F476528

General Info

Members Datasets Scaffolds Average Seq Length
707 323 707 204

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100030759|Ga0070698_1000307592
Length 232
Sequence MREARSDRFEPRRLGSVETSSQTAGRAYPVRFDVEYPDRDLDRLTTAFRIFVAIPILIVAGAVGGHQSTYQAGRHGWTVATGAGGLVVLAPLLMIVFRQKYPRWWYDWNLELQRFSSRVGVYLALMDDRYPSTDEHQSVSLDFPYPDVKTDLNRWLPLVKWLLAIPHYVVLIFLWLAALVSVIIAWFAILFTGRYPRGLFDFVLGVFRWTNRVIGYAFVLVTDEYPPFRLSP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
239 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.61
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10074723 3300001979 Bacteria 899
2 JGI24744J21845_10005541 3300002077 Bacteria 2612
3 JGI24033J26618_1015790 3300002155 Bacteria 935
4 JGI24751J29686_10036987 3300002459 Bacteria 1011
5 JGI25406J46586_10002793 3300003203 Bacteria 8211
6 Ga0070658_10004588 3300005327 Bacteria 11224
7 Ga0070676_10515296 3300005328 Bacteria 851
8 Ga0070683_100002243 3300005329 Bacteria 15326
9 Ga0070683_100838581 3300005329 Bacteria 881
10 Ga0070690_100052433 3300005330 Bacteria 2608
11 Ga0070690_100450003 3300005330 Bacteria 955
12 Ga0070670_100060122 3300005331 Bacteria 3262
13 Ga0068869_100004228 3300005334 Bacteria 8909
14 Ga0070666_10109394 3300005335 Bacteria 1910
15 Ga0070666_10281271 3300005335 Bacteria 1183
16 Ga0070680_100003234 3300005336 Bacteria 12124
17 Ga0070680_100090747 3300005336 Bacteria 2529
18 Ga0070682_100002451 3300005337 Bacteria 10247
19 Ga0070682_100003625 3300005337 Bacteria 8562
20 Ga0068868_100005180 3300005338 Bacteria 9150
21 Ga0070660_100008595 3300005339 Bacteria 7148
22 Ga0070660_100092259 3300005339 Bacteria 2390
23 Ga0070660_100200978 3300005339 Bacteria 1616
24 Ga0070689_100056419 3300005340 Bacteria 3045
25 Ga0070689_100065108 3300005340 Bacteria 2838
26 Ga0070691_10005633 3300005341 Bacteria 5706
27 Ga0070687_100005734 3300005343 Bacteria 5039
28 Ga0070661_100050120 3300005344 Bacteria 3055
29 Ga0070661_100101051 3300005344 Bacteria 2145
30 Ga0070692_10002446 3300005345 Bacteria 7213
31 Ga0070692_10058446 3300005345 Bacteria 2025
32 Ga0070668_100011757 3300005347 Bacteria 6518
33 Ga0070675_100005835 3300005354 Bacteria 9430
34 Ga0070671_100002212 3300005355 Bacteria 15019
35 Ga0070671_100089380 3300005355 Bacteria 2579
36 Ga0070673_100908437 3300005364 Bacteria 817
37 Ga0070688_100091260 3300005365 Bacteria 1990
38 Ga0070659_100039165 3300005366 Bacteria 3699
39 Ga0070667_100342516 3300005367 Bacteria 1352
40 Ga0070709_10050272 3300005434 Bacteria 2611
41 Ga0070709_10145195 3300005434 Bacteria 1634
42 Ga0070709_10821633 3300005434 Bacteria 731
43 Ga0070714_100062094 3300005435 Bacteria 3211
44 Ga0070713_100001480 3300005436 Bacteria 14974
45 Ga0070713_100895068 3300005436 Bacteria 853
46 Ga0070710_10009130 3300005437 Bacteria 4848
47 Ga0070710_10105434 3300005437 Bacteria 1685
48 Ga0070710_10344629 3300005437 Bacteria 985
49 Ga0070701_10068936 3300005438 Bacteria 1885
50 Ga0070701_10112118 3300005438 Bacteria 1525
51 Ga0070711_100030904 3300005439 Bacteria 3550
52 Ga0070705_100024691 3300005440 Bacteria 3248
53 Ga0070705_100071486 3300005440 Bacteria 2099
54 Ga0070705_100105433 3300005440 Bacteria 1790
55 Ga0070700_100198343 3300005441 Bacteria 1408
56 Ga0070700_100301661 3300005441 Bacteria 1169
57 Ga0070694_100046715 3300005444 Bacteria 2908
58 Ga0070694_100211481 3300005444 Bacteria 1451
59 Ga0070708_100120157 3300005445 Bacteria 2423
60 Ga0070708_100278337 3300005445 Bacteria 1575
61 Ga0070708_100405356 3300005445 Bacteria 1286
62 Ga0070708_100475849 3300005445 Bacteria 1178
63 Ga0070708_100539011 3300005445 Unclassified 1101
64 Ga0070663_100006626 3300005455 Bacteria 6982
65 Ga0070678_100001440 3300005456 Bacteria 12678
66 Ga0070678_100008130 3300005456 Bacteria 6267
67 Ga0070678_100140394 3300005456 Bacteria 1932
68 Ga0070662_100005090 3300005457 Bacteria 8374
69 Ga0070681_10480988 3300005458 Bacteria 1154
70 Ga0070681_10523595 3300005458 Bacteria 1099
71 Ga0068867_100002296 3300005459 Bacteria 13445
72 Ga0070685_10008151 3300005466 Bacteria 5369
73 Ga0070685_10032550 3300005466 Bacteria 2921
74 Ga0070706_100000065 3300005467 Bacteria 125557
75 Ga0070706_100006302 3300005467 Bacteria 11210
76 Ga0070706_100066105 3300005467 Bacteria 3345
77 Ga0070706_100092842 3300005467 Bacteria 2800
78 Ga0070707_100000131 3300005468 Bacteria 70101
79 Ga0070707_100003323 3300005468 Bacteria 15188
80 Ga0070707_100008114 3300005468 Bacteria 9740
81 Ga0070707_100024321 3300005468 Bacteria 5736
82 Ga0070707_100131426 3300005468 Bacteria 2434
83 Ga0070707_100242857 3300005468 Bacteria 1753
84 Ga0070707_100428993 3300005468 Bacteria 1282
85 Ga0070707_100622588 3300005468 Bacteria 1042
86 Ga0070698_100000457 3300005471 Bacteria 43263
87 Ga0070698_100000503 3300005471 Bacteria 41519
88 Ga0070698_100026040 3300005471 Bacteria 6092
89 Ga0070698_100030759 3300005471 Bacteria 5566
90 Ga0070698_100203811 3300005471 Bacteria 1913
91 Ga0070698_100329694 3300005471 Bacteria 1457
92 Ga0070699_100000758 3300005518 Bacteria 29797
93 Ga0070699_100012018 3300005518 Bacteria 7474
94 Ga0070699_100021897 3300005518 Bacteria 5508
95 Ga0070699_100071335 3300005518 Bacteria 3021
96 Ga0070699_100096932 3300005518 Bacteria 2583
97 Ga0070699_100196842 3300005518 Bacteria 1791
98 Ga0070699_100233946 3300005518 Bacteria 1639
99 Ga0070699_100339894 3300005518 Bacteria 1351
100 Ga0070679_100028110 3300005530 Bacteria 5542
101 Ga0070684_100003076 3300005535 Bacteria 12452
102 Ga0070684_100488959 3300005535 Bacteria 1139
103 Ga0070684_101057851 3300005535 Bacteria 762
104 Ga0070697_100009116 3300005536 Bacteria 7751
105 Ga0070697_100164640 3300005536 Bacteria 1875
106 Ga0070697_100238156 3300005536 Bacteria 1553
107 Ga0070697_100375430 3300005536 Bacteria 1231
108 Ga0068853_100136108 3300005539 Bacteria 2202
109 Ga0068853_100562788 3300005539 Bacteria 1081
110 Ga0070672_100051493 3300005543 Bacteria 3211
111 Ga0070672_100345727 3300005543 Bacteria 1267
112 Ga0070686_100000541 3300005544 Bacteria 22572
113 Ga0070695_100011574 3300005545 Bacteria 5278
114 Ga0070695_100065136 3300005545 Bacteria 2372
115 Ga0070695_100106767 3300005545 Bacteria 1894
116 Ga0070696_100002148 3300005546 Bacteria 12975
117 Ga0070696_100080603 3300005546 Bacteria 2305
118 Ga0070696_100166306 3300005546 Unclassified 1628
119 Ga0070696_100464609 3300005546 Bacteria 1001
120 Ga0070693_100005315 3300005547 Bacteria 6172
121 Ga0070693_100249090 3300005547 Bacteria 1177
122 Ga0070665_100009491 3300005548 Bacteria 9842
123 Ga0070665_100608723 3300005548 Bacteria 1105
124 Ga0070704_100052427 3300005549 Bacteria 2878
125 Ga0070704_100073129 3300005549 Bacteria 2496
126 Ga0070704_100103505 3300005549 Bacteria 2151
127 Ga0068855_100028546 3300005563 Bacteria 6675
128 Ga0068855_100030312 3300005563 Bacteria 6470
129 Ga0068855_100539765 3300005563 Bacteria 1263
130 Ga0068855_100680326 3300005563 Bacteria 1103
131 Ga0070664_100542920 3300005564 Bacteria 1074
132 Ga0068857_100001706 3300005577 Bacteria 17670
133 Ga0068857_100711963 3300005577 Bacteria 954
134 Ga0068854_100277699 3300005578 Bacteria 1347
135 Ga0068856_100002949 3300005614 Bacteria 17441
136 Ga0068856_100019295 3300005614 Bacteria 6618
137 Ga0068856_100056231 3300005614 Bacteria 3882
138 Ga0068856_100380229 3300005614 Bacteria 1431
139 Ga0070702_100000382 3300005615 Bacteria 15658
140 Ga0070702_100004033 3300005615 Bacteria 6663
141 Ga0068852_100051841 3300005616 Bacteria 3524
142 Ga0068852_100056400 3300005616 Bacteria 3395
143 Ga0068852_101166921 3300005616 Unclassified 791
144 Ga0068859_100484160 3300005617 Bacteria 1333
145 Ga0068859_101003495 3300005617 Bacteria 917
146 Ga0068864_100006746 3300005618 Bacteria 9403
147 Ga0068864_100209066 3300005618 Bacteria 1796
148 Ga0068864_100361375 3300005618 Bacteria 1372
149 Ga0068866_10002211 3300005718 Bacteria 8080
150 Ga0068861_100008038 3300005719 Bacteria 7259
151 Ga0068861_100042333 3300005719 Bacteria 3413
152 Ga0068861_100120082 3300005719 Bacteria 2119
153 Ga0068851_10048040 3300005834 Bacteria 2163
154 Ga0068870_10000205 3300005840 Bacteria 21167
155 Ga0068863_100035875 3300005841 Bacteria 4722
156 Ga0068863_100174280 3300005841 Bacteria 2064
157 Ga0068858_100578215 3300005842 Bacteria 1089
158 Ga0068860_100015607 3300005843 Bacteria 7418
159 Ga0068860_100080871 3300005843 Bacteria 3090
160 Ga0068860_100647358 3300005843 Bacteria 1064
161 Ga0068862_100054129 3300005844 Bacteria 3436
162 Ga0081455_10001937 3300005937 Bacteria 24871
163 Ga0081455_10007927 3300005937 Bacteria 11112
164 Ga0081455_10023020 3300005937 Bacteria 5807
165 Ga0081455_10027319 3300005937 Bacteria 5230
166 Ga0081455_10534450 3300005937 Bacteria 779
167 Ga0081538_10006131 3300005981 Bacteria 10668
168 Ga0081538_10016642 3300005981 Bacteria 5625
169 Ga0081538_10036742 3300005981 Bacteria 3190
170 Ga0081538_10058845 3300005981 Bacteria 2225
171 Ga0081540_1089031 3300005983 Bacteria 1363
172 Ga0081539_10000409 3300005985 Bacteria 91550
173 Ga0081539_10011230 3300005985 Bacteria 7122
174 Ga0070717_10039636 3300006028 Bacteria 3834
175 Ga0070717_10080248 3300006028 Bacteria 2737
176 Ga0070717_10307536 3300006028 Bacteria 1410
177 Ga0070717_10356165 3300006028 Bacteria 1309
178 Ga0070717_10523614 3300006028 Bacteria 1073
179 Ga0075432_10005834 3300006058 Bacteria 4190
180 Ga0075432_10006844 3300006058 Bacteria 3884
181 Ga0075432_10019965 3300006058 Bacteria 2292
182 Ga0075432_10046682 3300006058 Bacteria 1521
183 Ga0070716_100014134 3300006173 Bacteria 4084
184 Ga0070716_100096027 3300006173 Bacteria 1806
185 Ga0070716_100283573 3300006173 Bacteria 1144
186 Ga0070716_100534585 3300006173 Bacteria 871
187 Ga0070712_100005736 3300006175 Bacteria 7679
188 Ga0070712_100866426 3300006175 Bacteria 777
189 Ga0097621_100044929 3300006237 Bacteria 3566
190 Ga0097621_100673223 3300006237 Bacteria 951
191 Ga0068871_100371258 3300006358 Bacteria 1269
192 Ga0075428_100047490 3300006844 Bacteria 4716
193 Ga0075428_100080857 3300006844 Bacteria 3547
194 Ga0075428_100654984 3300006844 Bacteria 1120
195 Ga0075428_101182236 3300006844 Bacteria 806
196 Ga0075430_100391474 3300006846 Bacteria 1147
197 Ga0075431_100004110 3300006847 Bacteria 14214
198 Ga0075431_100162565 3300006847 Bacteria 2295
199 Ga0075431_100198408 3300006847 Bacteria 2054
200 Ga0075433_10002396 3300006852 Bacteria 14261
201 Ga0075433_10042872 3300006852 Bacteria 3927
202 Ga0075433_10144164 3300006852 Bacteria 2117
203 Ga0075433_10324913 3300006852 Bacteria 1361
204 Ga0075433_10459580 3300006852 Bacteria 1122
205 Ga0075434_100010463 3300006871 Bacteria 8698
206 Ga0075434_100092515 3300006871 Bacteria 3027
207 Ga0075434_100113934 3300006871 Bacteria 2716
208 Ga0075434_100228877 3300006871 Bacteria 1878
209 Ga0075434_100416616 3300006871 Bacteria 1364
210 Ga0075434_100449101 3300006871 Bacteria 1310
211 Ga0075429_100242417 3300006880 Bacteria 1579
212 Ga0068865_100000372 3300006881 Bacteria 24843
213 Ga0075436_100067131 3300006914 Bacteria 2479
214 Ga0075436_100098847 3300006914 Bacteria 2031
215 Ga0075436_100234205 3300006914 Bacteria 1305
216 Ga0075436_100496273 3300006914 Bacteria 893
217 Ga0097620_100484111 3300006931 Bacteria 1333
218 Ga0097620_101003361 3300006931 Bacteria 917
219 Ga0075435_100001480 3300007076 Bacteria 15092
220 Ga0075435_100022943 3300007076 Bacteria 4818
221 Ga0075435_100172070 3300007076 Bacteria 1827
222 Ga0075435_100178253 3300007076 Bacteria 1795
223 Ga0075435_100520787 3300007076 Bacteria 1029
224 Ga0105240_11038394 3300009093 Bacteria 875
225 Ga0111539_10000950 3300009094 Bacteria 37974
226 Ga0111539_10020930 3300009094 Bacteria 8054
227 Ga0111539_10067800 3300009094 Bacteria 4213
228 Ga0105245_10003696 3300009098 Bacteria 13653
229 Ga0105245_10010965 3300009098 Bacteria 7886
230 Ga0105245_10013986 3300009098 Bacteria 6989
231 Ga0105245_10072043 3300009098 Bacteria 3139
232 Ga0105245_10088962 3300009098 Bacteria 2837
233 Ga0105247_10010220 3300009101 Bacteria 5679
234 Ga0114129_10041874 3300009147 Bacteria 6449
235 Ga0114129_10069564 3300009147 Bacteria 4907
236 Ga0114129_10133650 3300009147 Bacteria 3406
237 Ga0114129_10345416 3300009147 Bacteria 1972
238 Ga0114129_10570683 3300009147 Bacteria 1469
239 Ga0105243_10000793 3300009148 Bacteria 30289
240 Ga0105243_10208169 3300009148 Bacteria 1720
241 Ga0105243_11064821 3300009148 Bacteria 815
242 Ga0105241_10028278 3300009174 Bacteria 4178
243 Ga0105241_10068929 3300009174 Bacteria 2742
244 Ga0105242_10008195 3300009176 Bacteria 8029
245 Ga0105242_10324106 3300009176 Bacteria 1414
246 Ga0105242_10707678 3300009176 Bacteria 986
247 Ga0105248_10048963 3300009177 Bacteria 4740
248 Ga0105248_10139157 3300009177 Bacteria 2738
249 Ga0105248_10532112 3300009177 Bacteria 1325
250 Ga0105248_11324139 3300009177 Bacteria 815
251 Ga0105237_10082301 3300009545 Bacteria 3210
252 Ga0105238_10070609 3300009551 Bacteria 3491
253 Ga0105238_10090098 3300009551 Bacteria 3054
254 Ga0105238_10800676 3300009551 Bacteria 958
255 Ga0105249_10001946 3300009553 Bacteria 17925
256 Ga0105249_10025423 3300009553 Bacteria 5331
257 Ga0105239_10002279 3300010375 Bacteria 24494
258 Ga0105239_10063676 3300010375 Bacteria 4049
259 Ga0105239_10266060 3300010375 Bacteria 1928
260 Ga0105239_10268144 3300010375 Bacteria 1920
261 Ga0105239_11170340 3300010375 Bacteria 886
262 Ga0105246_10009444 3300011119 Bacteria 6010
263 Ga0157373_10108843 3300013100 Bacteria 1949
264 Ga0157371_10021950 3300013102 Bacteria 4685
265 Ga0157371_10139754 3300013102 Bacteria 1725
266 Ga0157370_10075643 3300013104 Bacteria 3174
267 Ga0157369_10147677 3300013105 Bacteria 2485
268 Ga0157374_10573924 3300013296 Bacteria 1137
269 Ga0157378_10004177 3300013297 Bacteria 12749
270 Ga0157378_10636324 3300013297 Bacteria 1081
271 Ga0163162_10017450 3300013306 Bacteria 7023
272 Ga0163162_10248705 3300013306 Bacteria 1910
273 Ga0157372_10347315 3300013307 Bacteria 1728
274 Ga0157375_10025598 3300013308 Bacteria 5486
275 Ga0157375_10357089 3300013308 Bacteria 1627
276 Ga0157375_11120480 3300013308 Bacteria 922
277 Ga0163163_10062366 3300014325 Bacteria 3694
278 Ga0157380_10045294 3300014326 Unclassified 3451
279 Ga0182008_10073794 3300014497 Bacteria 1678
280 Ga0157377_10004325 3300014745 Bacteria 6522
281 Ga0157379_10030327 3300014968 Bacteria 4813
282 Ga0157379_10866115 3300014968 Bacteria 855
283 Ga0163161_10125838 3300017792 Bacteria 1930
284 Ga0197907_11372322 3300020069 Bacteria 1352
285 Ga0206355_1456876 3300020076 Bacteria 820
286 Ga0206350_10218199 3300020080 Bacteria 1099
287 Ga0213875_10000644 3300021388 Bacteria 27796
288 Ga0207656_10062722 3300025321 Bacteria 1634
289 Ga0207653_10014749 3300025885 Bacteria 2453
290 Ga0207692_10005823 3300025898 Bacteria 4967
291 Ga0207692_10136226 3300025898 Bacteria 1392
292 Ga0207642_10216728 3300025899 Unclassified 1067
293 Ga0207710_10040870 3300025900 Bacteria 2056
294 Ga0207710_10177513 3300025900 Bacteria 1044
295 Ga0207688_10193623 3300025901 Bacteria 1217
296 Ga0207680_10146962 3300025903 Bacteria 1568
297 Ga0207680_10272807 3300025903 Bacteria 1173
298 Ga0207647_10160735 3300025904 Bacteria 1310
299 Ga0207699_10151533 3300025906 Bacteria 1535
300 Ga0207699_10477774 3300025906 Bacteria 897
301 Ga0207699_10622902 3300025906 Bacteria 787
302 Ga0207643_10000027 3300025908 Bacteria 99423
303 Ga0207705_10056214 3300025909 Bacteria 2837
304 Ga0207705_10465155 3300025909 Bacteria 981
305 Ga0207684_10000071 3300025910 Bacteria 185783
306 Ga0207684_10018854 3300025910 Bacteria 5902
307 Ga0207684_10038969 3300025910 Bacteria 4032
308 Ga0207684_10051955 3300025910 Bacteria 3477
309 Ga0207684_10238217 3300025910 Bacteria 1570
310 Ga0207654_10035180 3300025911 Bacteria 2789
311 Ga0207707_10404181 3300025912 Bacteria 1172
312 Ga0207671_10185819 3300025914 Bacteria 1619
313 Ga0207693_10004357 3300025915 Bacteria 11970
314 Ga0207693_10009922 3300025915 Bacteria 7741
315 Ga0207693_10030056 3300025915 Bacteria 4289
316 Ga0207663_10005856 3300025916 Bacteria 6234
317 Ga0207663_10062908 3300025916 Bacteria 2361
318 Ga0207660_10080347 3300025917 Bacteria 2394
319 Ga0207660_10281095 3300025917 Bacteria 1321
320 Ga0207660_10807580 3300025917 Bacteria 765
321 Ga0207662_10080352 3300025918 Bacteria 1989
322 Ga0207657_10017530 3300025919 Bacteria 6862
323 Ga0207657_10109231 3300025919 Bacteria 2286
324 Ga0207649_10003298 3300025920 Bacteria 8835
325 Ga0207652_10492747 3300025921 Bacteria 1103
326 Ga0207646_10000135 3300025922 Bacteria 100459
327 Ga0207646_10000809 3300025922 Bacteria 40727
328 Ga0207646_10003386 3300025922 Bacteria 18036
329 Ga0207646_10015155 3300025922 Bacteria 7293
330 Ga0207646_10033131 3300025922 Bacteria 4675
331 Ga0207646_10180699 3300025922 Bacteria 1905
332 Ga0207646_10316659 3300025922 Bacteria 1410
333 Ga0207646_10536978 3300025922 Bacteria 1052
334 Ga0207646_10890752 3300025922 Bacteria 790
335 Ga0207694_10175535 3300025924 Bacteria 1736
336 Ga0207650_10001414 3300025925 Bacteria 17301
337 Ga0207650_10004873 3300025925 Bacteria 9170
338 Ga0207659_10018351 3300025926 Bacteria 4586
339 Ga0207687_10025966 3300025927 Bacteria 3921
340 Ga0207687_10108393 3300025927 Bacteria 2056
341 Ga0207687_10396027 3300025927 Bacteria 1135
342 Ga0207687_10456279 3300025927 Unclassified 1061
343 Ga0207700_10000022 3300025928 Bacteria 166246
344 Ga0207700_10337043 3300025928 Bacteria 1310
345 Ga0207664_10202591 3300025929 Bacteria 1714
346 Ga0207644_10050042 3300025931 Bacteria 2994
347 Ga0207644_10348164 3300025931 Bacteria 1202
348 Ga0207690_10016743 3300025932 Bacteria 4467
349 Ga0207706_10006899 3300025933 Bacteria 10501
350 Ga0207706_10400723 3300025933 Unclassified 1190
351 Ga0207686_10001561 3300025934 Bacteria 12935
352 Ga0207709_10059247 3300025935 Bacteria 2383
353 Ga0207709_10454498 3300025935 Bacteria 991
354 Ga0207670_10034204 3300025936 Bacteria 3282
355 Ga0207670_10075831 3300025936 Bacteria 2339
356 Ga0207669_10005754 3300025937 Bacteria 5596
357 Ga0207704_10045753 3300025938 Bacteria 2602
358 Ga0207665_10023234 3300025939 Bacteria 4084
359 Ga0207665_10025500 3300025939 Bacteria 3901
360 Ga0207665_10039123 3300025939 Bacteria 3161
361 Ga0207665_10288231 3300025939 Bacteria 1224
362 Ga0207665_10368727 3300025939 Bacteria 1087
363 Ga0207691_10027054 3300025940 Bacteria 5382
364 Ga0207691_10210400 3300025940 Bacteria 1689
365 Ga0207711_10104176 3300025941 Bacteria 2513
366 Ga0207711_10121079 3300025941 Bacteria 2336
367 Ga0207689_10004346 3300025942 Bacteria 12911
368 Ga0207689_10185610 3300025942 Bacteria 1715
369 Ga0207661_10007251 3300025944 Bacteria 7885
370 Ga0207661_10012002 3300025944 Bacteria 6294
371 Ga0207679_10009014 3300025945 Bacteria 6377
372 Ga0207679_10238083 3300025945 Bacteria 1541
373 Ga0207667_10026785 3300025949 Bacteria 6290
374 Ga0207667_10048066 3300025949 Bacteria 4513
375 Ga0207667_10079878 3300025949 Bacteria 3389
376 Ga0207651_10037039 3300025960 Bacteria 3192
377 Ga0207712_10001816 3300025961 Bacteria 14094
378 Ga0207712_10028018 3300025961 Bacteria 3766
379 Ga0207712_10069569 3300025961 Bacteria 2526
380 Ga0207668_10026778 3300025972 Bacteria 3749
381 Ga0207668_10119724 3300025972 Bacteria 1991
382 Ga0207640_10439098 3300025981 Unclassified 1073
383 Ga0207677_10056352 3300026023 Bacteria 2692
384 Ga0207677_10098097 3300026023 Bacteria 2149
385 Ga0207677_10103401 3300026023 Bacteria 2103
386 Ga0207639_10189311 3300026041 Bacteria 1756
387 Ga0207639_10375577 3300026041 Bacteria 1275
388 Ga0207678_10000662 3300026067 Bacteria 31648
389 Ga0207678_10190476 3300026067 Bacteria 1752
390 Ga0207708_10000064 3300026075 Bacteria 85366
391 Ga0207708_10067211 3300026075 Bacteria 2742
392 Ga0207708_11147233 3300026075 Bacteria 678
393 Ga0207702_10001188 3300026078 Bacteria 26420
394 Ga0207702_10017568 3300026078 Bacteria 5917
395 Ga0207702_10029148 3300026078 Bacteria 4591
396 Ga0207641_10042523 3300026088 Bacteria 3812
397 Ga0207641_11180233 3300026088 Bacteria 765
398 Ga0207648_10000958 3300026089 Bacteria 32650
399 Ga0207676_10011868 3300026095 Bacteria 6234
400 Ga0207676_10607485 3300026095 Bacteria 1051
401 Ga0207674_10000635 3300026116 Bacteria 45675
402 Ga0207674_10519485 3300026116 Bacteria 1150
403 Ga0207675_100001404 3300026118 Bacteria 24092
404 Ga0207675_100052074 3300026118 Bacteria 3820
405 Ga0207675_100108792 3300026118 Bacteria 2615
406 Ga0207683_10000450 3300026121 Bacteria 38100
407 Ga0207683_10002218 3300026121 Bacteria 17085
408 Ga0207683_10102966 3300026121 Bacteria 2550
409 Ga0207698_10025400 3300026142 Bacteria 4173
410 Ga0207698_10040256 3300026142 Bacteria 3470
411 Ga0207698_10392594 3300026142 Bacteria 1323
412 Ga0207428_10002503 3300027907 Bacteria 18349
413 Ga0207428_10008066 3300027907 Bacteria 9552
414 Ga0207428_10060400 3300027907 Bacteria 3004
415 Ga0268266_10058894 3300028379 Bacteria 3308
416 Ga0268266_10172245 3300028379 Bacteria 1965
417 Ga0268264_10465615 3300028381 Bacteria 1227
418 Ga0265318_10009493 3300028577 Bacteria 4277
419 Ga0265338_10084802 3300028800 Bacteria 2643
420 Ga0265330_10032824 3300031235 Bacteria 2325
421 Ga0265339_10124878 3300031249 Bacteria 1320
422 Ga0307408_100448359 3300031548 Bacteria 1119
423 Ga0307405_10022832 3300031731 Bacteria 3545
424 Ga0307413_10090252 3300031824 Bacteria 1993
425 Ga0307413_10215175 3300031824 Unclassified 1399
426 Ga0307410_10474995 3300031852 Bacteria 1024
427 Ga0307406_10088080 3300031901 Bacteria 2082
428 Ga0307406_10120693 3300031901 Bacteria 1822
429 Ga0307407_10051733 3300031903 Bacteria 2356
430 Ga0307412_10117851 3300031911 Bacteria 1907
431 Ga0307409_100007151 3300031995 Bacteria 6649
432 Ga0307409_100400028 3300031995 Bacteria 1311
433 Ga0307416_100014303 3300032002 Bacteria 5431
434 Ga0307416_100134222 3300032002 Bacteria 2235
435 Ga0307416_100152402 3300032002 Bacteria 2122
436 Ga0307414_10511737 3300032004 Bacteria 1064
437 Ga0307411_10063622 3300032005 Bacteria 2466
438 Ga0307411_10959630 3300032005 Unclassified 763
439 Ga0307415_100000170 3300032126 Bacteria 28895
440 Ga0307415_100013125 3300032126 Bacteria 4823
441 Ga0307415_100104075 3300032126 Bacteria 2090
442 Ga0373938_0059829 3300034957 Bacteria 889
443 Ga0373928_0036437 3300035084 Bacteria 1112
444 Ga0373929_0067172 3300035085 Bacteria 851
445 Ga0373934_0238799 3300035086 Bacteria 750
446 Ga0373940_0086842 3300035088 Bacteria 932
447 Ga0373951_0003761 3300035091 Bacteria 3655
448 Ga0373932_0010164 3300035112 Bacteria 2274
449 Ga0373941_0123104 3300035115 Bacteria 926
450 Ga0373960_0010730 3300035121 Bacteria 2244
451 Ga0373955_0078567 3300035172 Bacteria 1860
452 Ga0373942_0036650 3300035207 Bacteria 1322
453 Ga0373961_0020468 3300035241 Bacteria 1751
454 Ga0373924_0110572 3300035410 Bacteria 1187
455 Ga0373931_0012082 3300035691 Bacteria 4180
456 Ga0373947_0021867 3300035725 Bacteria 3706
457 Ga0373947_0027005 3300035725 Bacteria 3359
458 Ga0373937_0005583 3300036401 Bacteria 10792
459 Ga0373937_0146342 3300036401 Bacteria 2212
460 Ga0373937_0238891 3300036401 Bacteria 1711
461 Ga0395899_0020763 3300037312 Bacteria 4980
462 Ga0395899_0034039 3300037312 Bacteria 3825
463 Ga0395899_0076330 3300037312 Bacteria 2446
464 Ga0395899_0093511 3300037312 Bacteria 2176
465 Ga0395899_0149051 3300037312 Bacteria 1659
466 Ga0395899_0156979 3300037312 Bacteria 1609
467 Ga0395899_0173326 3300037312 Bacteria 1518
468 Ga0395899_0182299 3300037312 Bacteria 1473
469 Ga0395899_0200472 3300037312 Bacteria 1392
470 Ga0395899_0202099 3300037312 Bacteria 1385
471 Ga0395900_0001588 3300037418 Bacteria 26879
472 Ga0395900_0024584 3300037418 Bacteria 6168
473 Ga0395900_0040000 3300037418 Bacteria 4832
474 Ga0395900_0053577 3300037418 Bacteria 4152
475 Ga0395900_0076324 3300037418 Bacteria 3444
476 Ga0395900_0093085 3300037418 Bacteria 3096
477 Ga0395900_0105035 3300037418 Bacteria 2902
478 Ga0395900_0130263 3300037418 Bacteria 2578
479 Ga0395900_0154442 3300037418 Bacteria 2344
480 Ga0395900_0378781 3300037418 Bacteria 1383
481 Ga0395900_0978391 3300037418 Bacteria 767
482 Ga0395898_0001845 3300037466 Bacteria 27238
483 Ga0395898_0046606 3300037466 Bacteria 4258
484 Ga0395898_0049301 3300037466 Bacteria 4126
485 Ga0395898_0105884 3300037466 Bacteria 2697
486 Ga0395898_0118250 3300037466 Bacteria 2539
487 Ga0395898_0175463 3300037466 Bacteria 2048
488 Ga0395898_0191259 3300037466 Bacteria 1955
489 Ga0395898_0196032 3300037466 Bacteria 1929
490 Ga0395898_0401017 3300037466 Bacteria 1308
491 Ga0395898_0537557 3300037466 Bacteria 1110
492 Ga0395898_0540746 3300037466 Bacteria 1107
493 Ga0395905_0001761 3300037471 Bacteria 25226
494 Ga0395905_0003142 3300037471 Bacteria 17794
495 Ga0395905_0004600 3300037471 Bacteria 14275
496 Ga0395905_0017743 3300037471 Bacteria 6758
497 Ga0395905_0074199 3300037471 Bacteria 3188
498 Ga0395905_0139218 3300037471 Bacteria 2283
499 Ga0395905_0170827 3300037471 Bacteria 2042
500 Ga0395905_0203318 3300037471 Bacteria 1857
501 Ga0395905_0283583 3300037471 Bacteria 1543
502 Ga0395905_0389631 3300037471 Bacteria 1288
503 Ga0436364_0330965 3300037853 Bacteria 247749
504 Ga0395901_0000944 3300038443 Bacteria 31637
505 Ga0395901_0001597 3300038443 Bacteria 23455
506 Ga0395901_0001828 3300038443 Bacteria 21979
507 Ga0395901_0002386 3300038443 Bacteria 19104
508 Ga0395901_0007239 3300038443 Bacteria 11192
509 Ga0395901_0010987 3300038443 Bacteria 9175
510 Ga0395901_0020676 3300038443 Bacteria 6737
511 Ga0395901_0026394 3300038443 Bacteria 5963
512 Ga0395901_0150318 3300038443 Bacteria 2447
513 Ga0395901_0170858 3300038443 Bacteria 2281
514 Ga0395901_0184487 3300038443 Bacteria 2188
515 Ga0395901_0194422 3300038443 Bacteria 2127
516 Ga0395901_0205304 3300038443 Bacteria 2064
517 Ga0395901_0686070 3300038443 Bacteria 1023
518 Ga0436365_1817076 3300039437 Bacteria 2629
519 Ga0436362_0152248 3300039453 Bacteria 1171
520 Ga0451800_0109780 3300041459 Bacteria 1186
521 Ga0451853_2979489 3300041512 Bacteria 796
522 Ga0439448_0002961 3300042005 Bacteria 4659
523 Ga0439448_0014467 3300042005 Bacteria 2380
524 Ga0439455_0036609 3300042012 Bacteria 1242
525 Ga0439463_034037 3300042016 Bacteria 1289
526 Ga0450905_013829 3300042142 Bacteria 1146
527 Ga0439459_0000765 3300042438 Bacteria 4420
528 Ga0439459_0009350 3300042438 Bacteria 1694
529 Ga0439464_0002766 3300042439 Bacteria 4353
530 Ga0450916_013031 3300042530 Bacteria 1068
531 Ga0466963_0114373 3300044694 Bacteria 1854
532 Ga0495592_0030952 3300046454 Bacteria 4047
533 Ga0495592_0059128 3300046454 Bacteria 2824
534 Ga0495603_0004890 3300046455 Bacteria 8013
535 Ga0495641_0200192 3300046461 Bacteria 895
536 Ga0495651_0003810 3300046462 Bacteria 11535
537 Ga0495653_0151295 3300046463 Bacteria 1621
538 Ga0495653_0155180 3300046463 Bacteria 1595
539 Ga0495580_0154744 3300046472 Bacteria 1588
540 Ga0495582_0056238 3300046473 Unclassified 2168
541 Ga0495582_0275920 3300046473 Bacteria 965
542 Ga0495639_0133001 3300046475 Bacteria 1192
543 Ga0495662_0056754 3300046476 Bacteria 1891
544 Ga0495584_0053086 3300046491 Bacteria 2040
545 Ga0495585_0175912 3300046492 Unclassified 1103
546 Ga0495596_0081266 3300046500 Bacteria 1258
547 Ga0495596_0090933 3300046500 Bacteria 1185
548 Ga0495607_0234524 3300046501 Bacteria 891
549 Ga0495608_0351777 3300046511 Bacteria 907
550 Ga0495608_0413445 3300046511 Bacteria 824
551 Ga0495628_0412550 3300046516 Bacteria 985
552 Ga0495630_0003481 3300046517 Bacteria 10940
553 Ga0495644_0013612 3300046523 Bacteria 3120
554 Ga0495663_0018550 3300046525 Bacteria 1982
555 Ga0495666_0138915 3300046526 Bacteria 1133
556 Ga0495642_0086189 3300046528 Bacteria 1326
557 Ga0495642_0088507 3300046528 Bacteria 1309
558 Ga0495652_0004743 3300046529 Bacteria 12943
559 Ga0495652_0070688 3300046529 Bacteria 2916
560 Ga0495652_0331336 3300046529 Bacteria 1097
561 Ga0495640_0004494 3300046533 Bacteria 11122
562 Ga0495587_0210582 3300046536 Bacteria 1098
563 Ga0495598_0135787 3300046537 Bacteria 847
564 Ga0495645_0149136 3300046543 Bacteria 1626
565 Ga0495645_0462889 3300046543 Bacteria 798
566 Ga0495667_0029407 3300046559 Bacteria 3699
567 Ga0495667_0363708 3300046559 Bacteria 913
568 Ga0495656_0172728 3300046615 Bacteria 1058
569 Ga0495668_0052050 3300046616 Bacteria 2267
570 Ga0495611_0204309 3300046648 Bacteria 921
571 Ga0495659_0070461 3300046664 Unclassified 1309
572 Ga0495657_0153751 3300046675 Bacteria 1427
573 Ga0495599_0087043 3300046678 Bacteria 1951
574 Ga0495647_0025564 3300046681 Bacteria 2158
575 Ga0495613_0183097 3300046689 Bacteria 1483
576 Ga0495589_0184908 3300046794 Bacteria 987
577 Ga0495600_0228145 3300046809 Bacteria 1190
578 Ga0495581_0000916 3300047315 Bacteria 15822
579 Ga0495581_0074233 3300047315 Bacteria 1968
580 Ga0495674_0004625 3300047319 Bacteria 13231
581 Ga0495676_0005289 3300047321 Bacteria 11817
582 Ga0495680_0004191 3300047322 Bacteria 13847
583 Ga0495684_0025968 3300047471 Bacteria 4502
584 Ga0496100_0025178 3300048903 Bacteria 3637
585 Ga0496100_0032251 3300048903 Bacteria 3264
586 Ga0496100_0056169 3300048903 Bacteria 2575
587 Ga0496100_0289890 3300048903 Bacteria 1223
588 Ga0496100_0795837 3300048903 Bacteria 741
589 Ga0496101_0017284 3300048904 Bacteria 4891
590 Ga0496101_0019616 3300048904 Bacteria 4618
591 Ga0496101_0328773 3300048904 Bacteria 1200
592 Ga0496101_0542711 3300048904 Bacteria 919
593 Ga0496102_0002877 3300048905 Bacteria 14610
594 Ga0496102_0008114 3300048905 Bacteria 8985
595 Ga0496102_0035194 3300048905 Bacteria 4506
596 Ga0496102_0175758 3300048905 Bacteria 2016
597 Ga0496102_0725283 3300048905 Bacteria 917
598 Ga0496102_0772702 3300048905 Bacteria 883
599 Ga0496103_0001171 3300048906 Bacteria 18044
600 Ga0496103_0031484 3300048906 Bacteria 3232
601 Ga0496104_0001170 3300048907 Bacteria 22501
602 Ga0496104_0018488 3300048907 Bacteria 6358
603 Ga0496104_0022974 3300048907 Bacteria 5731
604 Ga0496104_0061095 3300048907 Bacteria 3571
605 Ga0496104_0309997 3300048907 Bacteria 1491
606 Ga0496104_0525379 3300048907 Bacteria 1094
607 Ga0496105_0006599 3300048908 Bacteria 8934
608 Ga0496105_0076637 3300048908 Bacteria 2761
609 Ga0496106_0003883 3300048909 Bacteria 11150
610 Ga0496106_0008317 3300048909 Bacteria 7678
611 Ga0496106_0075471 3300048909 Bacteria 2582
612 Ga0496106_0301556 3300048909 Bacteria 1285
613 Ga0496107_0002222 3300048910 Bacteria 12485
614 Ga0496107_0022541 3300048910 Bacteria 4450
615 Ga0496107_0056926 3300048910 Bacteria 2826
616 Ga0496107_0634418 3300048910 Bacteria 788
617 Ga0496108_0002125 3300048911 Bacteria 15875
618 Ga0496108_0003219 3300048911 Bacteria 13130
619 Ga0496108_0006937 3300048911 Bacteria 9169
620 Ga0496108_0014703 3300048911 Bacteria 6388
621 Ga0496108_0029825 3300048911 Bacteria 4520
622 Ga0496108_0360393 3300048911 Unclassified 1269
623 Ga0496109_0001268 3300048912 Bacteria 20981
624 Ga0496109_0001362 3300048912 Bacteria 20254
625 Ga0496109_0090273 3300048912 Bacteria 2833
626 Ga0496110_0002646 3300048913 Bacteria 13499
627 Ga0496110_0022246 3300048913 Bacteria 5380
628 Ga0496110_0022752 3300048913 Bacteria 5326
629 Ga0496110_0023256 3300048913 Bacteria 5269
630 Ga0496110_0050221 3300048913 Bacteria 3662
631 Ga0496110_0067361 3300048913 Bacteria 3168
632 Ga0496110_0092570 3300048913 Bacteria 2705
633 Ga0496110_0709967 3300048913 Bacteria 907
634 Ga0496111_0001346 3300048914 Bacteria 13880
635 Ga0496111_0003756 3300048914 Bacteria 9453
636 Ga0496111_0016048 3300048914 Bacteria 5154
637 Ga0496111_0035010 3300048914 Bacteria 3587
638 Ga0496112_0000677 3300048915 Bacteria 23790
639 Ga0496112_0003338 3300048915 Bacteria 13246
640 Ga0496112_0043873 3300048915 Bacteria 4378
641 Ga0496112_0097269 3300048915 Bacteria 2914
642 Ga0496112_0338194 3300048915 Bacteria 1449
643 Ga0496112_0451589 3300048915 Bacteria 1223
644 Ga0496113_0000374 3300048916 Bacteria 21591
645 Ga0496113_0044877 3300048916 Bacteria 3275
646 Ga0496113_0339056 3300048916 Bacteria 1205
647 Ga0496113_0850830 3300048916 Bacteria 723
648 Ga0496114_0007583 3300048917 Bacteria 8580
649 Ga0496114_0027132 3300048917 Bacteria 4690
650 Ga0496114_0219079 3300048917 Bacteria 1670
651 Ga0496114_0355510 3300048917 Bacteria 1296
652 Ga0496114_0480196 3300048917 Bacteria 1100
653 Ga0496114_0614747 3300048917 Bacteria 958
654 Ga0496115_0003228 3300048918 Bacteria 11702
655 Ga0496115_0053859 3300048918 Bacteria 3230
656 Ga0496115_0070465 3300048918 Bacteria 2834
657 Ga0496115_0199172 3300048918 Bacteria 1654
658 Ga0501033_0531236 3300049570 Bacteria 812
659 Ga0501038_0181048 3300049574 Bacteria 1700
660 Ga0501040_0218672 3300049576 Bacteria 1355
661 Ga0501041_0047479 3300049577 Bacteria 2614
662 Ga0501067_0008277 3300049583 Bacteria 5775
663 Ga0501069_0013951 3300049585 Bacteria 4291
664 Ga0501070_0086193 3300049586 Bacteria 2600
665 Ga0501071_0375810 3300049587 Bacteria 1083
666 Ga0501076_0047063 3300049592 Bacteria 3409
667 Ga0501077_0211244 3300049593 Bacteria 1233
668 Ga0501077_0367920 3300049593 Bacteria 918
669 Ga0501079_0355104 3300049741 Bacteria 1149
670 Ga0501080_0200308 3300049742 Bacteria 1833
671 Ga0501035_0168065 3300049822 Bacteria 1896
672 Ga0501045_0274963 3300049824 Bacteria 1254
673 nmdc:mga05p37_199377_c1 3300050507 Bacteria 2425
674 nmdc:mga05p37_237163_c1 3300050507 Bacteria 2195
675 nmdc:mga05p37_244585_c1 3300050507 Bacteria 2155
676 nmdc:mga05p37_35575_c1 3300050507 Bacteria 6107
677 nmdc:mga05p37_68914_c1 3300050507 Bacteria 4350
678 nmdc:mga05p37_75325_c1 3300050507 Bacteria 4154
679 nmdc:mga06r32_5438_c1 3300050510 Bacteria 11467
680 nmdc:mga06r32_584315_c1 3300050510 Bacteria 1089
681 nmdc:mga06r32_874901_c1 3300050510 Bacteria 856
682 nmdc:mga08y16_43806_c1 3300050511 Bacteria 4690
683 nmdc:mga08y16_44640_c1 3300050511 Bacteria 4644
684 nmdc:mga08y16_66007_c1 3300050511 Bacteria 3777
685 nmdc:mga0n895_290407_c1 3300050512 Bacteria 1658
686 nmdc:mga0n895_349906_c1 3300050512 Bacteria 1497
687 nmdc:mga0n895_40782_c1 3300050512 Bacteria 4511
688 nmdc:mga0n895_4819_c1 3300050512 Bacteria 11169
689 nmdc:mga0n895_59897_c1 3300050512 Bacteria 3757
690 nmdc:mga0n895_671294_c1 3300050512 Bacteria 1034
691 nmdc:mga0n895_85291_c1 3300050512 Bacteria 3153
692 nmdc:mga0rr50_20862_c1 3300050513 Bacteria 4461
693 nmdc:mga0rr50_23401_c1 3300050513 Bacteria 4260
694 nmdc:mga0rr50_257295_c1 3300050513 Bacteria 1452
695 nmdc:mga0rr50_468122_c1 3300050513 Bacteria 1070
696 nmdc:mga0rr50_80442_c1 3300050513 Bacteria 2512
697 nmdc:mga08x19_31888_c1 3300050514 Bacteria 3319
698 nmdc:mga08x19_332557_c1 3300050514 Bacteria 1059
699 nmdc:mga08x19_5782_c1 3300050514 Bacteria 7309
700 nmdc:mga0a205_14964_c1 3300050515 Bacteria 7240
701 nmdc:mga0a205_19434_c1 3300050515 Bacteria 6404
702 nmdc:mga0a205_267466_c1 3300050515 Bacteria 1587
703 nmdc:mga0a205_302354_c1 3300050515 Bacteria 1473
704 nmdc:mga0a205_90836_c1 3300050515 Bacteria 2951
705 Ga0501084_0023000 3300054114 Bacteria 5203
706 Ga0501082_0060417 3300060353 Bacteria 3264
707 Ga0530510_0059294 3300061734 Bacteria 2768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10890752 Ga0207646_108907522 164
2 3300028577 Ga0265318_10009493 Ga0265318_100094935 164
3 3300028800 Ga0265338_10084802 Ga0265338_100848022 164
4 3300031235 Ga0265330_10032824 Ga0265330_100328242 164
5 3300048905 Ga0496102_0725283 Ga0496102_0725283_289_903 164
6 3300005546 Ga0070696_100166306 Ga0070696_1001663062 166
7 3300049574 Ga0501038_0181048 Ga0501038_0181048_414_1046 171
8 3300049576 Ga0501040_0218672 Ga0501040_0218672_538_1170 171
9 3300049577 Ga0501041_0047479 Ga0501041_0047479_830_1462 171
10 3300049587 Ga0501071_0375810 Ga0501071_0375810_46_678 171
11 3300049592 Ga0501076_0047063 Ga0501076_0047063_2204_2836 171
12 3300049593 Ga0501077_0211244 Ga0501077_0211244_472_1104 171
13 3300049741 Ga0501079_0355104 Ga0501079_0355104_462_1094 171
14 3300049822 Ga0501035_0168065 Ga0501035_0168065_1157_1789 171
15 3300049824 Ga0501045_0274963 Ga0501045_0274963_295_927 171
16 3300054114 Ga0501084_0023000 Ga0501084_0023000_4080_4712 171
17 3300060353 Ga0501082_0060417 Ga0501082_0060417_953_1585 171
18 3300048913 Ga0496110_0067361 Ga0496110_0067361_1180_1827 174
19 3300014497 Ga0182008_10073794 Ga0182008_100737942 182
20 3300005364 Ga0070673_100908437 Ga0070673_1009084371 183
21 3300005434 Ga0070709_10050272 Ga0070709_100502723 183
22 3300005436 Ga0070713_100895068 Ga0070713_1008950681 183
23 3300005437 Ga0070710_10344629 Ga0070710_103446292 183
24 3300005440 Ga0070705_100105433 Ga0070705_1001054333 183
25 3300005441 Ga0070700_100301661 Ga0070700_1003016611 183
26 3300005444 Ga0070694_100211481 Ga0070694_1002114811 183
27 3300005445 Ga0070708_100278337 Ga0070708_1002783372 183
28 3300005456 Ga0070678_100140394 Ga0070678_1001403942 183
29 3300005468 Ga0070707_100622588 Ga0070707_1006225883 183
30 3300005518 Ga0070699_100233946 Ga0070699_1002339463 183
31 3300005536 Ga0070697_100375430 Ga0070697_1003754302 183
32 3300005545 Ga0070695_100011574 Ga0070695_1000115744 183
33 3300005546 Ga0070696_100002148 Ga0070696_1000021483 183
34 3300005547 Ga0070693_100249090 Ga0070693_1002490901 183
35 3300005549 Ga0070704_100103505 Ga0070704_1001035053 183
36 3300006175 Ga0070712_100005736 Ga0070712_1000057364 183
37 3300009147 Ga0114129_10345416 Ga0114129_103454162 183
38 3300009148 Ga0105243_10208169 Ga0105243_102081691 183
39 3300009174 Ga0105241_10068929 Ga0105241_100689292 183
40 3300009176 Ga0105242_10324106 Ga0105242_103241063 183
41 3300010375 Ga0105239_10268144 Ga0105239_102681441 183
42 3300013297 Ga0157378_10636324 Ga0157378_106363241 183
43 3300013308 Ga0157375_11120480 Ga0157375_111204802 183
44 3300025885 Ga0207653_10014749 Ga0207653_100147491 183
45 3300025915 Ga0207693_10004357 Ga0207693_1000435712 183
46 3300025916 Ga0207663_10062908 Ga0207663_100629081 183
47 3300025917 Ga0207660_10807580 Ga0207660_108075801 183
48 3300025935 Ga0207709_10454498 Ga0207709_104544981 183
49 3300025939 Ga0207665_10025500 Ga0207665_100255003 183
50 3300026075 Ga0207708_11147233 Ga0207708_111472331 183
51 3300026121 Ga0207683_10102966 Ga0207683_101029663 183
52 3300034957 Ga0373938_0059829 Ga0373938_0059829_76_705 183
53 3300035084 Ga0373928_0036437 Ga0373928_0036437_426_1055 183
54 3300035085 Ga0373929_0067172 Ga0373929_0067172_92_721 183
55 3300035088 Ga0373940_0086842 Ga0373940_0086842_174_803 183
56 3300035091 Ga0373951_0003761 Ga0373951_0003761_1448_2077 183
57 3300035112 Ga0373932_0010164 Ga0373932_0010164_1499_2128 183
58 3300035115 Ga0373941_0123104 Ga0373941_0123104_283_912 183
59 3300035207 Ga0373942_0036650 Ga0373942_0036650_680_1309 183
60 3300035691 Ga0373931_0012082 Ga0373931_0012082_965_1594 183
61 3300048903 Ga0496100_0032251 Ga0496100_0032251_960_1589 183
62 3300048905 Ga0496102_0002877 Ga0496102_0002877_12913_13542 183
63 3300048907 Ga0496104_0018488 Ga0496104_0018488_4625_5254 183
64 3300048908 Ga0496105_0076637 Ga0496105_0076637_861_1490 183
65 3300048910 Ga0496107_0002222 Ga0496107_0002222_572_1201 183
66 3300048911 Ga0496108_0003219 Ga0496108_0003219_1190_1819 183
67 3300048913 Ga0496110_0022246 Ga0496110_0022246_4641_5270 183
68 3300048914 Ga0496111_0035010 Ga0496111_0035010_1539_2168 183
69 3300048915 Ga0496112_0003338 Ga0496112_0003338_262_891 183
70 3300048916 Ga0496113_0339056 Ga0496113_0339056_293_922 183
71 3300048917 Ga0496114_0219079 Ga0496114_0219079_795_1424 183
72 3300048918 Ga0496115_0199172 Ga0496115_0199172_510_1139 183
73 3300050512 nmdc:mga0n895_349906_c1 nmdc:mga0n895_349906_c1_549_1178 183
74 3300050513 nmdc:mga0rr50_257295_c1 nmdc:mga0rr50_257295_c1_301_930 183
75 3300050514 nmdc:mga08x19_332557_c1 nmdc:mga08x19_332557_c1_330_959 183
76 3300050515 nmdc:mga0a205_302354_c1 nmdc:mga0a205_302354_c1_248_877 183
77 3300006852 Ga0075433_10042872 Ga0075433_100428725 184
78 3300006871 Ga0075434_100449101 Ga0075434_1004491012 184
79 3300006914 Ga0075436_100098847 Ga0075436_1000988472 184
80 3300025939 Ga0207665_10039123 Ga0207665_100391234 184
81 3300037471 Ga0395905_0389631 Ga0395905_0389631_245_865 184
82 3300038443 Ga0395901_0170858 Ga0395901_0170858_759_1379 184
83 3300039453 Ga0436362_0152248 Ga0436362_0152248_241_867 184
84 3300046501 Ga0495607_0234524 Ga0495607_0234524_228_878 184
85 3300046523 Ga0495644_0013612 Ga0495644_0013612_1912_2562 184
86 3300050507 nmdc:mga05p37_68914_c1 nmdc:mga05p37_68914_c1_2590_3219 184
87 3300031903 Ga0307407_10051733 Ga0307407_100517332 185
88 3300037418 Ga0395900_0040000 Ga0395900_0040000_1355_2005 185
89 3300037418 Ga0395900_0978391 Ga0395900_0978391_26_709 185
90 3300038443 Ga0395901_0010987 Ga0395901_0010987_5234_5884 185
91 3300005518 Ga0070699_100012018 Ga0070699_1000120184 187
92 3300005937 Ga0081455_10001937 Ga0081455_100019374 187
93 3300006058 Ga0075432_10019965 Ga0075432_100199652 187
94 3300006844 Ga0075428_100047490 Ga0075428_1000474906 187
95 3300006852 Ga0075433_10144164 Ga0075433_101441644 187
96 3300006871 Ga0075434_100416616 Ga0075434_1004166163 187
97 3300006914 Ga0075436_100067131 Ga0075436_1000671315 187
98 3300007076 Ga0075435_100178253 Ga0075435_1001782534 187
99 3300009094 Ga0111539_10000950 Ga0111539_100009502 187
100 3300009147 Ga0114129_10041874 Ga0114129_100418746 187
101 3300036401 Ga0373937_0238891 Ga0373937_0238891_357_1010 187
102 3300046454 Ga0495592_0059128 Ga0495592_0059128_628_1251 187
103 3300046516 Ga0495628_0412550 Ga0495628_0412550_261_914 187
104 3300046529 Ga0495652_0004743 Ga0495652_0004743_3018_3641 187
105 3300046543 Ga0495645_0149136 Ga0495645_0149136_341_964 187
106 3300050507 nmdc:mga05p37_75325_c1 nmdc:mga05p37_75325_c1_146_799 187
107 3300050512 nmdc:mga0n895_59897_c1 nmdc:mga0n895_59897_c1_19_672 187
108 3300050513 nmdc:mga0rr50_23401_c1 nmdc:mga0rr50_23401_c1_424_1077 187
109 3300050514 nmdc:mga08x19_31888_c1 nmdc:mga08x19_31888_c1_859_1512 187
110 3300050515 nmdc:mga0a205_90836_c1 nmdc:mga0a205_90836_c1_2153_2806 187
111 3300006847 Ga0075431_100198408 Ga0075431_1001984083 188
112 3300009094 Ga0111539_10067800 Ga0111539_100678005 188
113 3300009176 Ga0105242_10707678 Ga0105242_107076782 188
114 3300027907 Ga0207428_10060400 Ga0207428_100604005 188
115 3300035086 Ga0373934_0238799 Ga0373934_0238799_108_731 188
116 3300048903 Ga0496100_0289890 Ga0496100_0289890_397_1047 188
117 3300050511 nmdc:mga08y16_44640_c1 nmdc:mga08y16_44640_c1_2286_2921 188
118 3300036401 Ga0373937_0146342 Ga0373937_0146342_809_1465 189
119 3300046463 Ga0495653_0155180 Ga0495653_0155180_293_949 189
120 3300046511 Ga0495608_0413445 Ga0495608_0413445_21_677 189
121 3300046525 Ga0495663_0018550 Ga0495663_0018550_635_1285 189
122 3300046528 Ga0495642_0086189 Ga0495642_0086189_271_921 189
123 3300046536 Ga0495587_0210582 Ga0495587_0210582_238_894 189
124 3300046559 Ga0495667_0363708 Ga0495667_0363708_196_852 189
125 3300046675 Ga0495657_0153751 Ga0495657_0153751_451_1107 189
126 3300049742 Ga0501080_0200308 Ga0501080_0200308_553_1197 189
127 3300005328 Ga0070676_10515296 Ga0070676_105152961 190
128 3300005981 Ga0081538_10036742 Ga0081538_100367423 190
129 3300006844 Ga0075428_100080857 Ga0075428_1000808572 190
130 3300006846 Ga0075430_100391474 Ga0075430_1003914742 190
131 3300025906 Ga0207699_10151533 Ga0207699_101515333 190
132 3300025906 Ga0207699_10622902 Ga0207699_106229021 190
133 3300031249 Ga0265339_10124878 Ga0265339_101248782 190
134 3300031731 Ga0307405_10022832 Ga0307405_100228326 190
135 3300031824 Ga0307413_10215175 Ga0307413_102151752 190
136 3300031901 Ga0307406_10120693 Ga0307406_101206932 190
137 3300031911 Ga0307412_10117851 Ga0307412_101178513 190
138 3300031995 Ga0307409_100007151 Ga0307409_1000071517 190
139 3300032002 Ga0307416_100014303 Ga0307416_1000143036 190
140 3300032005 Ga0307411_10959630 Ga0307411_109596301 190
141 3300032126 Ga0307415_100000170 Ga0307415_10000017025 190
142 3300046455 Ga0495603_0004890 Ga0495603_0004890_882_1550 190
143 3300048910 Ga0496107_0634418 Ga0496107_0634418_87_716 190
144 3300003203 JGI25406J46586_10002793 JGI25406J46586_1000279310 191
145 3300005535 Ga0070684_101057851 Ga0070684_1010578511 191
146 3300005546 Ga0070696_100464609 Ga0070696_1004646091 191
147 3300005937 Ga0081455_10534450 Ga0081455_105344501 191
148 3300005981 Ga0081538_10006131 Ga0081538_1000613110 191
149 3300005985 Ga0081539_10000409 Ga0081539_1000040981 191
150 3300006844 Ga0075428_101182236 Ga0075428_1011822361 191
151 3300006852 Ga0075433_10459580 Ga0075433_104595802 191
152 3300007076 Ga0075435_100520787 Ga0075435_1005207872 191
153 3300037418 Ga0395900_0024584 Ga0395900_0024584_2448_3101 191
154 3300037466 Ga0395898_0001845 Ga0395898_0001845_2990_3643 191
155 3300037471 Ga0395905_0017743 Ga0395905_0017743_3121_3774 191
156 3300038443 Ga0395901_0000944 Ga0395901_0000944_8766_9419 191
157 3300046454 Ga0495592_0030952 Ga0495592_0030952_766_1416 191
158 3300048918 Ga0496115_0070465 Ga0496115_0070465_679_1329 191
159 3300050507 nmdc:mga05p37_199377_c1 nmdc:mga05p37_199377_c1_141_770 191
160 3300050515 nmdc:mga0a205_267466_c1 nmdc:mga0a205_267466_c1_104_733 191
161 3300005981 Ga0081538_10016642 Ga0081538_100166426 192
162 3300010375 Ga0105239_11170340 Ga0105239_111703401 192
163 3300005329 Ga0070683_100002243 Ga0070683_10000224311 193
164 3300005340 Ga0070689_100065108 Ga0070689_1000651082 193
165 3300005468 Ga0070707_100024321 Ga0070707_1000243214 193
166 3300005535 Ga0070684_100003076 Ga0070684_1000030764 193
167 3300005577 Ga0068857_100001706 Ga0068857_1000017067 193
168 3300005618 Ga0068864_100361375 Ga0068864_1003613752 193
169 3300005843 Ga0068860_100647358 Ga0068860_1006473582 193
170 3300005937 Ga0081455_10027319 Ga0081455_100273197 193
171 3300025922 Ga0207646_10033131 Ga0207646_100331314 193
172 3300025936 Ga0207670_10075831 Ga0207670_100758312 193
173 3300025944 Ga0207661_10007251 Ga0207661_100072515 193
174 3300025945 Ga0207679_10238083 Ga0207679_102380831 193
175 3300026067 Ga0207678_10190476 Ga0207678_101904762 193
176 3300026088 Ga0207641_11180233 Ga0207641_111802331 193
177 3300026095 Ga0207676_10607485 Ga0207676_106074852 193
178 3300026116 Ga0207674_10000635 Ga0207674_1000063537 193
179 3300028381 Ga0268264_10465615 Ga0268264_104656152 193
180 3300048916 Ga0496113_0850830 Ga0496113_0850830_37_669 193
181 3300049570 Ga0501033_0531236 Ga0501033_0531236_150_785 193
182 3300005445 Ga0070708_100120157 Ga0070708_1001201572 194
183 3300005467 Ga0070706_100006302 Ga0070706_1000063027 194
184 3300005468 Ga0070707_100131426 Ga0070707_1001314263 194
185 3300005471 Ga0070698_100203811 Ga0070698_1002038113 194
186 3300025910 Ga0207684_10051955 Ga0207684_100519553 194
187 3300025922 Ga0207646_10003386 Ga0207646_1000338618 194
188 3300035725 Ga0373947_0021867 Ga0373947_0021867_1070_1735 194
189 3300048904 Ga0496101_0542711 Ga0496101_0542711_97_750 194
190 3300006871 Ga0075434_100113934 Ga0075434_1001139341 195
191 3300006914 Ga0075436_100234205 Ga0075436_1002342052 195
192 3300025922 Ga0207646_10536978 Ga0207646_105369781 195
193 3300049583 Ga0501067_0008277 Ga0501067_0008277_4888_5535 195
194 3300049585 Ga0501069_0013951 Ga0501069_0013951_414_1061 195
195 3300049586 Ga0501070_0086193 Ga0501070_0086193_1924_2571 195
196 3300050512 nmdc:mga0n895_290407_c1 nmdc:mga0n895_290407_c1_816_1481 195
197 3300061734 Ga0530510_0059294 Ga0530510_0059294_2018_2665 195
198 3300005457 Ga0070662_100005090 Ga0070662_1000050903 196
199 3300005545 Ga0070695_100065136 Ga0070695_1000651363 196
200 3300005563 Ga0068855_100028546 Ga0068855_1000285469 196
201 3300005719 Ga0068861_100008038 Ga0068861_1000080389 196
202 3300009093 Ga0105240_11038394 Ga0105240_110383942 196
203 3300009098 Ga0105245_10013986 Ga0105245_100139863 196
204 3300009553 Ga0105249_10025423 Ga0105249_100254233 196
205 3300010375 Ga0105239_10266060 Ga0105239_102660602 196
206 3300013306 Ga0163162_10248705 Ga0163162_102487052 196
207 3300017792 Ga0163161_10125838 Ga0163161_101258381 196
208 3300025927 Ga0207687_10025966 Ga0207687_100259666 196
209 3300025933 Ga0207706_10006899 Ga0207706_100068996 196
210 3300025949 Ga0207667_10079878 Ga0207667_100798785 196
211 3300025961 Ga0207712_10028018 Ga0207712_100280185 196
212 3300025972 Ga0207668_10119724 Ga0207668_101197242 196
213 3300026118 Ga0207675_100001404 Ga0207675_10000140416 196
214 3300035410 Ga0373924_0110572 Ga0373924_0110572_112_759 196
215 3300036401 Ga0373937_0005583 Ga0373937_0005583_3374_4021 196
216 3300037312 Ga0395899_0034039 Ga0395899_0034039_882_1529 196
217 3300037418 Ga0395900_0130263 Ga0395900_0130263_124_771 196
218 3300037466 Ga0395898_0196032 Ga0395898_0196032_1110_1757 196
219 3300037471 Ga0395905_0203318 Ga0395905_0203318_464_1111 196
220 3300037471 Ga0395905_0283583 Ga0395905_0283583_145_792 196
221 3300038443 Ga0395901_0686070 Ga0395901_0686070_208_855 196
222 3300048905 Ga0496102_0772702 Ga0496102_0772702_110_814 196
223 3300050512 nmdc:mga0n895_671294_c1 nmdc:mga0n895_671294_c1_386_997 196
224 3300002077 JGI24744J21845_10005541 JGI24744J21845_100055413 197
225 3300005330 Ga0070690_100052433 Ga0070690_1000524333 197
226 3300005335 Ga0070666_10109394 Ga0070666_101093942 197
227 3300005336 Ga0070680_100090747 Ga0070680_1000907473 197
228 3300005337 Ga0070682_100003625 Ga0070682_1000036251 197
229 3300005339 Ga0070660_100008595 Ga0070660_1000085954 197
230 3300005340 Ga0070689_100056419 Ga0070689_1000564192 197
231 3300005343 Ga0070687_100005734 Ga0070687_1000057345 197
232 3300005345 Ga0070692_10058446 Ga0070692_100584462 197
233 3300005347 Ga0070668_100011757 Ga0070668_1000117578 197
234 3300005355 Ga0070671_100089380 Ga0070671_1000893803 197
235 3300005365 Ga0070688_100091260 Ga0070688_1000912603 197
236 3300005434 Ga0070709_10145195 Ga0070709_101451953 197
237 3300005437 Ga0070710_10009130 Ga0070710_100091306 197
238 3300005438 Ga0070701_10068936 Ga0070701_100689363 197
239 3300005439 Ga0070711_100030904 Ga0070711_1000309045 197
240 3300005440 Ga0070705_100024691 Ga0070705_1000246912 197
241 3300005444 Ga0070694_100046715 Ga0070694_1000467153 197
242 3300005445 Ga0070708_100475849 Ga0070708_1004758492 197
243 3300005456 Ga0070678_100001440 Ga0070678_1000014402 197
244 3300005458 Ga0070681_10523595 Ga0070681_105235952 197
245 3300005459 Ga0068867_100002296 Ga0068867_10000229617 197
246 3300005466 Ga0070685_10008151 Ga0070685_100081515 197
247 3300005467 Ga0070706_100066105 Ga0070706_1000661053 197
248 3300005518 Ga0070699_100339894 Ga0070699_1003398942 197
249 3300005536 Ga0070697_100164640 Ga0070697_1001646403 197
250 3300005539 Ga0068853_100136108 Ga0068853_1001361082 197
251 3300005543 Ga0070672_100051493 Ga0070672_1000514933 197
252 3300005544 Ga0070686_100000541 Ga0070686_1000005412 197
253 3300005545 Ga0070695_100106767 Ga0070695_1001067672 197
254 3300005546 Ga0070696_100080603 Ga0070696_1000806032 197
255 3300005548 Ga0070665_100009491 Ga0070665_1000094912 197
256 3300005549 Ga0070704_100073129 Ga0070704_1000731294 197
257 3300005614 Ga0068856_100002949 Ga0068856_10000294921 197
258 3300005614 Ga0068856_100380229 Ga0068856_1003802291 197
259 3300005615 Ga0070702_100004033 Ga0070702_1000040337 197
260 3300005616 Ga0068852_101166921 Ga0068852_1011669211 197
261 3300005617 Ga0068859_100484160 Ga0068859_1004841602 197
262 3300005718 Ga0068866_10002211 Ga0068866_100022112 197
263 3300005719 Ga0068861_100042333 Ga0068861_1000423332 197
264 3300005843 Ga0068860_100080871 Ga0068860_1000808714 197
265 3300005844 Ga0068862_100054129 Ga0068862_1000541292 197
266 3300005983 Ga0081540_1089031 Ga0081540_10890312 197
267 3300006237 Ga0097621_100044929 Ga0097621_1000449292 197
268 3300006358 Ga0068871_100371258 Ga0068871_1003712583 197
269 3300006881 Ga0068865_100000372 Ga0068865_10000037221 197
270 3300006931 Ga0097620_100484111 Ga0097620_1004841112 197
271 3300009098 Ga0105245_10003696 Ga0105245_1000369618 197
272 3300009101 Ga0105247_10010220 Ga0105247_100102201 197
273 3300009148 Ga0105243_10000793 Ga0105243_1000079331 197
274 3300009176 Ga0105242_10008195 Ga0105242_1000819512 197
275 3300009177 Ga0105248_10048963 Ga0105248_100489635 197
276 3300009545 Ga0105237_10082301 Ga0105237_100823014 197
277 3300009551 Ga0105238_10070609 Ga0105238_100706094 197
278 3300009553 Ga0105249_10001946 Ga0105249_100019467 197
279 3300010375 Ga0105239_10002279 Ga0105239_100022793 197
280 3300013102 Ga0157371_10139754 Ga0157371_101397543 197
281 3300013297 Ga0157378_10004177 Ga0157378_100041772 197
282 3300013306 Ga0163162_10017450 Ga0163162_100174504 197
283 3300014326 Ga0157380_10045294 Ga0157380_100452942 197
284 3300025898 Ga0207692_10005823 Ga0207692_100058237 197
285 3300025899 Ga0207642_10216728 Ga0207642_102167282 197
286 3300025900 Ga0207710_10040870 Ga0207710_100408702 197
287 3300025903 Ga0207680_10146962 Ga0207680_101469622 197
288 3300025915 Ga0207693_10009922 Ga0207693_100099227 197
289 3300025916 Ga0207663_10005856 Ga0207663_100058566 197
290 3300025917 Ga0207660_10080347 Ga0207660_100803473 197
291 3300025918 Ga0207662_10080352 Ga0207662_100803522 197
292 3300025919 Ga0207657_10017530 Ga0207657_100175304 197
293 3300025924 Ga0207694_10175535 Ga0207694_101755352 197
294 3300025927 Ga0207687_10456279 Ga0207687_104562792 197
295 3300025931 Ga0207644_10050042 Ga0207644_100500423 197
296 3300025933 Ga0207706_10400723 Ga0207706_104007232 197
297 3300025934 Ga0207686_10001561 Ga0207686_100015616 197
298 3300025935 Ga0207709_10059247 Ga0207709_100592473 197
299 3300025936 Ga0207670_10034204 Ga0207670_100342043 197
300 3300025937 Ga0207669_10005754 Ga0207669_100057543 197
301 3300025938 Ga0207704_10045753 Ga0207704_100457533 197
302 3300025940 Ga0207691_10027054 Ga0207691_100270544 197
303 3300025941 Ga0207711_10104176 Ga0207711_101041763 197
304 3300025961 Ga0207712_10001816 Ga0207712_100018163 197
305 3300025972 Ga0207668_10026778 Ga0207668_100267785 197
306 3300025981 Ga0207640_10439098 Ga0207640_104390982 197
307 3300026023 Ga0207677_10098097 Ga0207677_100980972 197
308 3300026041 Ga0207639_10189311 Ga0207639_101893112 197
309 3300026075 Ga0207708_10000064 Ga0207708_100000644 197
310 3300026078 Ga0207702_10017568 Ga0207702_100175686 197
311 3300026089 Ga0207648_10000958 Ga0207648_1000095832 197
312 3300026118 Ga0207675_100052074 Ga0207675_1000520742 197
313 3300026121 Ga0207683_10000450 Ga0207683_100004508 197
314 3300026142 Ga0207698_10392594 Ga0207698_103925942 197
315 3300028379 Ga0268266_10058894 Ga0268266_100588945 197
316 3300042142 Ga0450905_013829 Ga0450905_013829_402_1031 197
317 3300046491 Ga0495584_0053086 Ga0495584_0053086_1137_1799 197
318 3300046528 Ga0495642_0088507 Ga0495642_0088507_561_1223 197
319 3300046537 Ga0495598_0135787 Ga0495598_0135787_25_687 197
320 3300046616 Ga0495668_0052050 Ga0495668_0052050_304_966 197
321 3300046648 Ga0495611_0204309 Ga0495611_0204309_174_836 197
322 3300048903 Ga0496100_0025178 Ga0496100_0025178_2197_2853 197
323 3300048904 Ga0496101_0019616 Ga0496101_0019616_3701_4357 197
324 3300048905 Ga0496102_0008114 Ga0496102_0008114_736_1392 197
325 3300048906 Ga0496103_0001171 Ga0496103_0001171_1621_2277 197
326 3300048907 Ga0496104_0061095 Ga0496104_0061095_2696_3352 197
327 3300048909 Ga0496106_0003883 Ga0496106_0003883_10046_10702 197
328 3300048911 Ga0496108_0029825 Ga0496108_0029825_259_915 197
329 3300048917 Ga0496114_0027132 Ga0496114_0027132_745_1401 197
330 3300048918 Ga0496115_0003228 Ga0496115_0003228_1379_2035 197
331 3300037466 Ga0395898_0118250 Ga0395898_0118250_1121_1774 198
332 3300046473 Ga0495582_0275920 Ga0495582_0275920_288_926 198
333 3300047315 Ga0495581_0074233 Ga0495581_0074233_728_1366 198
334 3300005985 Ga0081539_10011230 Ga0081539_100112307 199
335 3300006058 Ga0075432_10005834 Ga0075432_100058345 199
336 3300006871 Ga0075434_100228877 Ga0075434_1002288773 199
337 3300006880 Ga0075429_100242417 Ga0075429_1002424172 199
338 3300007076 Ga0075435_100022943 Ga0075435_1000229432 199
339 3300009147 Ga0114129_10069564 Ga0114129_100695643 199
340 3300027907 Ga0207428_10008066 Ga0207428_100080664 199
341 3300037312 Ga0395899_0173326 Ga0395899_0173326_333_986 199
342 3300037471 Ga0395905_0074199 Ga0395905_0074199_1312_1965 199
343 3300038443 Ga0395901_0026394 Ga0395901_0026394_2262_2915 199
344 3300044694 Ga0466963_0114373 Ga0466963_0114373_195_827 199
345 3300050507 nmdc:mga05p37_35575_c1 nmdc:mga05p37_35575_c1_3261_3914 199
346 3300050511 nmdc:mga08y16_43806_c1 nmdc:mga08y16_43806_c1_3301_3954 199
347 3300050512 nmdc:mga0n895_4819_c1 nmdc:mga0n895_4819_c1_5000_5653 199
348 3300050513 nmdc:mga0rr50_20862_c1 nmdc:mga0rr50_20862_c1_3038_3691 199
349 3300050515 nmdc:mga0a205_14964_c1 nmdc:mga0a205_14964_c1_5973_6626 199
350 3300006028 Ga0070717_10307536 Ga0070717_103075361 200
351 3300032002 Ga0307416_100134222 Ga0307416_1001342222 200
352 3300032126 Ga0307415_100013125 Ga0307415_1000131254 200
353 3300025898 Ga0207692_10136226 Ga0207692_101362262 201
354 3300042530 Ga0450916_013031 Ga0450916_013031_179_808 201
355 3300046689 Ga0495613_0183097 Ga0495613_0183097_367_1023 201
356 3300005563 Ga0068855_100680326 Ga0068855_1006803261 202
357 3300005981 Ga0081538_10058845 Ga0081538_100588452 202
358 3300006175 Ga0070712_100866426 Ga0070712_1008664261 202
359 3300009551 Ga0105238_10800676 Ga0105238_108006761 202
360 3300014968 Ga0157379_10866115 Ga0157379_108661151 202
361 3300042005 Ga0439448_0002961 Ga0439448_0002961_58_708 202
362 3300042438 Ga0439459_0000765 Ga0439459_0000765_2530_3180 202
363 3300048907 Ga0496104_0525379 Ga0496104_0525379_269_928 202
364 3300048917 Ga0496114_0355510 Ga0496114_0355510_181_840 202
365 3300020076 Ga0206355_1456876 Ga0206355_14568762 203
366 3300032126 Ga0307415_100104075 Ga0307415_1001040751 203
367 3300037312 Ga0395899_0076330 Ga0395899_0076330_1212_1865 203
368 3300037466 Ga0395898_0401017 Ga0395898_0401017_144_776 203
369 3300037471 Ga0395905_0004600 Ga0395905_0004600_7850_8503 203
370 3300038443 Ga0395901_0007239 Ga0395901_0007239_3934_4587 203
371 3300042016 Ga0439463_034037 Ga0439463_034037_305_955 203
372 3300042439 Ga0439464_0002766 Ga0439464_0002766_852_1502 203
373 3300005468 Ga0070707_100428993 Ga0070707_1004289932 204
374 3300005471 Ga0070698_100329694 Ga0070698_1003296942 204
375 3300005518 Ga0070699_100196842 Ga0070699_1001968421 204
376 3300005536 Ga0070697_100238156 Ga0070697_1002381561 204
377 3300005937 Ga0081455_10023020 Ga0081455_100230206 204
378 3300006847 Ga0075431_100004110 Ga0075431_1000041108 204
379 3300046461 Ga0495641_0200192 Ga0495641_0200192_32_688 204
380 3300046472 Ga0495580_0154744 Ga0495580_0154744_32_688 204
381 3300046473 Ga0495582_0056238 Ga0495582_0056238_231_887 204
382 3300046492 Ga0495585_0175912 Ga0495585_0175912_339_995 204
383 3300046500 Ga0495596_0081266 Ga0495596_0081266_209_865 204
384 3300046615 Ga0495656_0172728 Ga0495656_0172728_107_763 204
385 3300046681 Ga0495647_0025564 Ga0495647_0025564_282_938 204
386 3300047315 Ga0495581_0000916 Ga0495581_0000916_10340_10996 204
387 3300047321 Ga0495676_0005289 Ga0495676_0005289_3419_4075 204
388 3300050510 nmdc:mga06r32_5438_c1 nmdc:mga06r32_5438_c1_4883_5533 204
389 3300005435 Ga0070714_100062094 Ga0070714_1000620944 205
390 3300005445 Ga0070708_100405356 Ga0070708_1004053563 205
391 3300005468 Ga0070707_100000131 Ga0070707_10000013174 205
392 3300005471 Ga0070698_100026040 Ga0070698_1000260406 205
393 3300005518 Ga0070699_100021897 Ga0070699_1000218976 205
394 3300005518 Ga0070699_100096932 Ga0070699_1000969324 205
395 3300006028 Ga0070717_10523614 Ga0070717_105236142 205
396 3300006173 Ga0070716_100096027 Ga0070716_1000960272 205
397 3300025910 Ga0207684_10018854 Ga0207684_100188548 205
398 3300025910 Ga0207684_10238217 Ga0207684_102382172 205
399 3300025922 Ga0207646_10000135 Ga0207646_1000013510 205
400 3300025922 Ga0207646_10316659 Ga0207646_103166592 205
401 3300025929 Ga0207664_10202591 Ga0207664_102025912 205
402 3300025939 Ga0207665_10288231 Ga0207665_102882312 205
403 3300025939 Ga0207665_10368727 Ga0207665_103687272 205
404 3300048913 Ga0496110_0709967 Ga0496110_0709967_263_886 205
405 3300005445 Ga0070708_100539011 Ga0070708_1005390112 206
406 3300005467 Ga0070706_100000065 Ga0070706_100000065101 206
407 3300005468 Ga0070707_100003323 Ga0070707_10000332310 206
408 3300005471 Ga0070698_100000457 Ga0070698_10000045718 206
409 3300005471 Ga0070698_100000503 Ga0070698_10000050333 206
410 3300005518 Ga0070699_100071335 Ga0070699_1000713351 206
411 3300006173 Ga0070716_100283573 Ga0070716_1002835732 206
412 3300025910 Ga0207684_10000071 Ga0207684_10000071166 206
413 3300025922 Ga0207646_10000809 Ga0207646_1000080925 206
414 3300037312 Ga0395899_0182299 Ga0395899_0182299_268_897 206
415 3300037418 Ga0395900_0154442 Ga0395900_0154442_883_1512 206
416 3300037466 Ga0395898_0537557 Ga0395898_0537557_32_661 206
417 3300037471 Ga0395905_0003142 Ga0395905_0003142_10205_10834 206
418 3300038443 Ga0395901_0001828 Ga0395901_0001828_10918_11547 206
419 3300039437 Ga0436365_1817076 Ga0436365_1817076_303_938 206
420 3300006173 Ga0070716_100014134 Ga0070716_1000141346 207
421 3300006852 Ga0075433_10324913 Ga0075433_103249132 207
422 3300025915 Ga0207693_10030056 Ga0207693_100300565 207
423 3300025922 Ga0207646_10180699 Ga0207646_101806992 207
424 3300025928 Ga0207700_10000022 Ga0207700_1000002292 207
425 3300025939 Ga0207665_10023234 Ga0207665_100232343 207
426 3300037312 Ga0395899_0093511 Ga0395899_0093511_622_1269 207
427 3300037312 Ga0395899_0200472 Ga0395899_0200472_411_1049 207
428 3300037418 Ga0395900_0001588 Ga0395900_0001588_25132_25779 207
429 3300037418 Ga0395900_0105035 Ga0395900_0105035_343_981 207
430 3300037466 Ga0395898_0105884 Ga0395898_0105884_206_853 207
431 3300037466 Ga0395898_0175463 Ga0395898_0175463_27_665 207
432 3300037471 Ga0395905_0001761 Ga0395905_0001761_21068_21715 207
433 3300038443 Ga0395901_0001597 Ga0395901_0001597_21452_22099 207
434 3300038443 Ga0395901_0184487 Ga0395901_0184487_370_1008 207
435 3300041459 Ga0451800_0109780 Ga0451800_0109780_162_794 207
436 3300048913 Ga0496110_0092570 Ga0496110_0092570_255_893 207
437 3300050513 nmdc:mga0rr50_80442_c1 nmdc:mga0rr50_80442_c1_1128_1775 207
438 3300005367 Ga0070667_100342516 Ga0070667_1003425161 208
439 3300005471 Ga0070698_100030759 Ga0070698_1000307592 208
440 3300005543 Ga0070672_100345727 Ga0070672_1003457272 208
441 3300005618 Ga0068864_100209066 Ga0068864_1002090662 208
442 3300006058 Ga0075432_10006844 Ga0075432_100068445 208
443 3300006871 Ga0075434_100092515 Ga0075434_1000925152 208
444 3300009098 Ga0105245_10072043 Ga0105245_100720432 208
445 3300009147 Ga0114129_10570683 Ga0114129_105706832 208
446 3300009177 Ga0105248_10532112 Ga0105248_105321122 208
447 3300013308 Ga0157375_10025598 Ga0157375_100255983 208
448 3300025940 Ga0207691_10210400 Ga0207691_102104003 208
449 3300025942 Ga0207689_10185610 Ga0207689_101856101 208
450 3300037312 Ga0395899_0156979 Ga0395899_0156979_302_952 208
451 3300037418 Ga0395900_0378781 Ga0395900_0378781_722_1372 208
452 3300037471 Ga0395905_0139218 Ga0395905_0139218_1233_1883 208
453 3300038443 Ga0395901_0205304 Ga0395901_0205304_430_1080 208
454 3300046462 Ga0495651_0003810 Ga0495651_0003810_7121_7771 208
455 3300046463 Ga0495653_0151295 Ga0495653_0151295_793_1443 208
456 3300046475 Ga0495639_0133001 Ga0495639_0133001_392_1042 208
457 3300046476 Ga0495662_0056754 Ga0495662_0056754_1067_1717 208
458 3300046511 Ga0495608_0351777 Ga0495608_0351777_40_690 208
459 3300046517 Ga0495630_0003481 Ga0495630_0003481_6233_6883 208
460 3300046526 Ga0495666_0138915 Ga0495666_0138915_325_975 208
461 3300046529 Ga0495652_0070688 Ga0495652_0070688_1152_1802 208
462 3300046529 Ga0495652_0331336 Ga0495652_0331336_296_946 208
463 3300046533 Ga0495640_0004494 Ga0495640_0004494_8307_8957 208
464 3300046543 Ga0495645_0462889 Ga0495645_0462889_15_665 208
465 3300046559 Ga0495667_0029407 Ga0495667_0029407_1666_2316 208
466 3300046664 Ga0495659_0070461 Ga0495659_0070461_459_1094 208
467 3300046678 Ga0495599_0087043 Ga0495599_0087043_1187_1837 208
468 3300046794 Ga0495589_0184908 Ga0495589_0184908_129_794 208
469 3300046809 Ga0495600_0228145 Ga0495600_0228145_322_972 208
470 3300047319 Ga0495674_0004625 Ga0495674_0004625_8623_9273 208
471 3300047322 Ga0495680_0004191 Ga0495680_0004191_8036_8686 208
472 3300047471 Ga0495684_0025968 Ga0495684_0025968_3118_3768 208
473 3300048907 Ga0496104_0309997 Ga0496104_0309997_273_938 208
474 3300048911 Ga0496108_0014703 Ga0496108_0014703_3415_4080 208
475 3300048911 Ga0496108_0360393 Ga0496108_0360393_303_953 208
476 3300048912 Ga0496109_0001268 Ga0496109_0001268_11943_12608 208
477 3300048913 Ga0496110_0023256 Ga0496110_0023256_4104_4769 208
478 3300048914 Ga0496111_0003756 Ga0496111_0003756_7103_7768 208
479 3300005719 Ga0068861_100120082 Ga0068861_1001200823 209
480 3300005937 Ga0081455_10007927 Ga0081455_100079278 209
481 3300006028 Ga0070717_10039636 Ga0070717_100396364 209
482 3300006847 Ga0075431_100162565 Ga0075431_1001625652 209
483 3300006914 Ga0075436_100496273 Ga0075436_1004962731 209
484 3300007076 Ga0075435_100172070 Ga0075435_1001720702 209
485 3300009098 Ga0105245_10088962 Ga0105245_100889624 209
486 3300009147 Ga0114129_10133650 Ga0114129_101336503 209
487 3300025927 Ga0207687_10108393 Ga0207687_101083933 209
488 3300025961 Ga0207712_10069569 Ga0207712_100695693 209
489 3300026023 Ga0207677_10103401 Ga0207677_101034013 209
490 3300026118 Ga0207675_100108792 Ga0207675_1001087924 209
491 3300031548 Ga0307408_100448359 Ga0307408_1004483592 209
492 3300031824 Ga0307413_10090252 Ga0307413_100902522 209
493 3300031852 Ga0307410_10474995 Ga0307410_104749951 209
494 3300031901 Ga0307406_10088080 Ga0307406_100880802 209
495 3300031995 Ga0307409_100400028 Ga0307409_1004000282 209
496 3300032002 Ga0307416_100152402 Ga0307416_1001524022 209
497 3300032004 Ga0307414_10511737 Ga0307414_105117372 209
498 3300032005 Ga0307411_10063622 Ga0307411_100636223 209
499 3300035241 Ga0373961_0020468 Ga0373961_0020468_172_825 209
500 3300037312 Ga0395899_0149051 Ga0395899_0149051_568_1221 209
501 3300037418 Ga0395900_0053577 Ga0395900_0053577_316_969 209
502 3300037418 Ga0395900_0093085 Ga0395900_0093085_1140_1793 209
503 3300037466 Ga0395898_0049301 Ga0395898_0049301_2606_3259 209
504 3300037466 Ga0395898_0191259 Ga0395898_0191259_20_649 209
505 3300037466 Ga0395898_0540746 Ga0395898_0540746_131_784 209
506 3300037471 Ga0395905_0170827 Ga0395905_0170827_493_1146 209
507 3300038443 Ga0395901_0002386 Ga0395901_0002386_13104_13733 209
508 3300038443 Ga0395901_0020676 Ga0395901_0020676_4551_5204 209
509 3300041512 Ga0451853_2979489 Ga0451853_2979489_77_730 209
510 3300042005 Ga0439448_0014467 Ga0439448_0014467_140_793 209
511 3300042012 Ga0439455_0036609 Ga0439455_0036609_364_1017 209
512 3300042438 Ga0439459_0009350 Ga0439459_0009350_338_991 209
513 3300046500 Ga0495596_0090933 Ga0495596_0090933_480_1121 209
514 3300050507 nmdc:mga05p37_237163_c1 nmdc:mga05p37_237163_c1_1183_1815 209
515 3300050510 nmdc:mga06r32_874901_c1 nmdc:mga06r32_874901_c1_19_660 209
516 3300050512 nmdc:mga0n895_85291_c1 nmdc:mga0n895_85291_c1_576_1229 209
517 3300005434 Ga0070709_10821633 Ga0070709_108216331 210
518 3300005436 Ga0070713_100001480 Ga0070713_10000148012 210
519 3300005437 Ga0070710_10105434 Ga0070710_101054341 210
520 3300005467 Ga0070706_100092842 Ga0070706_1000928422 210
521 3300005468 Ga0070707_100008114 Ga0070707_1000081149 210
522 3300005518 Ga0070699_100000758 Ga0070699_10000075829 210
523 3300005536 Ga0070697_100009116 Ga0070697_1000091165 210
524 3300005549 Ga0070704_100052427 Ga0070704_1000524273 210
525 3300005614 Ga0068856_100019295 Ga0068856_1000192953 210
526 3300005841 Ga0068863_100174280 Ga0068863_1001742803 210
527 3300006028 Ga0070717_10080248 Ga0070717_100802485 210
528 3300006028 Ga0070717_10356165 Ga0070717_103561652 210
529 3300006173 Ga0070716_100534585 Ga0070716_1005345852 210
530 3300009177 Ga0105248_11324139 Ga0105248_113241391 210
531 3300025906 Ga0207699_10477774 Ga0207699_104777741 210
532 3300025910 Ga0207684_10038969 Ga0207684_100389694 210
533 3300025922 Ga0207646_10015155 Ga0207646_100151555 210
534 3300025928 Ga0207700_10337043 Ga0207700_103370431 210
535 3300026078 Ga0207702_10029148 Ga0207702_100291484 210
536 3300035121 Ga0373960_0010730 Ga0373960_0010730_1385_2035 210
537 3300035172 Ga0373955_0078567 Ga0373955_0078567_90_722 210
538 3300035725 Ga0373947_0027005 Ga0373947_0027005_2656_3330 210
539 3300048903 Ga0496100_0795837 Ga0496100_0795837_81_731 210
540 3300048904 Ga0496101_0017284 Ga0496101_0017284_242_892 210
541 3300048904 Ga0496101_0328773 Ga0496101_0328773_361_999 210
542 3300048905 Ga0496102_0175758 Ga0496102_0175758_390_1040 210
543 3300048907 Ga0496104_0022974 Ga0496104_0022974_4676_5326 210
544 3300048909 Ga0496106_0075471 Ga0496106_0075471_66_716 210
545 3300048909 Ga0496106_0301556 Ga0496106_0301556_139_789 210
546 3300048910 Ga0496107_0056926 Ga0496107_0056926_319_969 210
547 3300048911 Ga0496108_0006937 Ga0496108_0006937_1438_2088 210
548 3300048912 Ga0496109_0001362 Ga0496109_0001362_3108_3758 210
549 3300048913 Ga0496110_0022752 Ga0496110_0022752_3627_4277 210
550 3300048913 Ga0496110_0050221 Ga0496110_0050221_1480_2130 210
551 3300048914 Ga0496111_0001346 Ga0496111_0001346_12451_13101 210
552 3300048915 Ga0496112_0000677 Ga0496112_0000677_22672_23322 210
553 3300048915 Ga0496112_0097269 Ga0496112_0097269_523_1173 210
554 3300048915 Ga0496112_0451589 Ga0496112_0451589_561_1193 210
555 3300048916 Ga0496113_0000374 Ga0496113_0000374_20148_20798 210
556 3300048917 Ga0496114_0007583 Ga0496114_0007583_6298_6948 210
557 3300048917 Ga0496114_0614747 Ga0496114_0614747_14_652 210
558 3300048918 Ga0496115_0053859 Ga0496115_0053859_2090_2740 210
559 3300005339 Ga0070660_100200978 Ga0070660_1002009783 211
560 3300005344 Ga0070661_100101051 Ga0070661_1001010512 211
561 3300005563 Ga0068855_100030312 Ga0068855_1000303127 211
562 3300005616 Ga0068852_100051841 Ga0068852_1000518411 211
563 3300025949 Ga0207667_10026785 Ga0207667_100267857 211
564 3300026142 Ga0207698_10040256 Ga0207698_100402561 211
565 3300037312 Ga0395899_0202099 Ga0395899_0202099_509_1144 211
566 3300038443 Ga0395901_0194422 Ga0395901_0194422_257_892 211
567 3300013102 Ga0157371_10021950 Ga0157371_100219502 212
568 3300025932 Ga0207690_10016743 Ga0207690_100167432 212
569 3300049593 Ga0501077_0367920 Ga0501077_0367920_35_679 212
570 3300005468 Ga0070707_100242857 Ga0070707_1002428572 214
571 3300021388 Ga0213875_10000644 Ga0213875_100006443 214
572 3300037853 Ga0436364_0330965 Ga0436364_0330965_73954_74598 214
573 3300048915 Ga0496112_0338194 Ga0496112_0338194_661_1317 214
574 3300006844 Ga0075428_100654984 Ga0075428_1006549841 215
575 3300037312 Ga0395899_0020763 Ga0395899_0020763_1814_2464 215
576 3300037418 Ga0395900_0076324 Ga0395900_0076324_144_794 215
577 3300037466 Ga0395898_0046606 Ga0395898_0046606_3503_4153 215
578 3300038443 Ga0395901_0150318 Ga0395901_0150318_375_1025 215
579 3300050507 nmdc:mga05p37_244585_c1 nmdc:mga05p37_244585_c1_664_1314 215
580 3300001979 JGI24740J21852_10074723 JGI24740J21852_100747232 216
581 3300002155 JGI24033J26618_1015790 JGI24033J26618_10157901 216
582 3300002459 JGI24751J29686_10036987 JGI24751J29686_100369872 216
583 3300005327 Ga0070658_10004588 Ga0070658_1000458810 216
584 3300005329 Ga0070683_100838581 Ga0070683_1008385811 216
585 3300005330 Ga0070690_100450003 Ga0070690_1004500032 216
586 3300005331 Ga0070670_100060122 Ga0070670_1000601224 216
587 3300005334 Ga0068869_100004228 Ga0068869_1000042284 216
588 3300005335 Ga0070666_10281271 Ga0070666_102812712 216
589 3300005336 Ga0070680_100003234 Ga0070680_1000032347 216
590 3300005337 Ga0070682_100002451 Ga0070682_1000024519 216
591 3300005338 Ga0068868_100005180 Ga0068868_1000051807 216
592 3300005339 Ga0070660_100092259 Ga0070660_1000922592 216
593 3300005341 Ga0070691_10005633 Ga0070691_100056336 216
594 3300005344 Ga0070661_100050120 Ga0070661_1000501204 216
595 3300005345 Ga0070692_10002446 Ga0070692_100024463 216
596 3300005354 Ga0070675_100005835 Ga0070675_1000058357 216
597 3300005355 Ga0070671_100002212 Ga0070671_1000022121 216
598 3300005366 Ga0070659_100039165 Ga0070659_1000391654 216
599 3300005438 Ga0070701_10112118 Ga0070701_101121182 216
600 3300005440 Ga0070705_100071486 Ga0070705_1000714862 216
601 3300005441 Ga0070700_100198343 Ga0070700_1001983431 216
602 3300005455 Ga0070663_100006626 Ga0070663_1000066266 216
603 3300005456 Ga0070678_100008130 Ga0070678_1000081302 216
604 3300005458 Ga0070681_10480988 Ga0070681_104809882 216
605 3300005466 Ga0070685_10032550 Ga0070685_100325502 216
606 3300005530 Ga0070679_100028110 Ga0070679_1000281106 216
607 3300005535 Ga0070684_100488959 Ga0070684_1004889592 216
608 3300005539 Ga0068853_100562788 Ga0068853_1005627882 216
609 3300005547 Ga0070693_100005315 Ga0070693_1000053154 216
610 3300005548 Ga0070665_100608723 Ga0070665_1006087232 216
611 3300005563 Ga0068855_100539765 Ga0068855_1005397652 216
612 3300005564 Ga0070664_100542920 Ga0070664_1005429202 216
613 3300005577 Ga0068857_100711963 Ga0068857_1007119631 216
614 3300005578 Ga0068854_100277699 Ga0068854_1002776992 216
615 3300005614 Ga0068856_100056231 Ga0068856_1000562314 216
616 3300005615 Ga0070702_100000382 Ga0070702_1000003821 216
617 3300005616 Ga0068852_100056400 Ga0068852_1000564002 216
618 3300005617 Ga0068859_101003495 Ga0068859_1010034952 216
619 3300005618 Ga0068864_100006746 Ga0068864_1000067468 216
620 3300005834 Ga0068851_10048040 Ga0068851_100480402 216
621 3300005840 Ga0068870_10000205 Ga0068870_100002052 216
622 3300005841 Ga0068863_100035875 Ga0068863_1000358755 216
623 3300005842 Ga0068858_100578215 Ga0068858_1005782152 216
624 3300005843 Ga0068860_100015607 Ga0068860_1000156072 216
625 3300006058 Ga0075432_10046682 Ga0075432_100466822 216
626 3300006237 Ga0097621_100673223 Ga0097621_1006732232 216
627 3300006852 Ga0075433_10002396 Ga0075433_100023969 216
628 3300006871 Ga0075434_100010463 Ga0075434_1000104638 216
629 3300006931 Ga0097620_101003361 Ga0097620_1010033612 216
630 3300007076 Ga0075435_100001480 Ga0075435_1000014802 216
631 3300009094 Ga0111539_10020930 Ga0111539_100209306 216
632 3300009098 Ga0105245_10010965 Ga0105245_100109659 216
633 3300009148 Ga0105243_11064821 Ga0105243_110648211 216
634 3300009174 Ga0105241_10028278 Ga0105241_100282784 216
635 3300009177 Ga0105248_10139157 Ga0105248_101391573 216
636 3300009551 Ga0105238_10090098 Ga0105238_100900983 216
637 3300010375 Ga0105239_10063676 Ga0105239_100636764 216
638 3300011119 Ga0105246_10009444 Ga0105246_100094444 216
639 3300013100 Ga0157373_10108843 Ga0157373_101088433 216
640 3300013104 Ga0157370_10075643 Ga0157370_100756432 216
641 3300013105 Ga0157369_10147677 Ga0157369_101476772 216
642 3300013296 Ga0157374_10573924 Ga0157374_105739241 216
643 3300013307 Ga0157372_10347315 Ga0157372_103473151 216
644 3300013308 Ga0157375_10357089 Ga0157375_103570892 216
645 3300014325 Ga0163163_10062366 Ga0163163_100623662 216
646 3300014745 Ga0157377_10004325 Ga0157377_100043259 216
647 3300014968 Ga0157379_10030327 Ga0157379_100303272 216
648 3300020069 Ga0197907_11372322 Ga0197907_113723222 216
649 3300020080 Ga0206350_10218199 Ga0206350_102181992 216
650 3300025321 Ga0207656_10062722 Ga0207656_100627222 216
651 3300025900 Ga0207710_10177513 Ga0207710_101775131 216
652 3300025901 Ga0207688_10193623 Ga0207688_101936232 216
653 3300025903 Ga0207680_10272807 Ga0207680_102728072 216
654 3300025904 Ga0207647_10160735 Ga0207647_101607352 216
655 3300025908 Ga0207643_10000027 Ga0207643_1000002718 216
656 3300025909 Ga0207705_10056214 Ga0207705_100562142 216
657 3300025909 Ga0207705_10465155 Ga0207705_104651552 216
658 3300025911 Ga0207654_10035180 Ga0207654_100351803 216
659 3300025912 Ga0207707_10404181 Ga0207707_104041811 216
660 3300025914 Ga0207671_10185819 Ga0207671_101858192 216
661 3300025917 Ga0207660_10281095 Ga0207660_102810952 216
662 3300025919 Ga0207657_10109231 Ga0207657_101092312 216
663 3300025920 Ga0207649_10003298 Ga0207649_100032982 216
664 3300025921 Ga0207652_10492747 Ga0207652_104927471 216
665 3300025925 Ga0207650_10001414 Ga0207650_100014144 216
666 3300025925 Ga0207650_10004873 Ga0207650_100048733 216
667 3300025926 Ga0207659_10018351 Ga0207659_100183514 216
668 3300025927 Ga0207687_10396027 Ga0207687_103960272 216
669 3300025931 Ga0207644_10348164 Ga0207644_103481642 216
670 3300025941 Ga0207711_10121079 Ga0207711_101210793 216
671 3300025942 Ga0207689_10004346 Ga0207689_100043462 216
672 3300025944 Ga0207661_10012002 Ga0207661_100120023 216
673 3300025945 Ga0207679_10009014 Ga0207679_100090148 216
674 3300025949 Ga0207667_10048066 Ga0207667_100480662 216
675 3300025960 Ga0207651_10037039 Ga0207651_100370394 216
676 3300026023 Ga0207677_10056352 Ga0207677_100563523 216
677 3300026041 Ga0207639_10375577 Ga0207639_103755772 216
678 3300026067 Ga0207678_10000662 Ga0207678_1000066236 216
679 3300026075 Ga0207708_10067211 Ga0207708_100672113 216
680 3300026078 Ga0207702_10001188 Ga0207702_100011888 216
681 3300026088 Ga0207641_10042523 Ga0207641_100425232 216
682 3300026095 Ga0207676_10011868 Ga0207676_100118688 216
683 3300026116 Ga0207674_10519485 Ga0207674_105194851 216
684 3300026121 Ga0207683_10002218 Ga0207683_1000221818 216
685 3300026142 Ga0207698_10025400 Ga0207698_100254005 216
686 3300027907 Ga0207428_10002503 Ga0207428_1000250311 216
687 3300028379 Ga0268266_10172245 Ga0268266_101722452 216
688 3300048903 Ga0496100_0056169 Ga0496100_0056169_1074_1724 216
689 3300048905 Ga0496102_0035194 Ga0496102_0035194_320_970 216
690 3300048906 Ga0496103_0031484 Ga0496103_0031484_94_744 216
691 3300048907 Ga0496104_0001170 Ga0496104_0001170_13097_13747 216
692 3300048908 Ga0496105_0006599 Ga0496105_0006599_4645_5295 216
693 3300048909 Ga0496106_0008317 Ga0496106_0008317_52_702 216
694 3300048910 Ga0496107_0022541 Ga0496107_0022541_1473_2123 216
695 3300048911 Ga0496108_0002125 Ga0496108_0002125_5824_6474 216
696 3300048912 Ga0496109_0090273 Ga0496109_0090273_238_888 216
697 3300048913 Ga0496110_0002646 Ga0496110_0002646_8071_8721 216
698 3300048914 Ga0496111_0016048 Ga0496111_0016048_2602_3252 216
699 3300048915 Ga0496112_0043873 Ga0496112_0043873_2318_2968 216
700 3300048916 Ga0496113_0044877 Ga0496113_0044877_308_958 216
701 3300048917 Ga0496114_0480196 Ga0496114_0480196_329_979 216
702 3300050510 nmdc:mga06r32_584315_c1 nmdc:mga06r32_584315_c1_66_716 216
703 3300050511 nmdc:mga08y16_66007_c1 nmdc:mga08y16_66007_c1_235_885 216
704 3300050512 nmdc:mga0n895_40782_c1 nmdc:mga0n895_40782_c1_388_1038 216
705 3300050513 nmdc:mga0rr50_468122_c1 nmdc:mga0rr50_468122_c1_369_1019 216
706 3300050514 nmdc:mga08x19_5782_c1 nmdc:mga08x19_5782_c1_1101_1751 216
707 3300050515 nmdc:mga0a205_19434_c1 nmdc:mga0a205_19434_c1_3826_4476 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14333

DUF4389

Domain of unknown function (DUF4389)

155

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e02-assembly1.cif.gz_A crystal structure of h369l mutant of yeast bleomycin hydrolase 0.2197 34 211
2e02-assembly1.cif.gz_A crystal structure of h369l mutant of yeast bleomycin hydrolase 0.1786 34 211
ID Description Score Start End Superfamily
af_Q9N3N3_187_497_3.30.559.70 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 0.3367 10 61 3.30.559.70
af_Q9N3N3_187_497_3.30.559.70 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 0.1163 10 61 3.30.559.70
ID Description Score Start End GO Terms
AF-A0A538L235-F1-model_v4 DUF4389 domain-containing protein 0.9895 148 216 GO:0016020
AF-A0A7K1CJJ6-F1-model_v4 DUF4389 domain-containing protein 0.9787 150 213 GO:0016020
AF-A0A661URQ6-F1-model_v4 DUF4389 domain-containing protein 0.9701 152 214 GO:0016020
AF-A0A538L235-F1-model_v4 DUF4389 domain-containing protein 0.962 148 216 GO:0016020
AF-A0A2W4MPZ9-F1-model_v4 DUF4389 domain-containing protein 0.9597 79 214 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.26 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map