_100484160 | Ga0068859_1004841602 | 197 |
| 262 | 3300005718 | Ga0068866_10002211 | Ga0068866_100022112 | 197 |
| 263 | 3300005719 | Ga0068861_100042333 | Ga0068861_1000423332 | 197 |
| 264 | 3300005843 | Ga0068860_100080871 | Ga0068860_1000808714 | 197 |
| 265 | 3300005844 | Ga0068862_100054129 | Ga0068862_1000541292 | 197 |
| 266 | 3300005983 | Ga0081540_1089031 | Ga0081540_10890312 | 197 |
| 267 | 3300006237 | Ga0097621_100044929 | Ga0097621_1000449292 | 197 |
| 268 | 3300006358 | Ga0068871_100371258 | Ga0068871_1003712583 | 197 |
| 269 | 3300006881 | Ga0068865_100000372 | Ga0068865_10000037221 | 197 |
| 270 | 3300006931 | Ga0097620_100484111 | Ga0097620_1004841112 | 197 |
| 271 | 3300009098 | Ga0105245_10003696 | Ga0105245_1000369618 | 197 |
| 272 | 3300009101 | Ga0105247_10010220 | Ga0105247_100102201 | 197 |
| 273 | 3300009148 | Ga0105243_10000793 | Ga0105243_1000079331 | 197 |
| 274 | 3300009176 | Ga0105242_10008195 | Ga0105242_1000819512 | 197 |
| 275 | 3300009177 | Ga0105248_10048963 | Ga0105248_100489635 | 197 |
| 276 | 3300009545 | Ga0105237_10082301 | Ga0105237_100823014 | 197 |
| 277 | 3300009551 | Ga0105238_10070609 | Ga0105238_100706094 | 197 |
| 278 | 3300009553 | Ga0105249_10001946 | Ga0105249_100019467 | 197 |
| 279 | 3300010375 | Ga0105239_10002279 | Ga0105239_100022793 | 197 |
| 280 | 3300013102 | Ga0157371_10139754 | Ga0157371_101397543 | 197 |
| 281 | 3300013297 | Ga0157378_10004177 | Ga0157378_100041772 | 197 |
| 282 | 3300013306 | Ga0163162_10017450 | Ga0163162_100174504 | 197 |
| 283 | 3300014326 | Ga0157380_10045294 | Ga0157380_100452942 | 197 |
| 284 | 3300025898 | Ga0207692_10005823 | Ga0207692_100058237 | 197 |
| 285 | 3300025899 | Ga0207642_10216728 | Ga0207642_102167282 | 197 |
| 286 | 3300025900 | Ga0207710_10040870 | Ga0207710_100408702 | 197 |
| 287 | 3300025903 | Ga0207680_10146962 | Ga0207680_101469622 | 197 |
| 288 | 3300025915 | Ga0207693_10009922 | Ga0207693_100099227 | 197 |
| 289 | 3300025916 | Ga0207663_10005856 | Ga0207663_100058566 | 197 |
| 290 | 3300025917 | Ga0207660_10080347 | Ga0207660_100803473 | 197 |
| 291 | 3300025918 | Ga0207662_10080352 | Ga0207662_100803522 | 197 |
| 292 | 3300025919 | Ga0207657_10017530 | Ga0207657_100175304 | 197 |
| 293 | 3300025924 | Ga0207694_10175535 | Ga0207694_101755352 | 197 |
| 294 | 3300025927 | Ga0207687_10456279 | Ga0207687_104562792 | 197 |
| 295 | 3300025931 | Ga0207644_10050042 | Ga0207644_100500423 | 197 |
| 296 | 3300025933 | Ga0207706_10400723 | Ga0207706_104007232 | 197 |
| 297 | 3300025934 | Ga0207686_10001561 | Ga0207686_100015616 | 197 |
| 298 | 3300025935 | Ga0207709_10059247 | Ga0207709_100592473 | 197 |
| 299 | 3300025936 | Ga0207670_10034204 | Ga0207670_100342043 | 197 |
| 300 | 3300025937 | Ga0207669_10005754 | Ga0207669_100057543 | 197 |
| 301 | 3300025938 | Ga0207704_10045753 | Ga0207704_100457533 | 197 |
| 302 | 3300025940 | Ga0207691_10027054 | Ga0207691_100270544 | 197 |
| 303 | 3300025941 | Ga0207711_10104176 | Ga0207711_101041763 | 197 |
| 304 | 3300025961 | Ga0207712_10001816 | Ga0207712_100018163 | 197 |
| 305 | 3300025972 | Ga0207668_10026778 | Ga0207668_100267785 | 197 |
| 306 | 3300025981 | Ga0207640_10439098 | Ga0207640_104390982 | 197 |
| 307 | 3300026023 | Ga0207677_10098097 | Ga0207677_100980972 | 197 |
| 308 | 3300026041 | Ga0207639_10189311 | Ga0207639_101893112 | 197 |
| 309 | 3300026075 | Ga0207708_10000064 | Ga0207708_100000644 | 197 |
| 310 | 3300026078 | Ga0207702_10017568 | Ga0207702_100175686 | 197 |
| 311 | 3300026089 | Ga0207648_10000958 | Ga0207648_1000095832 | 197 |
| 312 | 3300026118 | Ga0207675_100052074 | Ga0207675_1000520742 | 197 |
| 313 | 3300026121 | Ga0207683_10000450 | Ga0207683_100004508 | 197 |
| 314 | 3300026142 | Ga0207698_10392594 | Ga0207698_103925942 | 197 |
| 315 | 3300028379 | Ga0268266_10058894 | Ga0268266_100588945 | 197 |
| 316 | 3300042142 | Ga0450905_013829 | Ga0450905_013829_402_1031 | 197 |
| 317 | 3300046491 | Ga0495584_0053086 | Ga0495584_0053086_1137_1799 | 197 |
| 318 | 3300046528 | Ga0495642_0088507 | Ga0495642_0088507_561_1223 | 197 |
| 319 | 3300046537 | Ga0495598_0135787 | Ga0495598_0135787_25_687 | 197 |
| 320 | 3300046616 | Ga0495668_0052050 | Ga0495668_0052050_304_966 | 197 |
| 321 | 3300046648 | Ga0495611_0204309 | Ga0495611_0204309_174_836 | 197 |
| 322 | 3300048903 | Ga0496100_0025178 | Ga0496100_0025178_2197_2853 | 197 |
| 323 | 3300048904 | Ga0496101_0019616 | Ga0496101_0019616_3701_4357 | 197 |
| 324 | 3300048905 | Ga0496102_0008114 | Ga0496102_0008114_736_1392 | 197 |
| 325 | 3300048906 | Ga0496103_0001171 | Ga0496103_0001171_1621_2277 | 197 |
| 326 | 3300048907 | Ga0496104_0061095 | Ga0496104_0061095_2696_3352 | 197 |
| 327 | 3300048909 | Ga0496106_0003883 | Ga0496106_0003883_10046_10702 | 197 |
| 328 | 3300048911 | Ga0496108_0029825 | Ga0496108_0029825_259_915 | 197 |
| 329 | 3300048917 | Ga0496114_0027132 | Ga0496114_0027132_745_1401 | 197 |
| 330 | 3300048918 | Ga0496115_0003228 | Ga0496115_0003228_1379_2035 | 197 |
| 331 | 3300037466 | Ga0395898_0118250 | Ga0395898_0118250_1121_1774 | 198 |
| 332 | 3300046473 | Ga0495582_0275920 | Ga0495582_0275920_288_926 | 198 |
| 333 | 3300047315 | Ga0495581_0074233 | Ga0495581_0074233_728_1366 | 198 |
| 334 | 3300005985 | Ga0081539_10011230 | Ga0081539_100112307 | 199 |
| 335 | 3300006058 | Ga0075432_10005834 | Ga0075432_100058345 | 199 |
| 336 | 3300006871 | Ga0075434_100228877 | Ga0075434_1002288773 | 199 |
| 337 | 3300006880 | Ga0075429_100242417 | Ga0075429_1002424172 | 199 |
| 338 | 3300007076 | Ga0075435_100022943 | Ga0075435_1000229432 | 199 |
| 339 | 3300009147 | Ga0114129_10069564 | Ga0114129_100695643 | 199 |
| 340 | 3300027907 | Ga0207428_10008066 | Ga0207428_100080664 | 199 |
| 341 | 3300037312 | Ga0395899_0173326 | Ga0395899_0173326_333_986 | 199 |
| 342 | 3300037471 | Ga0395905_0074199 | Ga0395905_0074199_1312_1965 | 199 |
| 343 | 3300038443 | Ga0395901_0026394 | Ga0395901_0026394_2262_2915 | 199 |
| 344 | 3300044694 | Ga0466963_0114373 | Ga0466963_0114373_195_827 | 199 |
| 345 | 3300050507 | nmdc:mga05p37_35575_c1 | nmdc:mga05p37_35575_c1_3261_3914 | 199 |
| 346 | 3300050511 | nmdc:mga08y16_43806_c1 | nmdc:mga08y16_43806_c1_3301_3954 | 199 |
| 347 | 3300050512 | nmdc:mga0n895_4819_c1 | nmdc:mga0n895_4819_c1_5000_5653 | 199 |
| 348 | 3300050513 | nmdc:mga0rr50_20862_c1 | nmdc:mga0rr50_20862_c1_3038_3691 | 199 |
| 349 | 3300050515 | nmdc:mga0a205_14964_c1 | nmdc:mga0a205_14964_c1_5973_6626 | 199 |
| 350 | 3300006028 | Ga0070717_10307536 | Ga0070717_103075361 | 200 |
| 351 | 3300032002 | Ga0307416_100134222 | Ga0307416_1001342222 | 200 |
| 352 | 3300032126 | Ga0307415_100013125 | Ga0307415_1000131254 | 200 |
| 353 | 3300025898 | Ga0207692_10136226 | Ga0207692_101362262 | 201 |
| 354 | 3300042530 | Ga0450916_013031 | Ga0450916_013031_179_808 | 201 |
| 355 | 3300046689 | Ga0495613_0183097 | Ga0495613_0183097_367_1023 | 201 |
| 356 | 3300005563 | Ga0068855_100680326 | Ga0068855_1006803261 | 202 |
| 357 | 3300005981 | Ga0081538_10058845 | Ga0081538_100588452 | 202 |
| 358 | 3300006175 | Ga0070712_100866426 | Ga0070712_1008664261 | 202 |
| 359 | 3300009551 | Ga0105238_10800676 | Ga0105238_108006761 | 202 |
| 360 | 3300014968 | Ga0157379_10866115 | Ga0157379_108661151 | 202 |
| 361 | 3300042005 | Ga0439448_0002961 | Ga0439448_0002961_58_708 | 202 |
| 362 | 3300042438 | Ga0439459_0000765 | Ga0439459_0000765_2530_3180 | 202 |
| 363 | 3300048907 | Ga0496104_0525379 | Ga0496104_0525379_269_928 | 202 |
| 364 | 3300048917 | Ga0496114_0355510 | Ga0496114_0355510_181_840 | 202 |
| 365 | 3300020076 | Ga0206355_1456876 | Ga0206355_14568762 | 203 |
| 366 | 3300032126 | Ga0307415_100104075 | Ga0307415_1001040751 | 203 |
| 367 | 3300037312 | Ga0395899_0076330 | Ga0395899_0076330_1212_1865 | 203 |
| 368 | 3300037466 | Ga0395898_0401017 | Ga0395898_0401017_144_776 | 203 |
| 369 | 3300037471 | Ga0395905_0004600 | Ga0395905_0004600_7850_8503 | 203 |
| 370 | 3300038443 | Ga0395901_0007239 | Ga0395901_0007239_3934_4587 | 203 |
| 371 | 3300042016 | Ga0439463_034037 | Ga0439463_034037_305_955 | 203 |
| 372 | 3300042439 | Ga0439464_0002766 | Ga0439464_0002766_852_1502 | 203 |
| 373 | 3300005468 | Ga0070707_100428993 | Ga0070707_1004289932 | 204 |
| 374 | 3300005471 | Ga0070698_100329694 | Ga0070698_1003296942 | 204 |
| 375 | 3300005518 | Ga0070699_100196842 | Ga0070699_1001968421 | 204 |
| 376 | 3300005536 | Ga0070697_100238156 | Ga0070697_1002381561 | 204 |
| 377 | 3300005937 | Ga0081455_10023020 | Ga0081455_100230206 | 204 |
| 378 | 3300006847 | Ga0075431_100004110 | Ga0075431_1000041108 | 204 |
| 379 | 3300046461 | Ga0495641_0200192 | Ga0495641_0200192_32_688 | 204 |
| 380 | 3300046472 | Ga0495580_0154744 | Ga0495580_0154744_32_688 | 204 |
| 381 | 3300046473 | Ga0495582_0056238 | Ga0495582_0056238_231_887 | 204 |
| 382 | 3300046492 | Ga0495585_0175912 | Ga0495585_0175912_339_995 | 204 |
| 383 | 3300046500 | Ga0495596_0081266 | Ga0495596_0081266_209_865 | 204 |
| 384 | 3300046615 | Ga0495656_0172728 | Ga0495656_0172728_107_763 | 204 |
| 385 | 3300046681 | Ga0495647_0025564 | Ga0495647_0025564_282_938 | 204 |
| 386 | 3300047315 | Ga0495581_0000916 | Ga0495581_0000916_10340_10996 | 204 |
| 387 | 3300047321 | Ga0495676_0005289 | Ga0495676_0005289_3419_4075 | 204 |
| 388 | 3300050510 | nmdc:mga06r32_5438_c1 | nmdc:mga06r32_5438_c1_4883_5533 | 204 |
| 389 | 3300005435 | Ga0070714_100062094 | Ga0070714_1000620944 | 205 |
| 390 | 3300005445 | Ga0070708_100405356 | Ga0070708_1004053563 | 205 |
| 391 | 3300005468 | Ga0070707_100000131 | Ga0070707_10000013174 | 205 |
| 392 | 3300005471 | Ga0070698_100026040 | Ga0070698_1000260406 | 205 |
| 393 | 3300005518 | Ga0070699_100021897 | Ga0070699_1000218976 | 205 |
| 394 | 3300005518 | Ga0070699_100096932 | Ga0070699_1000969324 | 205 |
| 395 | 3300006028 | Ga0070717_10523614 | Ga0070717_105236142 | 205 |
| 396 | 3300006173 | Ga0070716_100096027 | Ga0070716_1000960272 | 205 |
| 397 | 3300025910 | Ga0207684_10018854 | Ga0207684_100188548 | 205 |
| 398 | 3300025910 | Ga0207684_10238217 | Ga0207684_102382172 | 205 |
| 399 | 3300025922 | Ga0207646_10000135 | Ga0207646_1000013510 | 205 |
| 400 | 3300025922 | Ga0207646_10316659 | Ga0207646_103166592 | 205 |
| 401 | 3300025929 | Ga0207664_10202591 | Ga0207664_102025912 | 205 |
| 402 | 3300025939 | Ga0207665_10288231 | Ga0207665_102882312 | 205 |
| 403 | 3300025939 | Ga0207665_10368727 | Ga0207665_103687272 | 205 |
| 404 | 3300048913 | Ga0496110_0709967 | Ga0496110_0709967_263_886 | 205 |
| 405 | 3300005445 | Ga0070708_100539011 | Ga0070708_1005390112 | 206 |
| 406 | 3300005467 | Ga0070706_100000065 | Ga0070706_100000065101 | 206 |
| 407 | 3300005468 | Ga0070707_100003323 | Ga0070707_10000332310 | 206 |
| 408 | 3300005471 | Ga0070698_100000457 | Ga0070698_10000045718 | 206 |
| 409 | 3300005471 | Ga0070698_100000503 | Ga0070698_10000050333 | 206 |
| 410 | 3300005518 | Ga0070699_100071335 | Ga0070699_1000713351 | 206 |
| 411 | 3300006173 | Ga0070716_100283573 | Ga0070716_1002835732 | 206 |
| 412 | 3300025910 | Ga0207684_10000071 | Ga0207684_10000071166 | 206 |
| 413 | 3300025922 | Ga0207646_10000809 | Ga0207646_1000080925 | 206 |
| 414 | 3300037312 | Ga0395899_0182299 | Ga0395899_0182299_268_897 | 206 |
| 415 | 3300037418 | Ga0395900_0154442 | Ga0395900_0154442_883_1512 | 206 |
| 416 | 3300037466 | Ga0395898_0537557 | Ga0395898_0537557_32_661 | 206 |
| 417 | 3300037471 | Ga0395905_0003142 | Ga0395905_0003142_10205_10834 | 206 |
| 418 | 3300038443 | Ga0395901_0001828 | Ga0395901_0001828_10918_11547 | 206 |
| 419 | 3300039437 | Ga0436365_1817076 | Ga0436365_1817076_303_938 | 206 |
| 420 | 3300006173 | Ga0070716_100014134 | Ga0070716_1000141346 | 207 |
| 421 | 3300006852 | Ga0075433_10324913 | Ga0075433_103249132 | 207 |
| 422 | 3300025915 | Ga0207693_10030056 | Ga0207693_100300565 | 207 |
| 423 | 3300025922 | Ga0207646_10180699 | Ga0207646_101806992 | 207 |
| 424 | 3300025928 | Ga0207700_10000022 | Ga0207700_1000002292 | 207 |
| 425 | 3300025939 | Ga0207665_10023234 | Ga0207665_100232343 | 207 |
| 426 | 3300037312 | Ga0395899_0093511 | Ga0395899_0093511_622_1269 | 207 |
| 427 | 3300037312 | Ga0395899_0200472 | Ga0395899_0200472_411_1049 | 207 |
| 428 | 3300037418 | Ga0395900_0001588 | Ga0395900_0001588_25132_25779 | 207 |
| 429 | 3300037418 | Ga0395900_0105035 | Ga0395900_0105035_343_981 | 207 |
| 430 | 3300037466 | Ga0395898_0105884 | Ga0395898_0105884_206_853 | 207 |
| 431 | 3300037466 | Ga0395898_0175463 | Ga0395898_0175463_27_665 | 207 |
| 432 | 3300037471 | Ga0395905_0001761 | Ga0395905_0001761_21068_21715 | 207 |
| 433 | 3300038443 | Ga0395901_0001597 | Ga0395901_0001597_21452_22099 | 207 |
| 434 | 3300038443 | Ga0395901_0184487 | Ga0395901_0184487_370_1008 | 207 |
| 435 | 3300041459 | Ga0451800_0109780 | Ga0451800_0109780_162_794 | 207 |
| 436 | 3300048913 | Ga0496110_0092570 | Ga0496110_0092570_255_893 | 207 |
| 437 | 3300050513 | nmdc:mga0rr50_80442_c1 | nmdc:mga0rr50_80442_c1_1128_1775 | 207 |
| 438 | 3300005367 | Ga0070667_100342516 | Ga0070667_1003425161 | 208 |
| 439 | 3300005471 | Ga0070698_100030759 | Ga0070698_1000307592 | 208 |
| 440 | 3300005543 | Ga0070672_100345727 | Ga0070672_1003457272 | 208 |
| 441 | 3300005618 | Ga0068864_100209066 | Ga0068864_1002090662 | 208 |
| 442 | 3300006058 | Ga0075432_10006844 | Ga0075432_100068445 | 208 |
| 443 | 3300006871 | Ga0075434_100092515 | Ga0075434_1000925152 | 208 |
| 444 | 3300009098 | Ga0105245_10072043 | Ga0105245_100720432 | 208 |
| 445 | 3300009147 | Ga0114129_10570683 | Ga0114129_105706832 | 208 |
| 446 | 3300009177 | Ga0105248_10532112 | Ga0105248_105321122 | 208 |
| 447 | 3300013308 | Ga0157375_10025598 | Ga0157375_100255983 | 208 |
| 448 | 3300025940 | Ga0207691_10210400 | Ga0207691_102104003 | 208 |
| 449 | 3300025942 | Ga0207689_10185610 | Ga0207689_101856101 | 208 |
| 450 | 3300037312 | Ga0395899_0156979 | Ga0395899_0156979_302_952 | 208 |
| 451 | 3300037418 | Ga0395900_0378781 | Ga0395900_0378781_722_1372 | 208 |
| 452 | 3300037471 | Ga0395905_0139218 | Ga0395905_0139218_1233_1883 | 208 |
| 453 | 3300038443 | Ga0395901_0205304 | Ga0395901_0205304_430_1080 | 208 |
| 454 | 3300046462 | Ga0495651_0003810 | Ga0495651_0003810_7121_7771 | 208 |
| 455 | 3300046463 | Ga0495653_0151295 | Ga0495653_0151295_793_1443 | 208 |
| 456 | 3300046475 | Ga0495639_0133001 | Ga0495639_0133001_392_1042 | 208 |
| 457 | 3300046476 | Ga0495662_0056754 | Ga0495662_0056754_1067_1717 | 208 |
| 458 | 3300046511 | Ga0495608_0351777 | Ga0495608_0351777_40_690 | 208 |
| 459 | 3300046517 | Ga0495630_0003481 | Ga0495630_0003481_6233_6883 | 208 |
| 460 | 3300046526 | Ga0495666_0138915 | Ga0495666_0138915_325_975 | 208 |
| 461 | 3300046529 | Ga0495652_0070688 | Ga0495652_0070688_1152_1802 | 208 |
| 462 | 3300046529 | Ga0495652_0331336 | Ga0495652_0331336_296_946 | 208 |
| 463 | 3300046533 | Ga0495640_0004494 | Ga0495640_0004494_8307_8957 | 208 |
| 464 | 3300046543 | Ga0495645_0462889 | Ga0495645_0462889_15_665 | 208 |
| 465 | 3300046559 | Ga0495667_0029407 | Ga0495667_0029407_1666_2316 | 208 |
| 466 | 3300046664 | Ga0495659_0070461 | Ga0495659_0070461_459_1094 | 208 |
| 467 | 3300046678 | Ga0495599_0087043 | Ga0495599_0087043_1187_1837 | 208 |
| 468 | 3300046794 | Ga0495589_0184908 | Ga0495589_0184908_129_794 | 208 |
| 469 | 3300046809 | Ga0495600_0228145 | Ga0495600_0228145_322_972 | 208 |
| 470 | 3300047319 | Ga0495674_0004625 | Ga0495674_0004625_8623_9273 | 208 |
| 471 | 3300047322 | Ga0495680_0004191 | Ga0495680_0004191_8036_8686 | 208 |
| 472 | 3300047471 | Ga0495684_0025968 | Ga0495684_0025968_3118_3768 | 208 |
| 473 | 3300048907 | Ga0496104_0309997 | Ga0496104_0309997_273_938 | 208 |
| 474 | 3300048911 | Ga0496108_0014703 | Ga0496108_0014703_3415_4080 | 208 |
| 475 | 3300048911 | Ga0496108_0360393 | Ga0496108_0360393_303_953 | 208 |
| 476 | 3300048912 | Ga0496109_0001268 | Ga0496109_0001268_11943_12608 | 208 |
| 477 | 3300048913 | Ga0496110_0023256 | Ga0496110_0023256_4104_4769 | 208 |
| 478 | 3300048914 | Ga0496111_0003756 | Ga0496111_0003756_7103_7768 | 208 |
| 479 | 3300005719 | Ga0068861_100120082 | Ga0068861_1001200823 | 209 |
| 480 | 3300005937 | Ga0081455_10007927 | Ga0081455_100079278 | 209 |
| 481 | 3300006028 | Ga0070717_10039636 | Ga0070717_100396364 | 209 |
| 482 | 3300006847 | Ga0075431_100162565 | Ga0075431_1001625652 | 209 |
| 483 | 3300006914 | Ga0075436_100496273 | Ga0075436_1004962731 | 209 |
| 484 | 3300007076 | Ga0075435_100172070 | Ga0075435_1001720702 | 209 |
| 485 | 3300009098 | Ga0105245_10088962 | Ga0105245_100889624 | 209 |
| 486 | 3300009147 | Ga0114129_10133650 | Ga0114129_101336503 | 209 |
| 487 | 3300025927 | Ga0207687_10108393 | Ga0207687_101083933 | 209 |
| 488 | 3300025961 | Ga0207712_10069569 | Ga0207712_100695693 | 209 |
| 489 | 3300026023 | Ga0207677_10103401 | Ga0207677_101034013 | 209 |
| 490 | 3300026118 | Ga0207675_100108792 | Ga0207675_1001087924 | 209 |
| 491 | 3300031548 | Ga0307408_100448359 | Ga0307408_1004483592 | 209 |
| 492 | 3300031824 | Ga0307413_10090252 | Ga0307413_100902522 | 209 |
| 493 | 3300031852 | Ga0307410_10474995 | Ga0307410_104749951 | 209 |
| 494 | 3300031901 | Ga0307406_10088080 | Ga0307406_100880802 | 209 |
| 495 | 3300031995 | Ga0307409_100400028 | Ga0307409_1004000282 | 209 |
| 496 | 3300032002 | Ga0307416_100152402 | Ga0307416_1001524022 | 209 |
| 497 | 3300032004 | Ga0307414_10511737 | Ga0307414_105117372 | 209 |
| 498 | 3300032005 | Ga0307411_10063622 | Ga0307411_100636223 | 209 |
| 499 | 3300035241 | Ga0373961_0020468 | Ga0373961_0020468_172_825 | 209 |
| 500 | 3300037312 | Ga0395899_0149051 | Ga0395899_0149051_568_1221 | 209 |
| 501 | 3300037418 | Ga0395900_0053577 | Ga0395900_0053577_316_969 | 209 |
| 502 | 3300037418 | Ga0395900_0093085 | Ga0395900_0093085_1140_1793 | 209 |
| 503 | 3300037466 | Ga0395898_0049301 | Ga0395898_0049301_2606_3259 | 209 |
| 504 | 3300037466 | Ga0395898_0191259 | Ga0395898_0191259_20_649 | 209 |
| 505 | 3300037466 | Ga0395898_0540746 | Ga0395898_0540746_131_784 | 209 |
| 506 | 3300037471 | Ga0395905_0170827 | Ga0395905_0170827_493_1146 | 209 |
| 507 | 3300038443 | Ga0395901_0002386 | Ga0395901_0002386_13104_13733 | 209 |
| 508 | 3300038443 | Ga0395901_0020676 | Ga0395901_0020676_4551_5204 | 209 |
| 509 | 3300041512 | Ga0451853_2979489 | Ga0451853_2979489_77_730 | 209 |
| 510 | 3300042005 | Ga0439448_0014467 | Ga0439448_0014467_140_793 | 209 |
| 511 | 3300042012 | Ga0439455_0036609 | Ga0439455_0036609_364_1017 | 209 |
| 512 | 3300042438 | Ga0439459_0009350 | Ga0439459_0009350_338_991 | 209 |
| 513 | 3300046500 | Ga0495596_0090933 | Ga0495596_0090933_480_1121 | 209 |
| 514 | 3300050507 | nmdc:mga05p37_237163_c1 | nmdc:mga05p37_237163_c1_1183_1815 | 209 |
| 515 | 3300050510 | nmdc:mga06r32_874901_c1 | nmdc:mga06r32_874901_c1_19_660 | 209 |
| 516 | 3300050512 | nmdc:mga0n895_85291_c1 | nmdc:mga0n895_85291_c1_576_1229 | 209 |
| 517 | 3300005434 | Ga0070709_10821633 | Ga0070709_108216331 | 210 |
| 518 | 3300005436 | Ga0070713_100001480 | Ga0070713_10000148012 | 210 |
| 519 | 3300005437 | Ga0070710_10105434 | Ga0070710_101054341 | 210 |
| 520 | 3300005467 | Ga0070706_100092842 | Ga0070706_1000928422 | 210 |
| 521 | 3300005468 | Ga0070707_100008114 | Ga0070707_1000081149 | 210 |
| 522 | 3300005518 | Ga0070699_100000758 | Ga0070699_10000075829 | 210 |
| 523 | 3300005536 | Ga0070697_100009116 | Ga0070697_1000091165 | 210 |
| 524 | 3300005549 | Ga0070704_100052427 | Ga0070704_1000524273 | 210 |
| 525 | 3300005614 | Ga0068856_100019295 | Ga0068856_1000192953 | 210 |
| 526 | 3300005841 | Ga0068863_100174280 | Ga0068863_1001742803 | 210 |
| 527 | 3300006028 | Ga0070717_10080248 | Ga0070717_100802485 | 210 |
| 528 | 3300006028 | Ga0070717_10356165 | Ga0070717_103561652 | 210 |
| 529 | 3300006173 | Ga0070716_100534585 | Ga0070716_1005345852 | 210 |
| 530 | 3300009177 | Ga0105248_11324139 | Ga0105248_113241391 | 210 |
| 531 | 3300025906 | Ga0207699_10477774 | Ga0207699_104777741 | 210 |
| 532 | 3300025910 | Ga0207684_10038969 | Ga0207684_100389694 | 210 |
| 533 | 3300025922 | Ga0207646_10015155 | Ga0207646_100151555 | 210 |
| 534 | 3300025928 | Ga0207700_10337043 | Ga0207700_103370431 | 210 |
| 535 | 3300026078 | Ga0207702_10029148 | Ga0207702_100291484 | 210 |
| 536 | 3300035121 | Ga0373960_0010730 | Ga0373960_0010730_1385_2035 | 210 |
| 537 | 3300035172 | Ga0373955_0078567 | Ga0373955_0078567_90_722 | 210 |
| 538 | 3300035725 | Ga0373947_0027005 | Ga0373947_0027005_2656_3330 | 210 |
| 539 | 3300048903 | Ga0496100_0795837 | Ga0496100_0795837_81_731 | 210 |
| 540 | 3300048904 | Ga0496101_0017284 | Ga0496101_0017284_242_892 | 210 |
| 541 | 3300048904 | Ga0496101_0328773 | Ga0496101_0328773_361_999 | 210 |
| 542 | 3300048905 | Ga0496102_0175758 | Ga0496102_0175758_390_1040 | 210 |
| 543 | 3300048907 | Ga0496104_0022974 | Ga0496104_0022974_4676_5326 | 210 |
| 544 | 3300048909 | Ga0496106_0075471 | Ga0496106_0075471_66_716 | 210 |
| 545 | 3300048909 | Ga0496106_0301556 | Ga0496106_0301556_139_789 | 210 |
| 546 | 3300048910 | Ga0496107_0056926 | Ga0496107_0056926_319_969 | 210 |
| 547 | 3300048911 | Ga0496108_0006937 | Ga0496108_0006937_1438_2088 | 210 |
| 548 | 3300048912 | Ga0496109_0001362 | Ga0496109_0001362_3108_3758 | 210 |
| 549 | 3300048913 | Ga0496110_0022752 | Ga0496110_0022752_3627_4277 | 210 |
| 550 | 3300048913 | Ga0496110_0050221 | Ga0496110_0050221_1480_2130 | 210 |
| 551 | 3300048914 | Ga0496111_0001346 | Ga0496111_0001346_12451_13101 | 210 |
| 552 | 3300048915 | Ga0496112_0000677 | Ga0496112_0000677_22672_23322 | 210 |
| 553 | 3300048915 | Ga0496112_0097269 | Ga0496112_0097269_523_1173 | 210 |
| 554 | 3300048915 | Ga0496112_0451589 | Ga0496112_0451589_561_1193 | 210 |
| 555 | 3300048916 | Ga0496113_0000374 | Ga0496113_0000374_20148_20798 | 210 |
| 556 | 3300048917 | Ga0496114_0007583 | Ga0496114_0007583_6298_6948 | 210 |
| 557 | 3300048917 | Ga0496114_0614747 | Ga0496114_0614747_14_652 | 210 |
| 558 | 3300048918 | Ga0496115_0053859 | Ga0496115_0053859_2090_2740 | 210 |
| 559 | 3300005339 | Ga0070660_100200978 | Ga0070660_1002009783 | 211 |
| 560 | 3300005344 | Ga0070661_100101051 | Ga0070661_1001010512 | 211 |
| 561 | 3300005563 | Ga0068855_100030312 | Ga0068855_1000303127 | 211 |
| 562 | 3300005616 | Ga0068852_100051841 | Ga0068852_1000518411 | 211 |
| 563 | 3300025949 | Ga0207667_10026785 | Ga0207667_100267857 | 211 |
| 564 | 3300026142 | Ga0207698_10040256 | Ga0207698_100402561 | 211 |
| 565 | 3300037312 | Ga0395899_0202099 | Ga0395899_0202099_509_1144 | 211 |
| 566 | 3300038443 | Ga0395901_0194422 | Ga0395901_0194422_257_892 | 211 |
| 567 | 3300013102 | Ga0157371_10021950 | Ga0157371_100219502 | 212 |
| 568 | 3300025932 | Ga0207690_10016743 | Ga0207690_100167432 | 212 |
| 569 | 3300049593 | Ga0501077_0367920 | Ga0501077_0367920_35_679 | 212 |
| 570 | 3300005468 | Ga0070707_100242857 | Ga0070707_1002428572 | 214 |
| 571 | 3300021388 | Ga0213875_10000644 | Ga0213875_100006443 | 214 |
| 572 | 3300037853 | Ga0436364_0330965 | Ga0436364_0330965_73954_74598 | 214 |
| 573 | 3300048915 | Ga0496112_0338194 | Ga0496112_0338194_661_1317 | 214 |
| 574 | 3300006844 | Ga0075428_100654984 | Ga0075428_1006549841 | 215 |
| 575 | 3300037312 | Ga0395899_0020763 | Ga0395899_0020763_1814_2464 | 215 |
| 576 | 3300037418 | Ga0395900_0076324 | Ga0395900_0076324_144_794 | 215 |
| 577 | 3300037466 | Ga0395898_0046606 | Ga0395898_0046606_3503_4153 | 215 |
| 578 | 3300038443 | Ga0395901_0150318 | Ga0395901_0150318_375_1025 | 215 |
| 579 | 3300050507 | nmdc:mga05p37_244585_c1 | nmdc:mga05p37_244585_c1_664_1314 | 215 |
| 580 | 3300001979 | JGI24740J21852_10074723 | JGI24740J21852_100747232 | 216 |
| 581 | 3300002155 | JGI24033J26618_1015790 | JGI24033J26618_10157901 | 216 |
| 582 | 3300002459 | JGI24751J29686_10036987 | JGI24751J29686_100369872 | 216 |
| 583 | 3300005327 | Ga0070658_10004588 | Ga0070658_1000458810 | 216 |
| 584 | 3300005329 | Ga0070683_100838581 | Ga0070683_1008385811 | 216 |
| 585 | 3300005330 | Ga0070690_100450003 | Ga0070690_1004500032 | 216 |
| 586 | 3300005331 | Ga0070670_100060122 | Ga0070670_1000601224 | 216 |
| 587 | 3300005334 | Ga0068869_100004228 | Ga0068869_1000042284 | 216 |
| 588 | 3300005335 | Ga0070666_10281271 | Ga0070666_102812712 | 216 |
| 589 | 3300005336 | Ga0070680_100003234 | Ga0070680_1000032347 | 216 |
| 590 | 3300005337 | Ga0070682_100002451 | Ga0070682_1000024519 | 216 |
| 591 | 3300005338 | Ga0068868_100005180 | Ga0068868_1000051807 | 216 |
| 592 | 3300005339 | Ga0070660_100092259 | Ga0070660_1000922592 | 216 |
| 593 | 3300005341 | Ga0070691_10005633 | Ga0070691_100056336 | 216 |
| 594 | 3300005344 | Ga0070661_100050120 | Ga0070661_1000501204 | 216 |
| 595 | 3300005345 | Ga0070692_10002446 | Ga0070692_100024463 | 216 |
| 596 | 3300005354 | Ga0070675_100005835 | Ga0070675_1000058357 | 216 |
| 597 | 3300005355 | Ga0070671_100002212 | Ga0070671_1000022121 | 216 |
| 598 | 3300005366 | Ga0070659_100039165 | Ga0070659_1000391654 | 216 |
| 599 | 3300005438 | Ga0070701_10112118 | Ga0070701_101121182 | 216 |
| 600 | 3300005440 | Ga0070705_100071486 | Ga0070705_1000714862 | 216 |
| 601 | 3300005441 | Ga0070700_100198343 | Ga0070700_1001983431 | 216 |
| 602 | 3300005455 | Ga0070663_100006626 | Ga0070663_1000066266 | 216 |
| 603 | 3300005456 | Ga0070678_100008130 | Ga0070678_1000081302 | 216 |
| 604 | 3300005458 | Ga0070681_10480988 | Ga0070681_104809882 | 216 |
| 605 | 3300005466 | Ga0070685_10032550 | Ga0070685_100325502 | 216 |
| 606 | 3300005530 | Ga0070679_100028110 | Ga0070679_1000281106 | 216 |
| 607 | 3300005535 | Ga0070684_100488959 | Ga0070684_1004889592 | 216 |
| 608 | 3300005539 | Ga0068853_100562788 | Ga0068853_1005627882 | 216 |
| 609 | 3300005547 | Ga0070693_100005315 | Ga0070693_1000053154 | 216 |
| 610 | 3300005548 | Ga0070665_100608723 | Ga0070665_1006087232 | 216 |
| 611 | 3300005563 | Ga0068855_100539765 | Ga0068855_1005397652 | 216 |
| 612 | 3300005564 | Ga0070664_100542920 | Ga0070664_1005429202 | 216 |
| 613 | 3300005577 | Ga0068857_100711963 | Ga0068857_1007119631 | 216 |
| 614 | 3300005578 | Ga0068854_100277699 | Ga0068854_1002776992 | 216 |
| 615 | 3300005614 | Ga0068856_100056231 | Ga0068856_1000562314 | 216 |
| 616 | 3300005615 | Ga0070702_100000382 | Ga0070702_1000003821 | 216 |
| 617 | 3300005616 | Ga0068852_100056400 | Ga0068852_1000564002 | 216 |
| 618 | 3300005617 | Ga0068859_101003495 | Ga0068859_1010034952 | 216 |
| 619 | 3300005618 | Ga0068864_100006746 | Ga0068864_1000067468 | 216 |
| 620 | 3300005834 | Ga0068851_10048040 | Ga0068851_100480402 | 216 |
| 621 | 3300005840 | Ga0068870_10000205 | Ga0068870_100002052 | 216 |
| 622 | 3300005841 | Ga0068863_100035875 | Ga0068863_1000358755 | 216 |
| 623 | 3300005842 | Ga0068858_100578215 | Ga0068858_1005782152 | 216 |
| 624 | 3300005843 | Ga0068860_100015607 | Ga0068860_1000156072 | 216 |
| 625 | 3300006058 | Ga0075432_10046682 | Ga0075432_100466822 | 216 |
| 626 | 3300006237 | Ga0097621_100673223 | Ga0097621_1006732232 | 216 |
| 627 | 3300006852 | Ga0075433_10002396 | Ga0075433_100023969 | 216 |
| 628 | 3300006871 | Ga0075434_100010463 | Ga0075434_1000104638 | 216 |
| 629 | 3300006931 | Ga0097620_101003361 | Ga0097620_1010033612 | 216 |
| 630 | 3300007076 | Ga0075435_100001480 | Ga0075435_1000014802 | 216 |
| 631 | 3300009094 | Ga0111539_10020930 | Ga0111539_100209306 | 216 |
| 632 | 3300009098 | Ga0105245_10010965 | Ga0105245_100109659 | 216 |
| 633 | 3300009148 | Ga0105243_11064821 | Ga0105243_110648211 | 216 |
| 634 | 3300009174 | Ga0105241_10028278 | Ga0105241_100282784 | 216 |
| 635 | 3300009177 | Ga0105248_10139157 | Ga0105248_101391573 | 216 |
| 636 | 3300009551 | Ga0105238_10090098 | Ga0105238_100900983 | 216 |
| 637 | 3300010375 | Ga0105239_10063676 | Ga0105239_100636764 | 216 |
| 638 | 3300011119 | Ga0105246_10009444 | Ga0105246_100094444 | 216 |
| 639 | 3300013100 | Ga0157373_10108843 | Ga0157373_101088433 | 216 |
| 640 | 3300013104 | Ga0157370_10075643 | Ga0157370_100756432 | 216 |
| 641 | 3300013105 | Ga0157369_10147677 | Ga0157369_101476772 | 216 |
| 642 | 3300013296 | Ga0157374_10573924 | Ga0157374_105739241 | 216 |
| 643 | 3300013307 | Ga0157372_10347315 | Ga0157372_103473151 | 216 |
| 644 | 3300013308 | Ga0157375_10357089 | Ga0157375_103570892 | 216 |
| 645 | 3300014325 | Ga0163163_10062366 | Ga0163163_100623662 | 216 |
| 646 | 3300014745 | Ga0157377_10004325 | Ga0157377_100043259 | 216 |
| 647 | 3300014968 | Ga0157379_10030327 | Ga0157379_100303272 | 216 |
| 648 | 3300020069 | Ga0197907_11372322 | Ga0197907_113723222 | 216 |
| 649 | 3300020080 | Ga0206350_10218199 | Ga0206350_102181992 | 216 |
| 650 | 3300025321 | Ga0207656_10062722 | Ga0207656_100627222 | 216 |
| 651 | 3300025900 | Ga0207710_10177513 | Ga0207710_101775131 | 216 |
| 652 | 3300025901 | Ga0207688_10193623 | Ga0207688_101936232 | 216 |
| 653 | 3300025903 | Ga0207680_10272807 | Ga0207680_102728072 | 216 |
| 654 | 3300025904 | Ga0207647_10160735 | Ga0207647_101607352 | 216 |
| 655 | 3300025908 | Ga0207643_10000027 | Ga0207643_1000002718 | 216 |
| 656 | 3300025909 | Ga0207705_10056214 | Ga0207705_100562142 | 216 |
| 657 | 3300025909 | Ga0207705_10465155 | Ga0207705_104651552 | 216 |
| 658 | 3300025911 | Ga0207654_10035180 | Ga0207654_100351803 | 216 |
| 659 | 3300025912 | Ga0207707_10404181 | Ga0207707_104041811 | 216 |
| 660 | 3300025914 | Ga0207671_10185819 | Ga0207671_101858192 | 216 |
| 661 | 3300025917 | Ga0207660_10281095 | Ga0207660_102810952 | 216 |
| 662 | 3300025919 | Ga0207657_10109231 | Ga0207657_101092312 | 216 |
| 663 | 3300025920 | Ga0207649_10003298 | Ga0207649_100032982 | 216 |
| 664 | 3300025921 | Ga0207652_10492747 | Ga0207652_104927471 | 216 |
| 665 | 3300025925 | Ga0207650_10001414 | Ga0207650_100014144 | 216 |
| 666 | 3300025925 | Ga0207650_10004873 | Ga0207650_100048733 | 216 |
| 667 | 3300025926 | Ga0207659_10018351 | Ga0207659_100183514 | 216 |
| 668 | 3300025927 | Ga0207687_10396027 | Ga0207687_103960272 | 216 |
| 669 | 3300025931 | Ga0207644_10348164 | Ga0207644_103481642 | 216 |
| 670 | 3300025941 | Ga0207711_10121079 | Ga0207711_101210793 | 216 |
| 671 | 3300025942 | Ga0207689_10004346 | Ga0207689_100043462 | 216 |
| 672 | 3300025944 | Ga0207661_10012002 | Ga0207661_100120023 | 216 |
| 673 | 3300025945 | Ga0207679_10009014 | Ga0207679_100090148 | 216 |
| 674 | 3300025949 | Ga0207667_10048066 | Ga0207667_100480662 | 216 |
| 675 | 3300025960 | Ga0207651_10037039 | Ga0207651_100370394 | 216 |
| 676 | 3300026023 | Ga0207677_10056352 | Ga0207677_100563523 | 216 |
| 677 | 3300026041 | Ga0207639_10375577 | Ga0207639_103755772 | 216 |
| 678 | 3300026067 | Ga0207678_10000662 | Ga0207678_1000066236 | 216 |
| 679 | 3300026075 | Ga0207708_10067211 | Ga0207708_100672113 | 216 |
| 680 | 3300026078 | Ga0207702_10001188 | Ga0207702_100011888 | 216 |
| 681 | 3300026088 | Ga0207641_10042523 | Ga0207641_100425232 | 216 |
| 682 | 3300026095 | Ga0207676_10011868 | Ga0207676_100118688 | 216 |
| 683 | 3300026116 | Ga0207674_10519485 | Ga0207674_105194851 | 216 |
| 684 | 3300026121 | Ga0207683_10002218 | Ga0207683_1000221818 | 216 |
| 685 | 3300026142 | Ga0207698_10025400 | Ga0207698_100254005 | 216 |
| 686 | 3300027907 | Ga0207428_10002503 | Ga0207428_1000250311 | 216 |
| 687 | 3300028379 | Ga0268266_10172245 | Ga0268266_101722452 | 216 |
| 688 | 3300048903 | Ga0496100_0056169 | Ga0496100_0056169_1074_1724 | 216 |
| 689 | 3300048905 | Ga0496102_0035194 | Ga0496102_0035194_320_970 | 216 |
| 690 | 3300048906 | Ga0496103_0031484 | Ga0496103_0031484_94_744 | 216 |
| 691 | 3300048907 | Ga0496104_0001170 | Ga0496104_0001170_13097_13747 | 216 |
| 692 | 3300048908 | Ga0496105_0006599 | Ga0496105_0006599_4645_5295 | 216 |
| 693 | 3300048909 | Ga0496106_0008317 | Ga0496106_0008317_52_702 | 216 |
| 694 | 3300048910 | Ga0496107_0022541 | Ga0496107_0022541_1473_2123 | 216 |
| 695 | 3300048911 | Ga0496108_0002125 | Ga0496108_0002125_5824_6474 | 216 |
| 696 | 3300048912 | Ga0496109_0090273 | Ga0496109_0090273_238_888 | 216 |
| 697 | 3300048913 | Ga0496110_0002646 | Ga0496110_0002646_8071_8721 | 216 |
| 698 | 3300048914 | Ga0496111_0016048 | Ga0496111_0016048_2602_3252 | 216 |
| 699 | 3300048915 | Ga0496112_0043873 | Ga0496112_0043873_2318_2968 | 216 |
| 700 | 3300048916 | Ga0496113_0044877 | Ga0496113_0044877_308_958 | 216 |
| 701 | 3300048917 | Ga0496114_0480196 | Ga0496114_0480196_329_979 | 216 |
| 702 | 3300050510 | nmdc:mga06r32_584315_c1 | nmdc:mga06r32_584315_c1_66_716 | 216 |
| 703 | 3300050511 | nmdc:mga08y16_66007_c1 | nmdc:mga08y16_66007_c1_235_885 | 216 |
| 704 | 3300050512 | nmdc:mga0n895_40782_c1 | nmdc:mga0n895_40782_c1_388_1038 | 216 |
| 705 | 3300050513 | nmdc:mga0rr50_468122_c1 | nmdc:mga0rr50_468122_c1_369_1019 | 216 |
| 706 | 3300050514 | nmdc:mga08x19_5782_c1 | nmdc:mga08x19_5782_c1_1101_1751 | 216 |
| 707 | 3300050515 | nmdc:mga0a205_19434_c1 | nmdc:mga0a205_19434_c1_3826_4476 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e02-assembly1.cif.gz_A | crystal structure of h369l mutant of yeast bleomycin hydrolase | 0.2197 | 34 | 211 |
| 2e02-assembly1.cif.gz_A | crystal structure of h369l mutant of yeast bleomycin hydrolase | 0.1786 | 34 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9N3N3_187_497_3.30.559.70 | Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 | 0.3367 | 10 | 61 | 3.30.559.70 |
| af_Q9N3N3_187_497_3.30.559.70 | Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 | 0.1163 | 10 | 61 | 3.30.559.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538L235-F1-model_v4 | DUF4389 domain-containing protein | 0.9895 | 148 | 216 |
GO:0016020
|
| AF-A0A7K1CJJ6-F1-model_v4 | DUF4389 domain-containing protein | 0.9787 | 150 | 213 |
GO:0016020
|
| AF-A0A661URQ6-F1-model_v4 | DUF4389 domain-containing protein | 0.9701 | 152 | 214 |
GO:0016020
|
| AF-A0A538L235-F1-model_v4 | DUF4389 domain-containing protein | 0.962 | 148 | 216 |
GO:0016020
|
| AF-A0A2W4MPZ9-F1-model_v4 | DUF4389 domain-containing protein | 0.9597 | 79 | 214 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar