F476513

General Info

Members Datasets Scaffolds Average Seq Length
706 490 1412 117

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_019124|Ga0500661_019124_687_1037
Length 104
Sequence MSDAVKPDRPDANLVLEYEFDAPPAKVWRAVTIPALRERWLPDCDLAGAEPESDSEPPYRESRVIFRIEPNVSGGTRFRIIQQACDVALPKPANSNCCLMRAAA

Samples

Sample ID Description Type Environment
1 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
57 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
58 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
59 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
134 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
159 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
160 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
161 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
170 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
292 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
293 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
294 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
295 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
312 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
313 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
316 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
317 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
324 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
325 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
328 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
329 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
330 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
331 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
332 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
333 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
334 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
335 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
336 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
337 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
338 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
339 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
340 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
341 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
342 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
343 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
344 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
345 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
346 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
347 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
348 2818991467 Bosea vestrisii 3192 Isolate Unclassified
349 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
350 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
351 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
352 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
353 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
354 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
355 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
356 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
357 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
358 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
359 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
360 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
361 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
362 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
363 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
364 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
365 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
366 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
367 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
368 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
369 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
370 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
371 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
372 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
373 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
374 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
375 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
376 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
377 2904699407
378 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
379 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
380 2906610324
381 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
382 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
383 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
384 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
385 2922368715
386 2922425934
387 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
388 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
389 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
390 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
391 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
392 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
393 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
394 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
395 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
396 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
397 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
398 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
399 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
400 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
401 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
402 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
403 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
404 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
405 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
406 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
407 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
408 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
409 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
410 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
411 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
412 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
413 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
414 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
415 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
416 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
417 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
418 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
419 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
420 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
421 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
422 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
423 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
424 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
425 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
426 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
427 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
428 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
429 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
430 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
431 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
432 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
433 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
434 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
435 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
436 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
437 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
438 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
439 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
440 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
441 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
442 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
443 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
444 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
445 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
446 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
447 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
448 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
449 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
450 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
451 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
452 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
453 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
454 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
455 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
456 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
457 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
458 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
459 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
460 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
461 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
462 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
463 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
464 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
465 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
466 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
467 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
468 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
469 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
470 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
471 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
472 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
473 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
474 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
475 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
476 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
477 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
478 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
479 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
480 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
481 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
482 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
483 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
484 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
485 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
486 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
487 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
488 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
489 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
490 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.49
Metatranscriptomes 0
Isolates 22.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17
Nodule 20.25
Rhizoplane 7.22
Rhizosphere 43.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500661_019124 3300055283 Bacteria 1219
2 JGI24737J22298_10127357 3300001990 Bacteria 752
3 JGI24738J21930_10034017 3300002075 Bacteria 1038
4 JGI25153J46596_10054512 3300003215 Bacteria 1125
5 JGI25153J46596_10119138 3300003215 Bacteria 597
6 JGI25160J50197_1001982 3300003354 Bacteria 9766
7 JGI25160J50197_1020872 3300003354 Bacteria 1963
8 Ga0055526_1042110 3300003771 Bacteria 1129
9 Ga0055531_10065814 3300003794 Bacteria 860
10 Ga0065165_1003369 3300005262 Bacteria 11333
11 Ga0065165_1010822 3300005262 Bacteria 3889
12 Ga0065165_1016221 3300005262 Bacteria 2799
13 Ga0070658_10272195 3300005327 Bacteria 1440
14 Ga0070683_101744749 3300005329 Bacteria 599
15 Ga0070670_100057786 3300005331 Bacteria 3329
16 Ga0068869_100164395 3300005334 Bacteria 1730
17 Ga0070666_10200584 3300005335 Bacteria 1404
18 Ga0070682_100214322 3300005337 Bacteria 1366
19 Ga0068868_100505847 3300005338 Bacteria 1059
20 Ga0070660_100026933 3300005339 Bacteria 4284
21 Ga0070661_100438596 3300005344 Bacteria 1038
22 Ga0070661_100795288 3300005344 Bacteria 776
23 Ga0070668_100289912 3300005347 Bacteria 1369
24 Ga0070669_100408286 3300005353 Bacteria 1112
25 Ga0070671_100067479 3300005355 Bacteria 2982
26 Ga0070674_100922707 3300005356 Bacteria 762
27 Ga0070659_100945470 3300005366 Bacteria 755
28 Ga0070667_100145617 3300005367 Bacteria 2077
29 Ga0070701_10563286 3300005438 Bacteria 749
30 Ga0070663_100094948 3300005455 Bacteria 2215
31 Ga0070663_100439308 3300005455 Bacteria 1073
32 Ga0070678_100321427 3300005456 Bacteria 1322
33 Ga0070662_100803674 3300005457 Bacteria 800
34 Ga0070685_10485835 3300005466 Bacteria 871
35 Ga0070672_100685077 3300005543 Bacteria 897
36 Ga0070665_100581555 3300005548 Bacteria 1133
37 Ga0068855_100707309 3300005563 Bacteria 1078
38 Ga0068855_101735591 3300005563 Bacteria 636
39 Ga0070664_100681638 3300005564 Bacteria 957
40 Ga0068857_100645494 3300005577 Bacteria 1003
41 Ga0068854_100875986 3300005578 Bacteria 788
42 Ga0068854_101633883 3300005578 Bacteria 588
43 Ga0068856_100240074 3300005614 Bacteria 1827
44 Ga0068856_100359463 3300005614 Bacteria 1475
45 Ga0070702_101541868 3300005615 Bacteria 548
46 Ga0068852_100108330 3300005616 Bacteria 2521
47 Ga0068852_100361225 3300005616 Bacteria 1420
48 Ga0068852_100650380 3300005616 Bacteria 1062
49 Ga0068852_101386490 3300005616 Bacteria 725
50 Ga0068852_102438104 3300005616 Bacteria 543
51 Ga0068859_100351370 3300005617 Bacteria 1569
52 Ga0068864_100208285 3300005618 Bacteria 1799
53 Ga0068864_100519557 3300005618 Bacteria 1148
54 Ga0068861_100375833 3300005719 Bacteria 1254
55 Ga0068858_100461630 3300005842 Bacteria 1225
56 Ga0068862_100286734 3300005844 Bacteria 1511
57 Ga0068862_100435762 3300005844 Bacteria 1233
58 Ga0081455_10268148 3300005937 Bacteria 1240
59 Ga0081540_1008843 3300005983 Bacteria 6991
60 Ga0070717_12021719 3300006028 Bacteria 519
61 Ga0075365_10113699 3300006038 Bacteria 1862
62 Ga0075365_10128231 3300006038 Bacteria 1754
63 Ga0075365_10144709 3300006038 Bacteria 1651
64 Ga0075365_10153648 3300006038 Bacteria 1602
65 Ga0075365_10204482 3300006038 Bacteria 1384
66 Ga0075368_10037772 3300006042 Bacteria 1889
67 Ga0075363_100027034 3300006048 Bacteria 2939
68 Ga0075363_100319874 3300006048 Bacteria 903
69 Ga0075364_10365667 3300006051 Bacteria 983
70 Ga0075364_10584000 3300006051 Bacteria 763
71 Ga0075367_10133341 3300006178 Bacteria 1536
72 Ga0075369_10116865 3300006186 Bacteria 1205
73 Ga0075369_10178266 3300006186 Bacteria 977
74 Ga0075369_10430539 3300006186 Bacteria 624
75 Ga0075366_10024108 3300006195 Bacteria 3548
76 Ga0075370_10023297 3300006353 Bacteria 3408
77 Ga0075370_10117650 3300006353 Bacteria 1545
78 Ga0068865_100509207 3300006881 Bacteria 1005
79 Ga0097620_100351368 3300006931 Bacteria 1569
80 Ga0099825_1031472 3300006941 Bacteria 2244
81 Ga0099824_1021563 3300006942 Bacteria 4461
82 Ga0099824_1025999 3300006942 Bacteria 3095
83 Ga0099822_1000007 3300006943 Bacteria 77453
84 Ga0099822_1056507 3300006943 Bacteria 1425
85 Ga0099823_1043404 3300006944 Bacteria 3102
86 Ga0105240_10094826 3300009093 Bacteria 3639
87 Ga0105240_12103254 3300009093 Bacteria 586
88 Ga0105245_10140555 3300009098 Bacteria 2273
89 Ga0105245_10322929 3300009098 Bacteria 1521
90 Ga0105247_10077972 3300009101 Bacteria 2083
91 Ga0105247_10148108 3300009101 Bacteria 1544
92 Ga0105243_10087060 3300009148 Bacteria 2563
93 Ga0105243_10614560 3300009148 Bacteria 1048
94 Ga0105241_10118544 3300009174 Bacteria 2128
95 Ga0105241_10239550 3300009174 Bacteria 1533
96 Ga0105241_11189725 3300009174 Bacteria 721
97 Ga0105242_13210832 3300009176 Bacteria 508
98 Ga0105248_11001681 3300009177 Bacteria 944
99 Ga0105248_11014793 3300009177 Bacteria 937
100 Ga0105248_12446591 3300009177 Bacteria 595
101 Ga0105237_10049068 3300009545 Bacteria 4244
102 Ga0105237_10232446 3300009545 Bacteria 1844
103 Ga0105237_10375797 3300009545 Bacteria 1426
104 Ga0105237_10747440 3300009545 Bacteria 984
105 Ga0105237_11370544 3300009545 Bacteria 713
106 Ga0105237_11644018 3300009545 Bacteria 649
107 Ga0105238_11177319 3300009551 Bacteria 791
108 Ga0105238_11270526 3300009551 Bacteria 762
109 Ga0105238_11324146 3300009551 Bacteria 746
110 Ga0105239_10177849 3300010375 Bacteria 2380
111 Ga0105239_10199125 3300010375 Bacteria 2243
112 Ga0105239_10243610 3300010375 Bacteria 2018
113 Ga0105239_10318234 3300010375 Bacteria 1754
114 Ga0105239_10650910 3300010375 Bacteria 1204
115 Ga0105239_11079269 3300010375 Bacteria 924
116 Ga0105246_10058664 3300011119 Bacteria 2667
117 Ga0105246_10209779 3300011119 Bacteria 1520
118 Ga0157370_10200982 3300013104 Bacteria 1849
119 Ga0157369_10401159 3300013105 Bacteria 1423
120 Ga0157374_10347743 3300013296 Bacteria 1473
121 Ga0157374_11641296 3300013296 Bacteria 667
122 Ga0157378_10181967 3300013297 Bacteria 1978
123 Ga0163162_11511416 3300013306 Bacteria 765
124 Ga0157372_10676988 3300013307 Bacteria 1201
125 Ga0157375_10212932 3300013308 Bacteria 2090
126 Ga0163163_10030090 3300014325 Bacteria 5227
127 Ga0163163_10165705 3300014325 Bacteria 2256
128 Ga0163163_10543199 3300014325 Bacteria 1224
129 Ga0182008_10110720 3300014497 Bacteria 1361
130 Ga0157377_10344224 3300014745 Bacteria 998
131 Ga0157379_10387784 3300014968 Bacteria 1282
132 Ga0157379_11922316 3300014968 Bacteria 583
133 Ga0157376_10396571 3300014969 Bacteria 1333
134 Ga0157376_10858015 3300014969 Bacteria 924
135 Ga0157376_10932181 3300014969 Bacteria 888
136 Ga0182006_1145355 3300015261 Bacteria 807
137 Ga0182005_1004190 3300015265 Bacteria 4711
138 Ga0163161_10207888 3300017792 Bacteria 1511
139 Ga0163161_11256227 3300017792 Bacteria 642
140 Ga0213876_10123226 3300021384 Bacteria 1377
141 Ga0213875_10163579 3300021388 Bacteria 1044
142 Ga0209563_103243 3300025230 Bacteria 3416
143 Ga0209677_108017 3300025253 Bacteria 2124
144 Ga0209148_1000282 3300025254 Bacteria 78016
145 Ga0209233_1000695 3300025261 Bacteria 15898
146 Ga0209233_1002488 3300025261 Bacteria 6751
147 Ga0209233_1003161 3300025261 Bacteria 5837
148 Ga0209455_1011548 3300025272 Bacteria 2167
149 Ga0209455_1011758 3300025272 Bacteria 2138
150 Ga0209455_1033495 3300025272 Bacteria 843
151 Ga0209564_1010903 3300025295 Bacteria 4134
152 Ga0209758_1002661 3300025297 Bacteria 17670
153 Ga0209758_1004375 3300025297 Bacteria 11808
154 Ga0209758_1009733 3300025297 Bacteria 5905
155 Ga0209758_1183442 3300025297 Bacteria 501
156 Ga0207426_1005286 3300025302 Bacteria 5945
157 Ga0207426_1011025 3300025302 Bacteria 3470
158 Ga0207426_1014790 3300025302 Bacteria 2850
159 Ga0207426_1018351 3300025302 Bacteria 2466
160 Ga0209257_1018498 3300025304 Bacteria 2678
161 Ga0209257_1023083 3300025304 Bacteria 2198
162 Ga0207710_10090473 3300025900 Bacteria 1431
163 Ga0207710_10129073 3300025900 Bacteria 1213
164 Ga0207688_10188165 3300025901 Bacteria 1233
165 Ga0207680_10383279 3300025903 Bacteria 991
166 Ga0207647_10009663 3300025904 Bacteria 6847
167 Ga0207705_10833616 3300025909 Bacteria 715
168 Ga0207654_10041579 3300025911 Bacteria 2596
169 Ga0207654_10103295 3300025911 Bacteria 1760
170 Ga0207695_10001820 3300025913 Bacteria 33567
171 Ga0207671_10008398 3300025914 Bacteria 8767
172 Ga0207657_10198773 3300025919 Bacteria 1614
173 Ga0207649_10391741 3300025920 Bacteria 1038
174 Ga0207649_10869921 3300025920 Bacteria 706
175 Ga0207681_10366423 3300025923 Bacteria 1157
176 Ga0207694_10217226 3300025924 Bacteria 1559
177 Ga0207694_10458054 3300025924 Bacteria 1065
178 Ga0207694_10913158 3300025924 Bacteria 742
179 Ga0207650_10843572 3300025925 Bacteria 777
180 Ga0207687_10355179 3300025927 Bacteria 1195
181 Ga0207687_10784764 3300025927 Bacteria 812
182 Ga0207644_10044985 3300025931 Bacteria 3139
183 Ga0207690_10409035 3300025932 Bacteria 1083
184 Ga0207690_10896564 3300025932 Bacteria 735
185 Ga0207706_10148334 3300025933 Bacteria 2063
186 Ga0207686_10779322 3300025934 Bacteria 765
187 Ga0207665_10917986 3300025939 Bacteria 695
188 Ga0207711_10132470 3300025941 Bacteria 2236
189 Ga0207711_10398245 3300025941 Bacteria 1279
190 Ga0207711_11034742 3300025941 Bacteria 761
191 Ga0207689_10412527 3300025942 Bacteria 1126
192 Ga0207667_11829761 3300025949 Bacteria 571
193 Ga0207712_10590112 3300025961 Bacteria 960
194 Ga0207668_10189853 3300025972 Bacteria 1627
195 Ga0207668_11087850 3300025972 Bacteria 716
196 Ga0207640_10164648 3300025981 Bacteria 1645
197 Ga0207640_10251747 3300025981 Bacteria 1371
198 Ga0207677_10296540 3300026023 Bacteria 1334
199 Ga0207703_10728206 3300026035 Bacteria 944
200 Ga0207639_10089808 3300026041 Bacteria 2456
201 Ga0207639_10638677 3300026041 Bacteria 984
202 Ga0207678_10321928 3300026067 Bacteria 1330
203 Ga0207678_10470639 3300026067 Bacteria 1094
204 Ga0207702_11566453 3300026078 Bacteria 652
205 Ga0207641_10308630 3300026088 Bacteria 1497
206 Ga0207641_11363962 3300026088 Bacteria 710
207 Ga0207648_10408092 3300026089 Bacteria 1232
208 Ga0207676_10910463 3300026095 Bacteria 863
209 Ga0207674_10042432 3300026116 Bacteria 4698
210 Ga0207674_11323254 3300026116 Bacteria 690
211 Ga0207675_100649090 3300026118 Bacteria 1061
212 Ga0207698_10337660 3300026142 Bacteria 1418
213 Ga0207698_12148105 3300026142 Bacteria 572
214 Ga0209389_1000033 3300027296 Bacteria 131516
215 Ga0209389_1000071 3300027296 Bacteria 97411
216 Ga0209589_1000021 3300027357 Bacteria 186431
217 Ga0209589_1000040 3300027357 Bacteria 126550
218 Ga0209489_100028 3300027361 Bacteria 186431
219 Ga0209489_100045 3300027361 Bacteria 158225
220 Ga0209489_100209 3300027361 Bacteria 96349
221 Ga0209700_100011 3300027363 Bacteria 362159
222 Ga0209700_100037 3300027363 Bacteria 186431
223 Ga0209813_10025654 3300027866 Bacteria 1698
224 Ga0268266_10250699 3300028379 Bacteria 1637
225 Ga0268256_1005446 3300030500 Bacteria 4990
226 Ga0307408_101976030 3300031548 Bacteria 560
227 Ga0307508_10269155 3300031616 Bacteria 1298
228 Ga0307518_10055895 3300031838 Bacteria 2868
229 Ga0307507_10501330 3300033179 Bacteria 654
230 Ga0307510_10001611 3300033180 Bacteria 24966
231 Ga0307510_10082790 3300033180 Bacteria 3102
232 Ga0307510_10575598 3300033180 Bacteria 575
233 Ga0315911_1000008 3300033442 Bacteria 381285
234 Ga0373946_0433678 3300035171 Bacteria 667
235 Ga0373925_0132073 3300037068 Bacteria 1948
236 Ga0395899_0204301 3300037312 Bacteria 1376
237 Ga0395900_0001984 3300037418 Bacteria 23107
238 Ga0395900_0491484 3300037418 Bacteria 1179
239 Ga0395900_1646457 3300037418 Bacteria 553
240 Ga0395898_0072727 3300037466 Bacteria 3321
241 Ga0395898_0952471 3300037466 Bacteria 795
242 Ga0395905_0031967 3300037471 Bacteria 4951
243 Ga0395905_1209781 3300037471 Bacteria 659
244 Ga0436364_0126097 3300037853 Bacteria 1055
245 Ga0395901_0008351 3300038443 Bacteria 10469
246 Ga0436365_0340380 3300039437 Bacteria 1473
247 Ga0436365_1050286 3300039437 Bacteria 704
248 Ga0436365_1751333 3300039437 Bacteria 1598
249 Ga0436363_0529233 3300039450 Bacteria 1203
250 Ga0451789_0835545 3300041443 Bacteria 832
251 Ga0451793_1876039 3300041452 Bacteria 633
252 Ga0451797_1221557 3300041453 Bacteria 673
253 Ga0451795_1015651 3300041456 Bacteria 1441
254 Ga0451798_0763090 3300041458 Bacteria 852
255 Ga0451800_1088871 3300041459 Bacteria 1277
256 Ga0451802_0570304 3300041460 Bacteria 951
257 Ga0451835_0334168 3300041492 Bacteria 816
258 Ga0451839_1240486 3300041496 Bacteria 900
259 Ga0451849_0605637 3300041505 Bacteria 1677
260 Ga0451843_0089561 3300041509 Bacteria 556
261 Ga0451855_1583322 3300041511 Bacteria 1522
262 Ga0451853_2695975 3300041512 Bacteria 1173
263 Ga0439450_096556 3300042008 Bacteria 747
264 Ga0439459_0073577 3300042438 Bacteria 795
265 Ga0466969_0010492 3300044656 Bacteria 4911
266 Ga0466972_0000107 3300044658 Bacteria 71873
267 Ga0466972_0008574 3300044658 Bacteria 5130
268 Ga0466972_0084515 3300044658 Bacteria 1509
269 Ga0466965_0207782 3300044683 Bacteria 1040
270 Ga0466966_0001443 3300044684 Bacteria 15269
271 Ga0466961_0000139 3300044693 Bacteria 48781
272 Ga0466964_0019701 3300044706 Bacteria 2595
273 Ga0466964_0035033 3300044706 Bacteria 2005
274 Ga0466964_0215367 3300044706 Bacteria 930
275 Ga0466968_0001784 3300044735 Bacteria 7764
276 Ga0466968_0133978 3300044735 Bacteria 1129
277 Ga0466968_0269628 3300044735 Bacteria 812
278 Ga0466970_0032163 3300044765 Bacteria 2772
279 Ga0466970_0188686 3300044765 Bacteria 1145
280 Ga0466970_0330279 3300044765 Bacteria 863
281 Ga0466957_1253708 3300044842 Bacteria 537
282 Ga0466960_0010452 3300044901 Bacteria 3856
283 Ga0466959_0008725 3300045049 Bacteria 7179
284 Ga0466959_0110600 3300045049 Bacteria 1961
285 Ga0466959_0430582 3300045049 Bacteria 895
286 Ga0466967_0053386 3300045976 Bacteria 3551
287 Ga0466967_0654368 3300045976 Bacteria 1039
288 Ga0495592_0070196 3300046454 Bacteria 2553
289 Ga0495592_0292088 3300046454 Bacteria 1062
290 Ga0495603_0293022 3300046455 Bacteria 935
291 Ga0495590_0128347 3300046457 Bacteria 911
292 Ga0495629_0017376 3300046459 Bacteria 5155
293 Ga0495629_0531542 3300046459 Bacteria 791
294 Ga0495638_0005789 3300046460 Bacteria 9097
295 Ga0495638_0622716 3300046460 Bacteria 527
296 Ga0495651_0033403 3300046462 Bacteria 4013
297 Ga0495651_0638561 3300046462 Bacteria 668
298 Ga0495653_0069937 3300046463 Bacteria 2628
299 Ga0495653_0205132 3300046463 Bacteria 1335
300 Ga0495605_0076820 3300046474 Bacteria 1568
301 Ga0495605_0083007 3300046474 Bacteria 1496
302 Ga0495639_0138423 3300046475 Bacteria 1169
303 Ga0495662_0124703 3300046476 Bacteria 1265
304 Ga0495664_0138964 3300046477 Bacteria 1472
305 Ga0495664_0580778 3300046477 Bacteria 667
306 Ga0495584_0426426 3300046491 Bacteria 674
307 Ga0495594_0251508 3300046499 Bacteria 1007
308 Ga0495607_0160987 3300046501 Bacteria 1141
309 Ga0495583_0252429 3300046506 Bacteria 707
310 Ga0495606_0091030 3300046507 Bacteria 1876
311 Ga0495606_0211356 3300046507 Bacteria 1099
312 Ga0495608_0299709 3300046511 Bacteria 995
313 Ga0495610_0046565 3300046512 Bacteria 2139
314 Ga0495610_0252332 3300046512 Bacteria 698
315 Ga0495616_0120469 3300046513 Bacteria 1212
316 Ga0495618_0225231 3300046514 Bacteria 1182
317 Ga0495628_0247359 3300046516 Bacteria 1332
318 Ga0495630_0244271 3300046517 Bacteria 1372
319 Ga0495631_0116136 3300046518 Bacteria 1151
320 Ga0495632_0331567 3300046519 Bacteria 671
321 Ga0495643_0101501 3300046522 Bacteria 1474
322 Ga0495648_0109428 3300046524 Bacteria 1507
323 Ga0495648_0140926 3300046524 Bacteria 1269
324 Ga0495648_0202216 3300046524 Bacteria 993
325 Ga0495648_0327708 3300046524 Bacteria 707
326 Ga0495652_0006980 3300046529 Bacteria 10439
327 Ga0495652_0562677 3300046529 Bacteria 782
328 Ga0495665_0343244 3300046531 Bacteria 761
329 Ga0495640_0070958 3300046533 Bacteria 2338
330 Ga0495587_0213873 3300046536 Bacteria 1088
331 Ga0495609_0033354 3300046538 Bacteria 2338
332 Ga0495597_0098900 3300046542 Bacteria 1232
333 Ga0495597_0287346 3300046542 Bacteria 640
334 Ga0495597_0309606 3300046542 Bacteria 612
335 Ga0495645_0002450 3300046543 Bacteria 12598
336 Ga0495622_0157696 3300046557 Bacteria 1024
337 Ga0495622_0385540 3300046557 Bacteria 604
338 Ga0495668_0020031 3300046616 Bacteria 3848
339 Ga0495668_0484582 3300046616 Bacteria 681
340 Ga0495668_0809347 3300046616 Bacteria 519
341 Ga0495611_0216625 3300046648 Bacteria 891
342 Ga0495625_0000064 3300046660 Bacteria 174730
343 Ga0495625_0148045 3300046660 Bacteria 1580
344 Ga0495625_0263675 3300046660 Bacteria 1114
345 Ga0495625_0549193 3300046660 Bacteria 700
346 Ga0495635_0003741 3300046663 Bacteria 10554
347 Ga0495635_0023565 3300046663 Bacteria 4287
348 Ga0495661_0129858 3300046665 Bacteria 1382
349 Ga0495661_0233284 3300046665 Bacteria 948
350 Ga0495588_0118005 3300046674 Bacteria 1398
351 Ga0495588_0425938 3300046674 Bacteria 696
352 Ga0495657_0009503 3300046675 Bacteria 7365
353 Ga0495657_0323893 3300046675 Bacteria 915
354 Ga0495657_0561190 3300046675 Bacteria 663
355 Ga0495599_0089929 3300046678 Bacteria 1916
356 Ga0495599_0296518 3300046678 Bacteria 977
357 Ga0495623_0001404 3300046679 Bacteria 16369
358 Ga0495646_0060345 3300046680 Bacteria 2262
359 Ga0495646_0073653 3300046680 Bacteria 2006
360 Ga0495613_0028252 3300046689 Bacteria 4172
361 Ga0495624_0015565 3300046690 Bacteria 5133
362 Ga0495624_0680454 3300046690 Bacteria 611
363 Ga0495671_0106542 3300046692 Bacteria 1369
364 Ga0495649_0147417 3300046694 Bacteria 1237
365 Ga0495649_0249318 3300046694 Bacteria 912
366 Ga0495649_0325051 3300046694 Bacteria 780
367 Ga0495600_0001928 3300046809 Bacteria 11645
368 Ga0495600_0047383 3300046809 Bacteria 2803
369 Ga0495581_0391463 3300047315 Bacteria 811
370 Ga0495604_0011547 3300047317 Bacteria 7019
371 Ga0495604_0147638 3300047317 Bacteria 1674
372 Ga0495674_0114962 3300047319 Bacteria 2278
373 Ga0495672_0443067 3300047320 Bacteria 587
374 Ga0495676_0050960 3300047321 Bacteria 3316
375 Ga0495676_0168359 3300047321 Bacteria 1544
376 Ga0495680_0002812 3300047322 Bacteria 17515
377 Ga0495680_0180949 3300047322 Bacteria 1522
378 Ga0495687_028038 3300047443 Bacteria 2624
379 Ga0495675_0140065 3300047444 Bacteria 1500
380 Ga0495675_0152904 3300047444 Bacteria 1425
381 Ga0495673_0140425 3300047469 Bacteria 942
382 Ga0495684_0280689 3300047471 Bacteria 1202
383 Ga0495686_0111833 3300047472 Bacteria 1637
384 Ga0495686_0177680 3300047472 Bacteria 1235
385 Ga0495593_0106511 3300047673 Bacteria 1434
386 Ga0495602_0058524 3300048088 Bacteria 3372
387 Ga0495602_0116441 3300048088 Bacteria 2159
388 Ga0495626_0046703 3300048091 Bacteria 2016
389 Ga0496100_0595124 3300048903 Bacteria 858
390 Ga0496101_0181034 3300048904 Bacteria 1623
391 Ga0496101_0303322 3300048904 Bacteria 1251
392 Ga0496101_0338626 3300048904 Bacteria 1181
393 Ga0496102_0122925 3300048905 Bacteria 2425
394 Ga0496102_0306004 3300048905 Bacteria 1498
395 Ga0496102_0401534 3300048905 Bacteria 1288
396 Ga0496103_0004777 3300048906 Bacteria 8187
397 Ga0496104_0073029 3300048907 Bacteria 3263
398 Ga0496104_0353323 3300048907 Bacteria 1382
399 Ga0496104_0459688 3300048907 Bacteria 1184
400 Ga0496104_0507606 3300048907 Bacteria 1117
401 Ga0496104_0661397 3300048907 Bacteria 953
402 Ga0496105_0041443 3300048908 Bacteria 3795
403 Ga0496105_0242727 3300048908 Bacteria 1461
404 Ga0496105_0280557 3300048908 Bacteria 1343
405 Ga0496106_0407644 3300048909 Bacteria 1092
406 Ga0496107_0432169 3300048910 Bacteria 979
407 Ga0496107_0468291 3300048910 Bacteria 935
408 Ga0496108_0791450 3300048911 Bacteria 818
409 Ga0496108_0833716 3300048911 Bacteria 794
410 Ga0496108_0949535 3300048911 Bacteria 736
411 Ga0496109_0031109 3300048912 Bacteria 4787
412 Ga0496109_0374378 3300048912 Bacteria 1345
413 Ga0496109_0661294 3300048912 Bacteria 982
414 Ga0496110_0093586 3300048913 Bacteria 2690
415 Ga0496110_0227496 3300048913 Bacteria 1696
416 Ga0496110_0550624 3300048913 Bacteria 1048
417 Ga0496111_0265951 3300048914 Bacteria 1272
418 Ga0496112_0063855 3300048915 Bacteria 3632
419 Ga0496112_0092258 3300048915 Bacteria 2998
420 Ga0496112_0154731 3300048915 Bacteria 2260
421 Ga0496113_0074130 3300048916 Bacteria 2594
422 Ga0496113_0138556 3300048916 Bacteria 1913
423 Ga0496113_0325121 3300048916 Bacteria 1233
424 Ga0496113_1117619 3300048916 Bacteria 618
425 Ga0496114_0086183 3300048917 Bacteria 2661
426 Ga0496114_0220173 3300048917 Bacteria 1666
427 Ga0496114_0921029 3300048917 Bacteria 756
428 Ga0496114_1219761 3300048917 Bacteria 638
429 Ga0496115_0102842 3300048918 Bacteria 2343
430 Ga0496115_0261375 3300048918 Bacteria 1423
431 Ga0496115_0764743 3300048918 Bacteria 754
432 Ga0496116_0053513 3300048919 Bacteria 2665
433 Ga0496117_0123519 3300048920 Bacteria 1585
434 Ga0496117_0223485 3300048920 Bacteria 1046
435 Ga0496118_0017923 3300048921 Bacteria 6421
436 Ga0496118_0047930 3300048921 Bacteria 3307
437 Ga0496118_0053477 3300048921 Bacteria 3069
438 Ga0496118_0240125 3300048921 Bacteria 1038
439 Ga0496118_0476262 3300048921 Bacteria 627
440 Ga0496119_0021482 3300048922 Bacteria 4665
441 Ga0496119_0111285 3300048922 Bacteria 1519
442 Ga0496119_0353796 3300048922 Bacteria 711
443 Ga0496120_0033990 3300048923 Bacteria 3058
444 Ga0496121_0028517 3300048924 Bacteria 5193
445 Ga0496121_0101293 3300048924 Bacteria 2221
446 Ga0496121_0137375 3300048924 Bacteria 1819
447 Ga0496121_0152975 3300048924 Bacteria 1695
448 Ga0496121_0167971 3300048924 Bacteria 1597
449 Ga0496122_0160967 3300048925 Bacteria 1368
450 Ga0496122_0487882 3300048925 Bacteria 602
451 Ga0496123_0025175 3300048926 Bacteria 4494
452 Ga0496123_0075063 3300048926 Bacteria 2088
453 Ga0496123_0186867 3300048926 Bacteria 1076
454 Ga0496124_0061116 3300048927 Bacteria 3159
455 Ga0496124_0110022 3300048927 Bacteria 2219
456 Ga0496124_0414609 3300048927 Bacteria 930
457 Ga0496124_0796880 3300048927 Bacteria 586
458 Ga0496125_0072775 3300048928 Bacteria 2676
459 Ga0496125_0119412 3300048928 Bacteria 1885
460 Ga0496125_0120568 3300048928 Bacteria 1872
461 Ga0496126_0188156 3300048929 Bacteria 1750
462 Ga0496126_0200161 3300048929 Bacteria 1687
463 Ga0496126_0213561 3300048929 Bacteria 1623
464 Ga0496126_0496298 3300048929 Bacteria 976
465 Ga0496126_0763062 3300048929 Bacteria 745
466 Ga0496126_0783637 3300048929 Bacteria 733
467 Ga0495682_0076466 3300049460 Bacteria 1204
468 Ga0495682_0155752 3300049460 Bacteria 814
469 Ga0495682_0177889 3300049460 Bacteria 756
470 nmdc:mga03n38_20260_c1 3300050490 Bacteria 2658
471 nmdc:mga00v17_235849_c1 3300050491 Bacteria 1186
472 nmdc:mga00v17_545120_c1 3300050491 Bacteria 750
473 nmdc:mga0yw44_19658_c1 3300050492 Bacteria 3730
474 nmdc:mga0yw44_45640_c1 3300050492 Bacteria 2628
475 nmdc:mga0yw44_55424_c1 3300050492 Bacteria 2412
476 nmdc:mga0k408_137965_c1 3300050493 Bacteria 1450
477 nmdc:mga06z11_96927_c1 3300050494 Bacteria 1612
478 nmdc:mga04h51_4544_c1 3300050495 Bacteria 3465
479 nmdc:mga07m45_36038_c1 3300050496 Bacteria 2754
480 nmdc:mga07m45_363767_c1 3300050496 Bacteria 840
481 nmdc:mga0sz30_115276_c1 3300050516 Bacteria 1179
482 nmdc:mga0sz30_25309_c1 3300050516 Bacteria 2427
483 nmdc:mga0sz30_58466_c1 3300050516 Bacteria 1644
484 Ga0495655_0035275 3300053083 Bacteria 1243
485 Ga0495655_0043411 3300053083 Bacteria 1159
486 Ga0495619_0153641 3300053085 Bacteria 1588
487 Ga0500578_0046543 3300053086 Bacteria 2783
488 Ga0500578_0387803 3300053086 Bacteria 808
489 Ga0500643_000063 3300053087 Bacteria 122135
490 Ga0500646_0064806 3300053090 Bacteria 1083
491 Ga0500583_0041342 3300053092 Bacteria 2093
492 Ga0500566_0016175 3300053094 Bacteria 4380
493 Ga0500566_0307095 3300053094 Bacteria 744
494 Ga0500640_177755 3300053095 Bacteria 775
495 Ga0500641_0058137 3300053096 Bacteria 1605
496 Ga0500650_0069634 3300053098 Bacteria 1645
497 Ga0500555_001844 3300053103 Bacteria 6305
498 Ga0500556_0004073 3300053104 Bacteria 4198
499 Ga0500557_000037 3300053105 Bacteria 71114
500 Ga0500558_250961 3300053106 Bacteria 581
501 Ga0500562_003526 3300053108 Bacteria 3921
502 Ga0500572_115119 3300053111 Bacteria 868
503 Ga0500592_017639 3300053116 Bacteria 1147
504 Ga0500594_0114444 3300053118 Bacteria 842
505 Ga0500595_030629 3300053119 Bacteria 1811
506 Ga0500597_399197 3300053120 Bacteria 523
507 Ga0500607_053714 3300053121 Bacteria 2135
508 Ga0500607_067406 3300053121 Bacteria 1854
509 Ga0500608_210603 3300053122 Bacteria 794
510 Ga0500618_149585 3300053125 Bacteria 533
511 Ga0500621_200918 3300053126 Bacteria 706
512 Ga0500642_0000153 3300053130 Bacteria 28618
513 Ga0500642_0023235 3300053130 Bacteria 2486
514 Ga0500658_0041584 3300053134 Bacteria 1844
515 Ga0500559_0093106 3300053136 Bacteria 1381
516 Ga0500559_0246128 3300053136 Bacteria 842
517 Ga0500568_0018223 3300053139 Bacteria 3078
518 Ga0500577_0265358 3300053142 Bacteria 747
519 Ga0500577_0523714 3300053142 Bacteria 517
520 Ga0500588_0038032 3300053146 Bacteria 1433
521 Ga0500588_0401619 3300053146 Bacteria 522
522 Ga0500603_194509 3300053150 Bacteria 642
523 Ga0500604_0029036 3300053151 Bacteria 1609
524 Ga0500604_0129428 3300053151 Bacteria 848
525 Ga0500616_0008592 3300053153 Bacteria 6322
526 Ga0500619_001466 3300053154 Bacteria 4190
527 Ga0500620_025213 3300053155 Bacteria 1827
528 Ga0500622_0006417 3300053156 Bacteria 6819
529 Ga0500622_0309384 3300053156 Bacteria 670
530 Ga0500627_0010437 3300053158 Bacteria 3388
531 Ga0500634_0039678 3300053161 Bacteria 2559
532 Ga0500634_0043079 3300053161 Bacteria 2448
533 Ga0500638_111126 3300053162 Bacteria 1265
534 Ga0500636_0000197 3300053177 Bacteria 32448
535 Ga0500637_0358161 3300053178 Bacteria 773
536 Ga0500649_179309 3300053722 Bacteria 718
537 Ga0500611_070643 3300053727 Bacteria 850
538 Ga0500625_034396 3300053729 Bacteria 2402
539 Ga0500625_224190 3300053729 Bacteria 595
540 Ga0500645_035494 3300053730 Bacteria 1485
541 Ga0500645_142127 3300053730 Bacteria 664
542 Ga0500599_004775 3300053736 Bacteria 1684
543 Ga0500599_007097 3300053736 Bacteria 1437
544 Ga0500601_000391 3300053737 Bacteria 7543
545 2507505265 2507262055 Bacteria 8048963
546 2508539186 2508501009 Bacteria 7784016
547 2508695505 2508501042 Bacteria 8719808
548 2511400201 2511231028 Bacteria 8046582
549 2513644661 2513237094 Bacteria 8789602
550 2513651496 2513237095 Bacteria 8976980
551 2513658839 2513237096 Bacteria 8722461
552 2513720285 2513237104 Bacteria 10034502
553 2513921103 2513237145 Bacteria 8979722
554 2515627462 2515154112 Bacteria 8294334
555 2517107692 2517093001 Bacteria 9002274
556 2517888867 2517572143 Bacteria 9484767
557 2524537023 2524023228 Bacteria 10118060
558 2528852957 2528768022 Bacteria 10457665
559 2671122473 2667528175 Bacteria 7532676
560 2728755011 2728368998 Bacteria 8720350
561 2793062061 2791355196 Bacteria 7323613
562 2793072955 2791355197 Bacteria 8420563
563 2818237669 2816332527 Bacteria 8933356
564 2819717658 2818991467 Bacteria 5893227
565 2824604565 2824600985 Bacteria 8488197
566 2824612344 2824609381 Bacteria 8672835
567 2824655209 2824653114 Bacteria 8493680
568 2824667580 2824661429 Bacteria 9877870
569 2824713103 2824704595 Bacteria 9667483
570 2824759936 2824753945 Bacteria 9787441
571 2824770370 2824763712 Bacteria 9792355
572 2844315355 2844315083 Bacteria 8138177
573 2847931093 2847930680 Bacteria 9342022
574 2874594465 2874590934 Bacteria 8299676
575 2874624802 2874620515 Bacteria 8290088
576 2874628775 2874628541 Bacteria 8630250
577 2874649838 2874645413 Bacteria 8214782
578 2876773957 2876771140 Bacteria 8287509
579 2876821837 2876818435 Bacteria 8274608
580 2879078319 2879074833 Bacteria 8279565
581 2879085928 2879083081 Bacteria 8587928
582 2879106001 2879099564 Bacteria 10442239
583 2879130579 2879127579 Bacteria 8294491
584 2879147144 2879142872 Bacteria 8267021
585 2881668166 2881665667 Bacteria 8175609
586 2885382828 2885374607 Bacteria 8927485
587 2888379571 2888378607 Bacteria 9652610
588 2888390660 2888388044 Bacteria 7304136
589 2888420287 2888419890 Bacteria 7857137
590 2903732216 2903727486 Bacteria 8281579
591 2903751496 2903748898 Bacteria 9972761
592 2904670243 2904666416 Bacteria 8226587
593 2904708684
594 2904713198 2904711408 Bacteria 9771557
595 2906604293 2906602504 Bacteria 8295279
596 2906613896
597 2906642306 2906635258 Bacteria 8601019
598 2906648157 2906643746 Bacteria 8722424
599 2906667334 2906660503 Bacteria 8595048
600 2908747467 2908739725 Bacteria 8628932
601 2922368913
602 2922434202
603 2929618621 2929615660 Bacteria 9193770
604 2929628694 2929624759 Bacteria 9339455
605 2932793735 2932784394 Bacteria 9704911
606 2932794297 2932794094 Bacteria 7915132
607 2932808110 2932801729 Bacteria 7987968
608 2932812144 2932809354 Bacteria 9135765
609 2932823134 2932818245 Bacteria 9955613
610 2932836052 2932828146 Bacteria 9745859
611 2933580667 2933577622 Bacteria 9116884
612 2935615704 2935608549 Bacteria 8203142
613 2935618541 2935616580 Bacteria 9032984
614 2935636519 2935630451 Bacteria 8169952
615 2935641058 2935638405 Bacteria 10015038
616 2935653621 2935648319 Bacteria 8801166
617 2935662370 2935656913 Bacteria 8965014
618 2935669974 2935665750 Bacteria 9571747
619 2935679177 2935675223 Bacteria 9928132
620 2935686423 2935684952 Bacteria 9590419
621 2935700204 2935694250 Bacteria 9291695
622 2935711501 2935703347 Bacteria 10242284
623 2935716111 2935713505 Bacteria 9608509
624 2935723765 2935722832 Bacteria 9608746
625 2935735320 2935732158 Bacteria 9706831
626 2935743889 2935741537 Bacteria 9707219
627 2935752389 2935750917 Bacteria 9590372
628 2935763514 2935760218 Bacteria 9817913
629 2935773021 2935769743 Bacteria 7878163
630 2935782964 2935777560 Bacteria 8077691
631 2935787990 2935785616 Bacteria 7962367
632 2935796434 2935793552 Bacteria 8012592
633 2935809938 2935801545 Bacteria 9301974
634 2935816243 2935810662 Bacteria 9401221
635 2935825498 2935819856 Bacteria 8261050
636 2935835637 2935827899 Bacteria 10038562
637 2935844588 2935837841 Bacteria 9454360
638 2935853287 2935847175 Bacteria 8228321
639 2935862966 2935855204 Bacteria 9035059
640 2935866708 2935864058 Bacteria 9784707
641 2935875015 2935873716 Bacteria 9632195
642 2935890075 2935883170 Bacteria 7964738
643 2935914760 2935908558 Bacteria 8568796
644 2935918736 2935916978 Bacteria 9113783
645 2935931547 2935926038 Bacteria 8601059
646 2935940144 2935934488 Bacteria 8602579
647 2935947509 2935942939 Bacteria 8599779
648 2935956281 2935951376 Bacteria 8602333
649 2935962657 2935959822 Bacteria 7869783
650 2935973074 2935967501 Bacteria 8603075
651 2935980683 2935975950 Bacteria 8347125
652 2935985163 2935984226 Bacteria 8302647
653 2935999709 2935992306 Bacteria 9802711
654 2936010594 2936002035 Bacteria 9362176
655 2936016672 2936011229 Bacteria 8801034
656 2936025305 2936019824 Bacteria 8804134
657 2936034147 2936028420 Bacteria 8965941
658 2936041248 2936037263 Bacteria 9446081
659 2936052204 2936046547 Bacteria 8903709
660 2936056335 2936055302 Bacteria 8785755
661 2939673430 2939669807 Bacteria 5028511
662 2940558302 2940556831 Bacteria 9590747
663 2941513154 2941507105 Bacteria 8166816
664 2941521191 2941515067 Bacteria 8166720
665 2941528872 2941523033 Bacteria 8169134
666 2941535493 2941531003 Bacteria 7653939
667 2941543227 2941538514 Bacteria 9402094
668 3005475088 3005474847 Bacteria 9259049
669 3005595070 3005594810 Bacteria 8716512
670 3005711018 3005710791 Bacteria 7622528
671 3005718323 3005718088 Bacteria 8283608
672 8006928944 8006926726 Bacteria 6749210
673 8006936202 8006933436 Bacteria 10410654
674 8006976148 8006973647 Bacteria 10679141
675 8016518161 8016511872 Bacteria 9921665
676 8016526161 8016522445 Bacteria 8156687
677 8016539774 8016530956 Bacteria 8155261
678 8016544080 8016539877 Bacteria 8155419
679 8016549229 8016548790 Bacteria 8155074
680 8016557654 8016557553 Bacteria 8154380
681 8016569483 8016566248 Bacteria 8158151
682 8016582096 8016575299 Bacteria 8154085
683 8016595689 8016595262 Bacteria 8149947
684 8016606543 8016603502 Bacteria 8731218
685 8016623138 8016622563 Bacteria 7999408
686 8016635603 8016630954 Bacteria 9217207
687 8017058485 8017057580 Bacteria 10023680
688 8019531051 8019530166 Bacteria 8155624
689 8019540529 8019538911 Bacteria 7872763
690 8019550150 8019547302 Bacteria 7996444
691 8019562432 8019555841 Bacteria 9642137
692 8019572504 8019565922 Bacteria 9639779
693 8019577210 8019576017 Bacteria 10049540
694 8019595288 8019586578 Bacteria 10212056
695 8019606467 8019597564 Bacteria 10041141
696 8019612055 8019608314 Bacteria 10042931
697 8019622992 8019619141 Bacteria 9218857
698 8019630112 8019629233 Bacteria 8687553
699 8019640502 8019638758 Bacteria 9062356
700 8019652448 8019648815 Bacteria 10014479
701 8019666946 8019659431 Bacteria 8577854
702 8019676703 8019668869 Bacteria 8791617
703 8019679285 8019678201 Bacteria 8863603
704 8019696217 8019687851 Bacteria 8712826
705 8055742471 8055742211 Bacteria 9226248
706 8056971308 8056967851 Bacteria 9038162
707 Ga0500661_019124
708 JGI24737J22298_10127357
709 JGI24738J21930_10034017
710 JGI25153J46596_10054512
711 JGI25153J46596_10119138
712 JGI25160J50197_1001982
713 JGI25160J50197_1020872
714 Ga0055526_1042110
715 Ga0055531_10065814
716 Ga0065165_1003369
717 Ga0065165_1010822
718 Ga0065165_1016221
719 Ga0070658_10272195
720 Ga0070683_101744749
721 Ga0070670_100057786
722 Ga0068869_100164395
723 Ga0070666_10200584
724 Ga0070682_100214322
725 Ga0068868_100505847
726 Ga0070660_100026933
727 Ga0070661_100438596
728 Ga0070661_100795288
729 Ga0070668_100289912
730 Ga0070669_100408286
731 Ga0070671_100067479
732 Ga0070674_100922707
733 Ga0070659_100945470
734 Ga0070667_100145617
735 Ga0070701_10563286
736 Ga0070663_100094948
737 Ga0070663_100439308
738 Ga0070678_100321427
739 Ga0070662_100803674
740 Ga0070685_10485835
741 Ga0070672_100685077
742 Ga0070665_100581555
743 Ga0068855_100707309
744 Ga0068855_101735591
745 Ga0070664_100681638
746 Ga0068857_100645494
747 Ga0068854_100875986
748 Ga0068854_101633883
749 Ga0068856_100240074
750 Ga0068856_100359463
751 Ga0070702_101541868
752 Ga0068852_100108330
753 Ga0068852_100361225
754 Ga0068852_100650380
755 Ga0068852_101386490
756 Ga0068852_102438104
757 Ga0068859_100351370
758 Ga0068864_100208285
759 Ga0068864_100519557
760 Ga0068861_100375833
761 Ga0068858_100461630
762 Ga0068862_100286734
763 Ga0068862_100435762
764 Ga0081455_10268148
765 Ga0081540_1008843
766 Ga0070717_12021719
767 Ga0075365_10113699
768 Ga0075365_10128231
769 Ga0075365_10144709
770 Ga0075365_10153648
771 Ga0075365_10204482
772 Ga0075368_10037772
773 Ga0075363_100027034
774 Ga0075363_100319874
775 Ga0075364_10365667
776 Ga0075364_10584000
777 Ga0075367_10133341
778 Ga0075369_10116865
779 Ga0075369_10178266
780 Ga0075369_10430539
781 Ga0075366_10024108
782 Ga0075370_10023297
783 Ga0075370_10117650
784 Ga0068865_100509207
785 Ga0097620_100351368
786 Ga0099825_1031472
787 Ga0099824_1021563
788 Ga0099824_1025999
789 Ga0099822_1000007
790 Ga0099822_1056507
791 Ga0099823_1043404
792 Ga0105240_10094826
793 Ga0105240_12103254
794 Ga0105245_10140555
795 Ga0105245_10322929
796 Ga0105247_10077972
797 Ga0105247_10148108
798 Ga0105243_10087060
799 Ga0105243_10614560
800 Ga0105241_10118544
801 Ga0105241_10239550
802 Ga0105241_11189725
803 Ga0105242_13210832
804 Ga0105248_11001681
805 Ga0105248_11014793
806 Ga0105248_12446591
807 Ga0105237_10049068
808 Ga0105237_10232446
809 Ga0105237_10375797
810 Ga0105237_10747440
811 Ga0105237_11370544
812 Ga0105237_11644018
813 Ga0105238_11177319
814 Ga0105238_11270526
815 Ga0105238_11324146
816 Ga0105239_10177849
817 Ga0105239_10199125
818 Ga0105239_10243610
819 Ga0105239_10318234
820 Ga0105239_10650910
821 Ga0105239_11079269
822 Ga0105246_10058664
823 Ga0105246_10209779
824 Ga0157370_10200982
825 Ga0157369_10401159
826 Ga0157374_10347743
827 Ga0157374_11641296
828 Ga0157378_10181967
829 Ga0163162_11511416
830 Ga0157372_10676988
831 Ga0157375_10212932
832 Ga0163163_10030090
833 Ga0163163_10165705
834 Ga0163163_10543199
835 Ga0182008_10110720
836 Ga0157377_10344224
837 Ga0157379_10387784
838 Ga0157379_11922316
839 Ga0157376_10396571
840 Ga0157376_10858015
841 Ga0157376_10932181
842 Ga0182006_1145355
843 Ga0182005_1004190
844 Ga0163161_10207888
845 Ga0163161_11256227
846 Ga0213876_10123226
847 Ga0213875_10163579
848 Ga0209563_103243
849 Ga0209677_108017
850 Ga0209148_1000282
851 Ga0209233_1000695
852 Ga0209233_1002488
853 Ga0209233_1003161
854 Ga0209455_1011548
855 Ga0209455_1011758
856 Ga0209455_1033495
857 Ga0209564_1010903
858 Ga0209758_1002661
859 Ga0209758_1004375
860 Ga0209758_1009733
861 Ga0209758_1183442
862 Ga0207426_1005286
863 Ga0207426_1011025
864 Ga0207426_1014790
865 Ga0207426_1018351
866 Ga0209257_1018498
867 Ga0209257_1023083
868 Ga0207710_10090473
869 Ga0207710_10129073
870 Ga0207688_10188165
871 Ga0207680_10383279
872 Ga0207647_10009663
873 Ga0207705_10833616
874 Ga0207654_10041579
875 Ga0207654_10103295
876 Ga0207695_10001820
877 Ga0207671_10008398
878 Ga0207657_10198773
879 Ga0207649_10391741
880 Ga0207649_10869921
881 Ga0207681_10366423
882 Ga0207694_10217226
883 Ga0207694_10458054
884 Ga0207694_10913158
885 Ga0207650_10843572
886 Ga0207687_10355179
887 Ga0207687_10784764
888 Ga0207644_10044985
889 Ga0207690_10409035
890 Ga0207690_10896564
891 Ga0207706_10148334
892 Ga0207686_10779322
893 Ga0207665_10917986
894 Ga0207711_10132470
895 Ga0207711_10398245
896 Ga0207711_11034742
897 Ga0207689_10412527
898 Ga0207667_11829761
899 Ga0207712_10590112
900 Ga0207668_10189853
901 Ga0207668_11087850
902 Ga0207640_10164648
903 Ga0207640_10251747
904 Ga0207677_10296540
905 Ga0207703_10728206
906 Ga0207639_10089808
907 Ga0207639_10638677
908 Ga0207678_10321928
909 Ga0207678_10470639
910 Ga0207702_11566453
911 Ga0207641_10308630
912 Ga0207641_11363962
913 Ga0207648_10408092
914 Ga0207676_10910463
915 Ga0207674_10042432
916 Ga0207674_11323254
917 Ga0207675_100649090
918 Ga0207698_10337660
919 Ga0207698_12148105
920 Ga0209389_1000033
921 Ga0209389_1000071
922 Ga0209589_1000021
923 Ga0209589_1000040
924 Ga0209489_100028
925 Ga0209489_100045
926 Ga0209489_100209
927 Ga0209700_100011
928 Ga0209700_100037
929 Ga0209813_10025654
930 Ga0268266_10250699
931 Ga0268256_1005446
932 Ga0307408_101976030
933 Ga0307508_10269155
934 Ga0307518_10055895
935 Ga0307507_10501330
936 Ga0307510_10001611
937 Ga0307510_10082790
938 Ga0307510_10575598
939 Ga0315911_1000008
940 Ga0373946_0433678
941 Ga0373925_0132073
942 Ga0395899_0204301
943 Ga0395900_0001984
944 Ga0395900_0491484
945 Ga0395900_1646457
946 Ga0395898_0072727
947 Ga0395898_0952471
948 Ga0395905_0031967
949 Ga0395905_1209781
950 Ga0436364_0126097
951 Ga0395901_0008351
952 Ga0436365_0340380
953 Ga0436365_1050286
954 Ga0436365_1751333
955 Ga0436363_0529233
956 Ga0451789_0835545
957 Ga0451793_1876039
958 Ga0451797_1221557
959 Ga0451795_1015651
960 Ga0451798_0763090
961 Ga0451800_1088871
962 Ga0451802_0570304
963 Ga0451835_0334168
964 Ga0451839_1240486
965 Ga0451849_0605637
966 Ga0451843_0089561
967 Ga0451855_1583322
968 Ga0451853_2695975
969 Ga0439450_096556
970 Ga0439459_0073577
971 Ga0466969_0010492
972 Ga0466972_0000107
973 Ga0466972_0008574
974 Ga0466972_0084515
975 Ga0466965_0207782
976 Ga0466966_0001443
977 Ga0466961_0000139
978 Ga0466964_0019701
979 Ga0466964_0035033
980 Ga0466964_0215367
981 Ga0466968_0001784
982 Ga0466968_0133978
983 Ga0466968_0269628
984 Ga0466970_0032163
985 Ga0466970_0188686
986 Ga0466970_0330279
987 Ga0466957_1253708
988 Ga0466960_0010452
989 Ga0466959_0008725
990 Ga0466959_0110600
991 Ga0466959_0430582
992 Ga0466967_0053386
993 Ga0466967_0654368
994 Ga0495592_0070196
995 Ga0495592_0292088
996 Ga0495603_0293022
997 Ga0495590_0128347
998 Ga0495629_0017376
999 Ga0495629_0531542
1000 Ga0495638_0005789
1001 Ga0495638_0622716
1002 Ga0495651_0033403
1003 Ga0495651_0638561
1004 Ga0495653_0069937
1005 Ga0495653_0205132
1006 Ga0495605_0076820
1007 Ga0495605_0083007
1008 Ga0495639_0138423
1009 Ga0495662_0124703
1010 Ga0495664_0138964
1011 Ga0495664_0580778
1012 Ga0495584_0426426
1013 Ga0495594_0251508
1014 Ga0495607_0160987
1015 Ga0495583_0252429
1016 Ga0495606_0091030
1017 Ga0495606_0211356
1018 Ga0495608_0299709
1019 Ga0495610_0046565
1020 Ga0495610_0252332
1021 Ga0495616_0120469
1022 Ga0495618_0225231
1023 Ga0495628_0247359
1024 Ga0495630_0244271
1025 Ga0495631_0116136
1026 Ga0495632_0331567
1027 Ga0495643_0101501
1028 Ga0495648_0109428
1029 Ga0495648_0140926
1030 Ga0495648_0202216
1031 Ga0495648_0327708
1032 Ga0495652_0006980
1033 Ga0495652_0562677
1034 Ga0495665_0343244
1035 Ga0495640_0070958
1036 Ga0495587_0213873
1037 Ga0495609_0033354
1038 Ga0495597_0098900
1039 Ga0495597_0287346
1040 Ga0495597_0309606
1041 Ga0495645_0002450
1042 Ga0495622_0157696
1043 Ga0495622_0385540
1044 Ga0495668_0020031
1045 Ga0495668_0484582
1046 Ga0495668_0809347
1047 Ga0495611_0216625
1048 Ga0495625_0000064
1049 Ga0495625_0148045
1050 Ga0495625_0263675
1051 Ga0495625_0549193
1052 Ga0495635_0003741
1053 Ga0495635_0023565
1054 Ga0495661_0129858
1055 Ga0495661_0233284
1056 Ga0495588_0118005
1057 Ga0495588_0425938
1058 Ga0495657_0009503
1059 Ga0495657_0323893
1060 Ga0495657_0561190
1061 Ga0495599_0089929
1062 Ga0495599_0296518
1063 Ga0495623_0001404
1064 Ga0495646_0060345
1065 Ga0495646_0073653
1066 Ga0495613_0028252
1067 Ga0495624_0015565
1068 Ga0495624_0680454
1069 Ga0495671_0106542
1070 Ga0495649_0147417
1071 Ga0495649_0249318
1072 Ga0495649_0325051
1073 Ga0495600_0001928
1074 Ga0495600_0047383
1075 Ga0495581_0391463
1076 Ga0495604_0011547
1077 Ga0495604_0147638
1078 Ga0495674_0114962
1079 Ga0495672_0443067
1080 Ga0495676_0050960
1081 Ga0495676_0168359
1082 Ga0495680_0002812
1083 Ga0495680_0180949
1084 Ga0495687_028038
1085 Ga0495675_0140065
1086 Ga0495675_0152904
1087 Ga0495673_0140425
1088 Ga0495684_0280689
1089 Ga0495686_0111833
1090 Ga0495686_0177680
1091 Ga0495593_0106511
1092 Ga0495602_0058524
1093 Ga0495602_0116441
1094 Ga0495626_0046703
1095 Ga0496100_0595124
1096 Ga0496101_0181034
1097 Ga0496101_0303322
1098 Ga0496101_0338626
1099 Ga0496102_0122925
1100 Ga0496102_0306004
1101 Ga0496102_0401534
1102 Ga0496103_0004777
1103 Ga0496104_0073029
1104 Ga0496104_0353323
1105 Ga0496104_0459688
1106 Ga0496104_0507606
1107 Ga0496104_0661397
1108 Ga0496105_0041443
1109 Ga0496105_0242727
1110 Ga0496105_0280557
1111 Ga0496106_0407644
1112 Ga0496107_0432169
1113 Ga0496107_0468291
1114 Ga0496108_0791450
1115 Ga0496108_0833716
1116 Ga0496108_0949535
1117 Ga0496109_0031109
1118 Ga0496109_0374378
1119 Ga0496109_0661294
1120 Ga0496110_0093586
1121 Ga0496110_0227496
1122 Ga0496110_0550624
1123 Ga0496111_0265951
1124 Ga0496112_0063855
1125 Ga0496112_0092258
1126 Ga0496112_0154731
1127 Ga0496113_0074130
1128 Ga0496113_0138556
1129 Ga0496113_0325121
1130 Ga0496113_1117619
1131 Ga0496114_0086183
1132 Ga0496114_0220173
1133 Ga0496114_0921029
1134 Ga0496114_1219761
1135 Ga0496115_0102842
1136 Ga0496115_0261375
1137 Ga0496115_0764743
1138 Ga0496116_0053513
1139 Ga0496117_0123519
1140 Ga0496117_0223485
1141 Ga0496118_0017923
1142 Ga0496118_0047930
1143 Ga0496118_0053477
1144 Ga0496118_0240125
1145 Ga0496118_0476262
1146 Ga0496119_0021482
1147 Ga0496119_0111285
1148 Ga0496119_0353796
1149 Ga0496120_0033990
1150 Ga0496121_0028517
1151 Ga0496121_0101293
1152 Ga0496121_0137375
1153 Ga0496121_0152975
1154 Ga0496121_0167971
1155 Ga0496122_0160967
1156 Ga0496122_0487882
1157 Ga0496123_0025175
1158 Ga0496123_0075063
1159 Ga0496123_0186867
1160 Ga0496124_0061116
1161 Ga0496124_0110022
1162 Ga0496124_0414609
1163 Ga0496124_0796880
1164 Ga0496125_0072775
1165 Ga0496125_0119412
1166 Ga0496125_0120568
1167 Ga0496126_0188156
1168 Ga0496126_0200161
1169 Ga0496126_0213561
1170 Ga0496126_0496298
1171 Ga0496126_0763062
1172 Ga0496126_0783637
1173 Ga0495682_0076466
1174 Ga0495682_0155752
1175 Ga0495682_0177889
1176 nmdc:mga03n38_20260_c1
1177 nmdc:mga00v17_235849_c1
1178 nmdc:mga00v17_545120_c1
1179 nmdc:mga0yw44_19658_c1
1180 nmdc:mga0yw44_45640_c1
1181 nmdc:mga0yw44_55424_c1
1182 nmdc:mga0k408_137965_c1
1183 nmdc:mga06z11_96927_c1
1184 nmdc:mga04h51_4544_c1
1185 nmdc:mga07m45_36038_c1
1186 nmdc:mga07m45_363767_c1
1187 nmdc:mga0sz30_115276_c1
1188 nmdc:mga0sz30_25309_c1
1189 nmdc:mga0sz30_58466_c1
1190 Ga0495655_0035275
1191 Ga0495655_0043411
1192 Ga0495619_0153641
1193 Ga0500578_0046543
1194 Ga0500578_0387803
1195 Ga0500643_000063
1196 Ga0500646_0064806
1197 Ga0500583_0041342
1198 Ga0500566_0016175
1199 Ga0500566_0307095
1200 Ga0500640_177755
1201 Ga0500641_0058137
1202 Ga0500650_0069634
1203 Ga0500555_001844
1204 Ga0500556_0004073
1205 Ga0500557_000037
1206 Ga0500558_250961
1207 Ga0500562_003526
1208 Ga0500572_115119
1209 Ga0500592_017639
1210 Ga0500594_0114444
1211 Ga0500595_030629
1212 Ga0500597_399197
1213 Ga0500607_053714
1214 Ga0500607_067406
1215 Ga0500608_210603
1216 Ga0500618_149585
1217 Ga0500621_200918
1218 Ga0500642_0000153
1219 Ga0500642_0023235
1220 Ga0500658_0041584
1221 Ga0500559_0093106
1222 Ga0500559_0246128
1223 Ga0500568_0018223
1224 Ga0500577_0265358
1225 Ga0500577_0523714
1226 Ga0500588_0038032
1227 Ga0500588_0401619
1228 Ga0500603_194509
1229 Ga0500604_0029036
1230 Ga0500604_0129428
1231 Ga0500616_0008592
1232 Ga0500619_001466
1233 Ga0500620_025213
1234 Ga0500622_0006417
1235 Ga0500622_0309384
1236 Ga0500627_0010437
1237 Ga0500634_0039678
1238 Ga0500634_0043079
1239 Ga0500638_111126
1240 Ga0500636_0000197
1241 Ga0500637_0358161
1242 Ga0500649_179309
1243 Ga0500611_070643
1244 Ga0500625_034396
1245 Ga0500625_224190
1246 Ga0500645_035494
1247 Ga0500645_142127
1248 Ga0500599_004775
1249 Ga0500599_007097
1250 Ga0500601_000391
1251 2507505265
1252 2508539186
1253 2508695505
1254 2511400201
1255 2513644661
1256 2513651496
1257 2513658839
1258 2513720285
1259 2513921103
1260 2515627462
1261 2517107692
1262 2517888867
1263 2524537023
1264 2528852957
1265 2671122473
1266 2728755011
1267 2793062061
1268 2793072955
1269 2818237669
1270 2819717658
1271 2824604565
1272 2824612344
1273 2824655209
1274 2824667580
1275 2824713103
1276 2824759936
1277 2824770370
1278 2844315355
1279 2847931093
1280 2874594465
1281 2874624802
1282 2874628775
1283 2874649838
1284 2876773957
1285 2876821837
1286 2879078319
1287 2879085928
1288 2879106001
1289 2879130579
1290 2879147144
1291 2881668166
1292 2885382828
1293 2888379571
1294 2888390660
1295 2888420287
1296 2903732216
1297 2903751496
1298 2904670243
1299 2904708684
1300 2904713198
1301 2906604293
1302 2906613896
1303 2906642306
1304 2906648157
1305 2906667334
1306 2908747467
1307 2922368913
1308 2922434202
1309 2929618621
1310 2929628694
1311 2932793735
1312 2932794297
1313 2932808110
1314 2932812144
1315 2932823134
1316 2932836052
1317 2933580667
1318 2935615704
1319 2935618541
1320 2935636519
1321 2935641058
1322 2935653621
1323 2935662370
1324 2935669974
1325 2935679177
1326 2935686423
1327 2935700204
1328 2935711501
1329 2935716111
1330 2935723765
1331 2935735320
1332 2935743889
1333 2935752389
1334 2935763514
1335 2935773021
1336 2935782964
1337 2935787990
1338 2935796434
1339 2935809938
1340 2935816243
1341 2935825498
1342 2935835637
1343 2935844588
1344 2935853287
1345 2935862966
1346 2935866708
1347 2935875015
1348 2935890075
1349 2935914760
1350 2935918736
1351 2935931547
1352 2935940144
1353 2935947509
1354 2935956281
1355 2935962657
1356 2935973074
1357 2935980683
1358 2935985163
1359 2935999709
1360 2936010594
1361 2936016672
1362 2936025305
1363 2936034147
1364 2936041248
1365 2936052204
1366 2936056335
1367 2939673430
1368 2940558302
1369 2941513154
1370 2941521191
1371 2941528872
1372 2941535493
1373 2941543227
1374 3005475088
1375 3005595070
1376 3005711018
1377 3005718323
1378 8006928944
1379 8006936202
1380 8006976148
1381 8016518161
1382 8016526161
1383 8016539774
1384 8016544080
1385 8016549229
1386 8016557654
1387 8016569483
1388 8016582096
1389 8016595689
1390 8016606543
1391 8016623138
1392 8016635603
1393 8017058485
1394 8019531051
1395 8019540529
1396 8019550150
1397 8019562432
1398 8019572504
1399 8019577210
1400 8019595288
1401 8019606467
1402 8019612055
1403 8019622992
1404 8019630112
1405 8019640502
1406 8019652448
1407 8019666946
1408 8019676703
1409 8019679285
1410 8019696217
1411 8055742471
1412 8056971308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ni8-assembly1.cif.gz_A crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum 0.7572 13 95
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.757 12 96
4qck-assembly1.cif.gz_A crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. tuberculosis in complex with 4-androstene-3,17-dione 0.7542 56 96
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.7538 13 96
7ony-assembly1.cif.gz_A crystal structure of pbp3 from p. aeruginosa 0.7367 59 96
ID Description Score Start End Superfamily
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7822 12 96 3.30.530.20
af_A0A1D6FG83_297_420_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7794 13 94 3.30.310.80
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7751 14 96 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7659 13 96 3.30.530.20
af_I1MSU0_301_424_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7653 12 96 3.30.310.80
ID Description Score Start End GO Terms
AF-A0A2D8KNY8-F1-model_v4 Polyketide cyclase 0.8278 11 96 GO:0016020
AF-A0A2N1VQN1-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.8256 11 96
AF-A0A538KK31-F1-model_v4 SRPBCC family protein 0.825 12 96
AF-A0A0B8WVU4-F1-model_v4 Polyketide cyclase 0.8246 11 96
AF-A0A7Y1U666-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.8211 11 95 GO:0016020

Map