F476450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 706 | 317 | 1412 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100024080|Ga0070683_1000240801 |
| Length | 395 |
| Sequence | MTQSQFTRQELLRRGLAGSALLTVPGLLAACGSGSKGAASTSTTSGKQQLAKTLHFSNWTLYIDVNNKTKSHPSLQAFQQRYGTHVDYVEDINDNASYFGKIQGALSRGQSINRDIIVMTDNDRYLSLMIKKGWTEKLDKSAIPNIKNLVEVQRHPTFDPNREYSLPWQSGMTGIAYNDKLTDPVLSVTDLLENPKLKGKVTSLNSMGDALTLVMLANGDDPSHVTDKSFSAAFNRIKKAVDDKQIRQFTGNDYAPSLAKGDLAAAMSWSGDIAQIGNSHIHWNVPKDGGALWTDNMIIPKGGNVYTASVYMNYVYDPSVMGLMEAGDPKRNITGIYYIPPVIGAKQAALKLNPAVANNQLIFPSAETLSKVHLFDSAALNNQKYLTQWQNLISG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 157 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 179 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 180 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 192 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 2.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 14.31 |
| Rhizosphere | 84.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100024080 | 3300005329 | Bacteria | 5448 |
| 2 | JGI25407J50210_10001565 | 3300003373 | Bacteria | 5212 |
| 3 | JGI25404J52841_10024007 | 3300003659 | Unclassified | 1315 |
| 4 | Ga0058862_10004946 | 3300004803 | Bacteria | 2033 |
| 5 | Ga0058862_12749158 | 3300004803 | Bacteria | 1709 |
| 6 | Ga0070658_10023603 | 3300005327 | Bacteria | 4935 |
| 7 | Ga0070683_100120480 | 3300005329 | Bacteria | 2478 |
| 8 | Ga0070683_100124997 | 3300005329 | Bacteria | 2431 |
| 9 | Ga0070683_100152225 | 3300005329 | Bacteria | 2193 |
| 10 | Ga0070690_100013723 | 3300005330 | Bacteria | 4798 |
| 11 | Ga0068869_100087515 | 3300005334 | Bacteria | 2337 |
| 12 | Ga0070666_10121607 | 3300005335 | Unclassified | 1811 |
| 13 | Ga0070680_100007965 | 3300005336 | Bacteria | 8088 |
| 14 | Ga0070680_100047719 | 3300005336 | Bacteria | 3487 |
| 15 | Ga0070680_100073798 | 3300005336 | Bacteria | 2806 |
| 16 | Ga0070680_100102155 | 3300005336 | Bacteria | 2381 |
| 17 | Ga0070680_100107399 | 3300005336 | Bacteria | 2322 |
| 18 | Ga0070680_100236375 | 3300005336 | Bacteria | 1544 |
| 19 | Ga0070682_100020440 | 3300005337 | Bacteria | 3895 |
| 20 | Ga0070682_100024510 | 3300005337 | Bacteria | 3592 |
| 21 | Ga0068868_100048270 | 3300005338 | Bacteria | 3339 |
| 22 | Ga0068868_100148533 | 3300005338 | Bacteria | 1929 |
| 23 | Ga0070660_100005513 | 3300005339 | Bacteria | 8764 |
| 24 | Ga0070660_100040732 | 3300005339 | Bacteria | 3537 |
| 25 | Ga0070689_100008321 | 3300005340 | Bacteria | 7303 |
| 26 | Ga0070691_10043552 | 3300005341 | Bacteria | 2126 |
| 27 | Ga0070661_100014914 | 3300005344 | Bacteria | 5480 |
| 28 | Ga0070661_100043625 | 3300005344 | Bacteria | 3276 |
| 29 | Ga0070661_100130148 | 3300005344 | Bacteria | 1889 |
| 30 | Ga0070692_10002761 | 3300005345 | Bacteria | 6912 |
| 31 | Ga0070668_100030525 | 3300005347 | Bacteria | 4097 |
| 32 | Ga0070668_100160967 | 3300005347 | Bacteria | 1821 |
| 33 | Ga0070675_100243693 | 3300005354 | Unclassified | 1571 |
| 34 | Ga0070674_100022407 | 3300005356 | Bacteria | 4074 |
| 35 | Ga0070674_100023154 | 3300005356 | Bacteria | 4015 |
| 36 | Ga0070688_100014573 | 3300005365 | Bacteria | 4458 |
| 37 | Ga0070659_100042536 | 3300005366 | Bacteria | 3552 |
| 38 | Ga0070659_100070140 | 3300005366 | Bacteria | 2783 |
| 39 | Ga0070709_10008900 | 3300005434 | Bacteria | 5526 |
| 40 | Ga0070709_10181712 | 3300005434 | Unclassified | 1477 |
| 41 | Ga0070714_100014369 | 3300005435 | Bacteria | 6359 |
| 42 | Ga0070714_100025272 | 3300005435 | Bacteria | 4899 |
| 43 | Ga0070714_100056819 | 3300005435 | Bacteria | 3348 |
| 44 | Ga0070713_100028424 | 3300005436 | Bacteria | 4415 |
| 45 | Ga0070713_100050775 | 3300005436 | Bacteria | 3427 |
| 46 | Ga0070713_100057501 | 3300005436 | Bacteria | 3239 |
| 47 | Ga0070713_100258493 | 3300005436 | Bacteria | 1591 |
| 48 | Ga0070710_10001625 | 3300005437 | Bacteria | 10618 |
| 49 | Ga0070710_10005790 | 3300005437 | Bacteria | 5891 |
| 50 | Ga0070711_100009827 | 3300005439 | Bacteria | 5900 |
| 51 | Ga0070705_100012181 | 3300005440 | Bacteria | 4364 |
| 52 | Ga0070705_100015497 | 3300005440 | Bacteria | 3944 |
| 53 | Ga0070705_100022314 | 3300005440 | Bacteria | 3381 |
| 54 | Ga0070705_100120813 | 3300005440 | Unclassified | 1691 |
| 55 | Ga0070700_100028398 | 3300005441 | Bacteria | 3327 |
| 56 | Ga0070700_100062090 | 3300005441 | Bacteria | 2360 |
| 57 | Ga0070694_100021115 | 3300005444 | Bacteria | 4158 |
| 58 | Ga0070694_100042816 | 3300005444 | Bacteria | 3025 |
| 59 | Ga0070694_100108864 | 3300005444 | Bacteria | 1971 |
| 60 | Ga0070708_100027320 | 3300005445 | Bacteria | 4896 |
| 61 | Ga0070708_100028883 | 3300005445 | Bacteria | 4776 |
| 62 | Ga0070708_100132313 | 3300005445 | Bacteria | 2309 |
| 63 | Ga0070678_100000442 | 3300005456 | Bacteria | 19620 |
| 64 | Ga0070678_100023110 | 3300005456 | Bacteria | 4137 |
| 65 | Ga0070678_100084059 | 3300005456 | Bacteria | 2421 |
| 66 | Ga0070662_100005385 | 3300005457 | Bacteria | 8170 |
| 67 | Ga0070662_100068740 | 3300005457 | Bacteria | 2605 |
| 68 | Ga0070681_10026263 | 3300005458 | Bacteria | 5853 |
| 69 | Ga0070681_10069858 | 3300005458 | Bacteria | 3478 |
| 70 | Ga0070681_10109059 | 3300005458 | Bacteria | 2708 |
| 71 | Ga0068867_100006216 | 3300005459 | Bacteria | 8457 |
| 72 | Ga0070685_10004918 | 3300005466 | Bacteria | 6759 |
| 73 | Ga0070706_100005519 | 3300005467 | Bacteria | 12039 |
| 74 | Ga0070706_100009854 | 3300005467 | Bacteria | 8877 |
| 75 | Ga0070706_100178289 | 3300005467 | Bacteria | 1984 |
| 76 | Ga0070707_100001518 | 3300005468 | Bacteria | 22613 |
| 77 | Ga0070707_100010429 | 3300005468 | Bacteria | 8654 |
| 78 | Ga0070707_100072782 | 3300005468 | Bacteria | 3313 |
| 79 | Ga0070707_100151579 | 3300005468 | Bacteria | 2257 |
| 80 | Ga0070707_100195534 | 3300005468 | Bacteria | 1972 |
| 81 | Ga0070698_100001085 | 3300005471 | Bacteria | 29891 |
| 82 | Ga0070698_100010575 | 3300005471 | Bacteria | 9836 |
| 83 | Ga0070698_100011117 | 3300005471 | Bacteria | 9562 |
| 84 | Ga0070699_100023472 | 3300005518 | Bacteria | 5313 |
| 85 | Ga0070679_100027668 | 3300005530 | Bacteria | 5582 |
| 86 | Ga0070679_100032458 | 3300005530 | Bacteria | 5165 |
| 87 | Ga0070679_100077214 | 3300005530 | Bacteria | 3319 |
| 88 | Ga0070684_100028844 | 3300005535 | Bacteria | 4697 |
| 89 | Ga0070684_100087881 | 3300005535 | Bacteria | 2760 |
| 90 | Ga0070684_100099924 | 3300005535 | Bacteria | 2590 |
| 91 | Ga0070684_100134936 | 3300005535 | Bacteria | 2228 |
| 92 | Ga0070697_100032076 | 3300005536 | Bacteria | 4225 |
| 93 | Ga0070697_100070504 | 3300005536 | Bacteria | 2865 |
| 94 | Ga0068853_100030464 | 3300005539 | Bacteria | 4556 |
| 95 | Ga0070686_100023451 | 3300005544 | Bacteria | 3687 |
| 96 | Ga0070695_100030883 | 3300005545 | Bacteria | 3337 |
| 97 | Ga0070696_100039202 | 3300005546 | Bacteria | 3272 |
| 98 | Ga0070696_100046404 | 3300005546 | Bacteria | 3012 |
| 99 | Ga0070693_100024395 | 3300005547 | Bacteria | 3243 |
| 100 | Ga0070693_100062394 | 3300005547 | Bacteria | 2169 |
| 101 | Ga0070665_100035292 | 3300005548 | Bacteria | 5028 |
| 102 | Ga0070665_100095175 | 3300005548 | Bacteria | 2983 |
| 103 | Ga0070704_100026780 | 3300005549 | Bacteria | 3815 |
| 104 | Ga0068855_100029141 | 3300005563 | Bacteria | 6602 |
| 105 | Ga0068855_100051058 | 3300005563 | Bacteria | 4871 |
| 106 | Ga0068855_100081129 | 3300005563 | Bacteria | 3760 |
| 107 | Ga0068855_100110835 | 3300005563 | Bacteria | 3150 |
| 108 | Ga0068855_100113296 | 3300005563 | Bacteria | 3111 |
| 109 | Ga0068855_100280966 | 3300005563 | Unclassified | 1848 |
| 110 | Ga0068855_100293109 | 3300005563 | Bacteria | 1803 |
| 111 | Ga0068855_100318484 | 3300005563 | Bacteria | 1720 |
| 112 | Ga0068857_100144954 | 3300005577 | Bacteria | 2149 |
| 113 | Ga0068857_100160396 | 3300005577 | Bacteria | 2040 |
| 114 | Ga0068856_100026471 | 3300005614 | Bacteria | 5656 |
| 115 | Ga0068856_100035486 | 3300005614 | Bacteria | 4887 |
| 116 | Ga0068856_100058209 | 3300005614 | Bacteria | 3816 |
| 117 | Ga0068856_100326582 | 3300005614 | Bacteria | 1552 |
| 118 | Ga0068856_100347152 | 3300005614 | Bacteria | 1502 |
| 119 | Ga0070702_100012399 | 3300005615 | Bacteria | 4270 |
| 120 | Ga0070702_100028539 | 3300005615 | Bacteria | 3025 |
| 121 | Ga0070702_100048106 | 3300005615 | Bacteria | 2426 |
| 122 | Ga0068852_100092908 | 3300005616 | Bacteria | 2703 |
| 123 | Ga0068852_100111759 | 3300005616 | Bacteria | 2485 |
| 124 | Ga0068864_100191535 | 3300005618 | Bacteria | 1875 |
| 125 | Ga0068866_10004144 | 3300005718 | Bacteria | 5944 |
| 126 | Ga0068861_100049753 | 3300005719 | Bacteria | 3175 |
| 127 | Ga0068861_100076174 | 3300005719 | Bacteria | 2614 |
| 128 | Ga0068861_100210483 | 3300005719 | Bacteria | 1637 |
| 129 | Ga0081455_10001178 | 3300005937 | Bacteria | 32690 |
| 130 | Ga0081455_10005512 | 3300005937 | Bacteria | 13870 |
| 131 | Ga0081455_10048055 | 3300005937 | Bacteria | 3690 |
| 132 | Ga0081538_10000138 | 3300005981 | Bacteria | 75121 |
| 133 | Ga0081540_1002348 | 3300005983 | Bacteria | 15492 |
| 134 | Ga0081540_1008368 | 3300005983 | Bacteria | 7229 |
| 135 | Ga0070717_10030764 | 3300006028 | Bacteria | 4314 |
| 136 | Ga0070717_10040175 | 3300006028 | Bacteria | 3809 |
| 137 | Ga0070717_10054826 | 3300006028 | Bacteria | 3288 |
| 138 | Ga0070717_10144535 | 3300006028 | Bacteria | 2054 |
| 139 | Ga0075432_10009109 | 3300006058 | Bacteria | 3382 |
| 140 | Ga0070715_10000120 | 3300006163 | Bacteria | 18786 |
| 141 | Ga0070715_10113269 | 3300006163 | Bacteria | 1283 |
| 142 | Ga0070716_100072825 | 3300006173 | Bacteria | 2025 |
| 143 | Ga0070712_100006659 | 3300006175 | Bacteria | 7183 |
| 144 | Ga0070712_100031018 | 3300006175 | Bacteria | 3598 |
| 145 | Ga0075362_10021821 | 3300006177 | Bacteria | 2692 |
| 146 | Ga0097621_100086202 | 3300006237 | Bacteria | 2620 |
| 147 | Ga0097621_100167090 | 3300006237 | Bacteria | 1894 |
| 148 | Ga0097621_100193196 | 3300006237 | Bacteria | 1764 |
| 149 | Ga0068871_100003070 | 3300006358 | Bacteria | 11453 |
| 150 | Ga0068871_100025871 | 3300006358 | Bacteria | 4572 |
| 151 | Ga0068871_100068128 | 3300006358 | Bacteria | 2921 |
| 152 | Ga0075428_100048614 | 3300006844 | Bacteria | 4655 |
| 153 | Ga0075430_100014061 | 3300006846 | Bacteria | 6823 |
| 154 | Ga0075433_10028527 | 3300006852 | Bacteria | 4746 |
| 155 | Ga0075433_10038801 | 3300006852 | Bacteria | 4115 |
| 156 | Ga0075434_100032472 | 3300006871 | Bacteria | 5147 |
| 157 | Ga0075434_100036266 | 3300006871 | Bacteria | 4878 |
| 158 | Ga0075434_100137850 | 3300006871 | Bacteria | 2459 |
| 159 | Ga0075429_100189634 | 3300006880 | Bacteria | 1801 |
| 160 | Ga0068865_100008117 | 3300006881 | Bacteria | 6479 |
| 161 | Ga0068865_100304828 | 3300006881 | Bacteria | 1276 |
| 162 | Ga0075436_100020126 | 3300006914 | Bacteria | 4580 |
| 163 | Ga0075436_100148785 | 3300006914 | Bacteria | 1647 |
| 164 | Ga0075435_100033701 | 3300007076 | Bacteria | 4052 |
| 165 | Ga0105250_10025459 | 3300009092 | Bacteria | 2384 |
| 166 | Ga0105240_10015896 | 3300009093 | Bacteria | 10208 |
| 167 | Ga0105240_10039055 | 3300009093 | Bacteria | 6082 |
| 168 | Ga0105240_10059512 | 3300009093 | Bacteria | 4767 |
| 169 | Ga0111539_10099690 | 3300009094 | Bacteria | 3411 |
| 170 | Ga0111539_10406537 | 3300009094 | Bacteria | 1585 |
| 171 | Ga0105245_10011919 | 3300009098 | Bacteria | 7560 |
| 172 | Ga0105245_10048211 | 3300009098 | Bacteria | 3810 |
| 173 | Ga0105245_10077461 | 3300009098 | Bacteria | 3031 |
| 174 | Ga0105245_10118994 | 3300009098 | Bacteria | 2465 |
| 175 | Ga0105245_10189653 | 3300009098 | Bacteria | 1968 |
| 176 | Ga0105247_10016213 | 3300009101 | Bacteria | 4464 |
| 177 | Ga0114129_10171013 | 3300009147 | Bacteria | 2962 |
| 178 | Ga0114129_10176202 | 3300009147 | Bacteria | 2912 |
| 179 | Ga0105243_10006519 | 3300009148 | Bacteria | 9020 |
| 180 | Ga0105243_10124923 | 3300009148 | Bacteria | 2175 |
| 181 | Ga0105243_10307683 | 3300009148 | Bacteria | 1439 |
| 182 | Ga0105241_10161272 | 3300009174 | Bacteria | 1843 |
| 183 | Ga0105242_10018967 | 3300009176 | Bacteria | 5387 |
| 184 | Ga0105242_10020103 | 3300009176 | Bacteria | 5233 |
| 185 | Ga0105242_10061511 | 3300009176 | Bacteria | 3089 |
| 186 | Ga0105242_10084480 | 3300009176 | Bacteria | 2660 |
| 187 | Ga0105248_10081226 | 3300009177 | Bacteria | 3644 |
| 188 | Ga0105248_10103575 | 3300009177 | Bacteria | 3208 |
| 189 | Ga0105237_10010937 | 3300009545 | Bacteria | 9629 |
| 190 | Ga0105237_10083602 | 3300009545 | Bacteria | 3183 |
| 191 | Ga0105237_10109684 | 3300009545 | Bacteria | 2751 |
| 192 | Ga0105238_10059323 | 3300009551 | Bacteria | 3833 |
| 193 | Ga0105238_10164767 | 3300009551 | Bacteria | 2192 |
| 194 | Ga0105238_10276644 | 3300009551 | Bacteria | 1659 |
| 195 | Ga0105249_10000948 | 3300009553 | Bacteria | 25660 |
| 196 | Ga0105249_10018638 | 3300009553 | Bacteria | 6181 |
| 197 | Ga0105239_10039360 | 3300010375 | Bacteria | 5181 |
| 198 | Ga0105239_10116859 | 3300010375 | Bacteria | 2960 |
| 199 | Ga0105246_10121086 | 3300011119 | Unclassified | 1939 |
| 200 | Ga0157371_10059178 | 3300013102 | Bacteria | 2716 |
| 201 | Ga0157370_10030838 | 3300013104 | Bacteria | 5252 |
| 202 | Ga0157369_10045756 | 3300013105 | Bacteria | 4758 |
| 203 | Ga0157369_10337990 | 3300013105 | Unclassified | 1564 |
| 204 | Ga0157369_10357056 | 3300013105 | Bacteria | 1517 |
| 205 | Ga0157374_10034025 | 3300013296 | Bacteria | 4652 |
| 206 | Ga0157374_10050794 | 3300013296 | Bacteria | 3855 |
| 207 | Ga0157374_10053238 | 3300013296 | Bacteria | 3772 |
| 208 | Ga0157374_10135952 | 3300013296 | Bacteria | 2383 |
| 209 | Ga0157374_10183535 | 3300013296 | Bacteria | 2045 |
| 210 | Ga0157378_10067816 | 3300013297 | Bacteria | 3198 |
| 211 | Ga0157378_10255667 | 3300013297 | Unclassified | 1679 |
| 212 | Ga0157378_10268832 | 3300013297 | Bacteria | 1639 |
| 213 | Ga0163162_10023656 | 3300013306 | Bacteria | 6066 |
| 214 | Ga0163162_10080663 | 3300013306 | Bacteria | 3322 |
| 215 | Ga0163162_10168503 | 3300013306 | Bacteria | 2314 |
| 216 | Ga0163162_10219089 | 3300013306 | Bacteria | 2033 |
| 217 | Ga0157372_10011814 | 3300013307 | Bacteria | 9303 |
| 218 | Ga0157372_10090271 | 3300013307 | Bacteria | 3483 |
| 219 | Ga0157372_10206990 | 3300013307 | Bacteria | 2273 |
| 220 | Ga0157372_10209151 | 3300013307 | Bacteria | 2261 |
| 221 | Ga0157372_10227629 | 3300013307 | Bacteria | 2161 |
| 222 | Ga0157372_10238196 | 3300013307 | Bacteria | 2111 |
| 223 | Ga0157372_10383932 | 3300013307 | Unclassified | 1636 |
| 224 | Ga0157375_10029269 | 3300013308 | Bacteria | 5177 |
| 225 | Ga0157375_10129179 | 3300013308 | Bacteria | 2645 |
| 226 | Ga0157377_10025925 | 3300014745 | Bacteria | 3131 |
| 227 | Ga0157376_10005458 | 3300014969 | Bacteria | 8886 |
| 228 | Ga0157376_10014185 | 3300014969 | Bacteria | 5971 |
| 229 | Ga0163161_10237547 | 3300017792 | Unclassified | 1416 |
| 230 | Ga0197907_11238927 | 3300020069 | Bacteria | 5708 |
| 231 | Ga0197907_11268062 | 3300020069 | Bacteria | 2137 |
| 232 | Ga0206350_10538545 | 3300020080 | Bacteria | 2267 |
| 233 | Ga0224712_10009892 | 3300022467 | Bacteria | 2894 |
| 234 | Ga0207696_1026201 | 3300025711 | Bacteria | 1806 |
| 235 | Ga0207653_10023673 | 3300025885 | Bacteria | 1957 |
| 236 | Ga0207653_10026817 | 3300025885 | Bacteria | 1848 |
| 237 | Ga0207692_10008727 | 3300025898 | Bacteria | 4208 |
| 238 | Ga0207688_10014206 | 3300025901 | Bacteria | 4333 |
| 239 | Ga0207685_10001820 | 3300025905 | Bacteria | 4656 |
| 240 | Ga0207699_10155119 | 3300025906 | Unclassified | 1519 |
| 241 | Ga0207705_10011519 | 3300025909 | Bacteria | 6396 |
| 242 | Ga0207705_10015166 | 3300025909 | Bacteria | 5538 |
| 243 | Ga0207684_10015225 | 3300025910 | Bacteria | 6624 |
| 244 | Ga0207684_10058065 | 3300025910 | Bacteria | 3283 |
| 245 | Ga0207684_10060697 | 3300025910 | Bacteria | 3211 |
| 246 | Ga0207654_10035652 | 3300025911 | Bacteria | 2773 |
| 247 | Ga0207654_10054480 | 3300025911 | Bacteria | 2312 |
| 248 | Ga0207707_10001761 | 3300025912 | Bacteria | 19878 |
| 249 | Ga0207707_10002492 | 3300025912 | Bacteria | 16577 |
| 250 | Ga0207707_10081311 | 3300025912 | Bacteria | 2828 |
| 251 | Ga0207695_10071012 | 3300025913 | Bacteria | 3557 |
| 252 | Ga0207695_10135545 | 3300025913 | Bacteria | 2415 |
| 253 | Ga0207671_10075260 | 3300025914 | Bacteria | 2525 |
| 254 | Ga0207671_10083725 | 3300025914 | Bacteria | 2395 |
| 255 | Ga0207671_10148707 | 3300025914 | Bacteria | 1809 |
| 256 | Ga0207693_10001119 | 3300025915 | Bacteria | 24079 |
| 257 | Ga0207693_10004453 | 3300025915 | Bacteria | 11836 |
| 258 | Ga0207693_10005339 | 3300025915 | Bacteria | 10737 |
| 259 | Ga0207693_10007372 | 3300025915 | Bacteria | 9045 |
| 260 | Ga0207693_10051308 | 3300025915 | Bacteria | 3238 |
| 261 | Ga0207663_10002132 | 3300025916 | Bacteria | 9442 |
| 262 | Ga0207663_10003179 | 3300025916 | Bacteria | 7990 |
| 263 | Ga0207663_10007050 | 3300025916 | Bacteria | 5804 |
| 264 | Ga0207660_10021336 | 3300025917 | Bacteria | 4355 |
| 265 | Ga0207660_10099945 | 3300025917 | Bacteria | 2165 |
| 266 | Ga0207660_10124308 | 3300025917 | Unclassified | 1958 |
| 267 | Ga0207660_10279515 | 3300025917 | Unclassified | 1324 |
| 268 | Ga0207657_10002585 | 3300025919 | Bacteria | 19586 |
| 269 | Ga0207649_10107802 | 3300025920 | Bacteria | 1855 |
| 270 | Ga0207649_10145876 | 3300025920 | Bacteria | 1624 |
| 271 | Ga0207652_10022704 | 3300025921 | Bacteria | 5195 |
| 272 | Ga0207652_10307791 | 3300025921 | Unclassified | 1430 |
| 273 | Ga0207646_10001000 | 3300025922 | Bacteria | 36321 |
| 274 | Ga0207646_10004378 | 3300025922 | Bacteria | 15370 |
| 275 | Ga0207646_10011349 | 3300025922 | Bacteria | 8644 |
| 276 | Ga0207646_10077203 | 3300025922 | Bacteria | 2977 |
| 277 | Ga0207646_10144515 | 3300025922 | Bacteria | 2143 |
| 278 | Ga0207694_10029083 | 3300025924 | Bacteria | 4214 |
| 279 | Ga0207694_10039476 | 3300025924 | Bacteria | 3633 |
| 280 | Ga0207694_10095017 | 3300025924 | Bacteria | 2356 |
| 281 | Ga0207687_10010093 | 3300025927 | Bacteria | 6176 |
| 282 | Ga0207687_10024082 | 3300025927 | Bacteria | 4063 |
| 283 | Ga0207687_10033346 | 3300025927 | Bacteria | 3492 |
| 284 | Ga0207687_10034212 | 3300025927 | Bacteria | 3450 |
| 285 | Ga0207687_10213264 | 3300025927 | Bacteria | 1516 |
| 286 | Ga0207664_10005273 | 3300025929 | Bacteria | 8832 |
| 287 | Ga0207664_10011464 | 3300025929 | Bacteria | 6304 |
| 288 | Ga0207664_10027751 | 3300025929 | Bacteria | 4296 |
| 289 | Ga0207664_10097135 | 3300025929 | Bacteria | 2426 |
| 290 | Ga0207664_10249890 | 3300025929 | Bacteria | 1547 |
| 291 | Ga0207706_10019714 | 3300025933 | Bacteria | 6067 |
| 292 | Ga0207706_10031554 | 3300025933 | Bacteria | 4720 |
| 293 | Ga0207686_10010919 | 3300025934 | Bacteria | 4954 |
| 294 | Ga0207709_10007136 | 3300025935 | Bacteria | 6238 |
| 295 | Ga0207709_10096254 | 3300025935 | Bacteria | 1947 |
| 296 | Ga0207709_10113013 | 3300025935 | Unclassified | 1820 |
| 297 | Ga0207669_10048896 | 3300025937 | Bacteria | 2516 |
| 298 | Ga0207669_10136885 | 3300025937 | Unclassified | 1693 |
| 299 | Ga0207704_10021540 | 3300025938 | Bacteria | 3435 |
| 300 | Ga0207665_10000462 | 3300025939 | Bacteria | 27963 |
| 301 | Ga0207665_10005207 | 3300025939 | Bacteria | 8685 |
| 302 | Ga0207665_10133595 | 3300025939 | Bacteria | 1764 |
| 303 | Ga0207711_10033528 | 3300025941 | Bacteria | 4346 |
| 304 | Ga0207689_10086235 | 3300025942 | Bacteria | 2580 |
| 305 | Ga0207661_10035307 | 3300025944 | Bacteria | 3895 |
| 306 | Ga0207661_10054152 | 3300025944 | Bacteria | 3213 |
| 307 | Ga0207667_10182134 | 3300025949 | Bacteria | 2157 |
| 308 | Ga0207712_10032372 | 3300025961 | Bacteria | 3529 |
| 309 | Ga0207668_10025865 | 3300025972 | Bacteria | 3804 |
| 310 | Ga0207677_10064293 | 3300026023 | Bacteria | 2554 |
| 311 | Ga0207677_10323151 | 3300026023 | Bacteria | 1283 |
| 312 | Ga0207639_10014973 | 3300026041 | Bacteria | 5464 |
| 313 | Ga0207639_10091022 | 3300026041 | Bacteria | 2441 |
| 314 | Ga0207639_10166859 | 3300026041 | Bacteria | 1861 |
| 315 | Ga0207678_10166659 | 3300026067 | Bacteria | 1881 |
| 316 | Ga0207708_10000564 | 3300026075 | Bacteria | 28643 |
| 317 | Ga0207708_10003976 | 3300026075 | Bacteria | 10876 |
| 318 | Ga0207702_10001525 | 3300026078 | Bacteria | 22924 |
| 319 | Ga0207702_10195610 | 3300026078 | Bacteria | 1871 |
| 320 | Ga0207702_10352381 | 3300026078 | Bacteria | 1409 |
| 321 | Ga0207648_10001096 | 3300026089 | Bacteria | 30351 |
| 322 | Ga0207674_10038198 | 3300026116 | Bacteria | 4988 |
| 323 | Ga0207674_10108165 | 3300026116 | Bacteria | 2757 |
| 324 | Ga0207674_10159079 | 3300026116 | Bacteria | 2214 |
| 325 | Ga0207675_100001665 | 3300026118 | Bacteria | 22230 |
| 326 | Ga0207675_100006719 | 3300026118 | Bacteria | 10877 |
| 327 | Ga0207675_100015619 | 3300026118 | Bacteria | 7082 |
| 328 | Ga0207683_10000251 | 3300026121 | Bacteria | 47816 |
| 329 | Ga0207683_10054732 | 3300026121 | Bacteria | 3498 |
| 330 | Ga0207683_10067003 | 3300026121 | Bacteria | 3167 |
| 331 | Ga0207683_10079341 | 3300026121 | Bacteria | 2910 |
| 332 | Ga0207698_10097487 | 3300026142 | Bacteria | 2426 |
| 333 | Ga0207428_10001520 | 3300027907 | Bacteria | 24213 |
| 334 | Ga0207428_10025482 | 3300027907 | Bacteria | 4950 |
| 335 | Ga0268266_10030241 | 3300028379 | Bacteria | 4603 |
| 336 | Ga0268265_10162969 | 3300028380 | Bacteria | 1897 |
| 337 | Ga0307416_100101496 | 3300032002 | Bacteria | 2506 |
| 338 | Ga0307415_100062748 | 3300032126 | Bacteria | 2579 |
| 339 | Ga0373959_0015109 | 3300034820 | Bacteria | 1414 |
| 340 | Ga0373926_0026293 | 3300035083 | Unclassified | 2035 |
| 341 | Ga0373944_0004987 | 3300035089 | Bacteria | 3482 |
| 342 | Ga0373949_0008840 | 3300035090 | Bacteria | 2204 |
| 343 | Ga0373952_0009172 | 3300035092 | Bacteria | 1889 |
| 344 | Ga0373943_0008505 | 3300035170 | Bacteria | 4603 |
| 345 | Ga0373943_0056003 | 3300035170 | Unclassified | 1955 |
| 346 | Ga0373943_0086308 | 3300035170 | Bacteria | 1618 |
| 347 | Ga0373961_0008513 | 3300035241 | Bacteria | 2495 |
| 348 | Ga0373962_0004784 | 3300035242 | Bacteria | 3269 |
| 349 | Ga0373931_0097815 | 3300035691 | Bacteria | 1646 |
| 350 | Ga0373947_0000990 | 3300035725 | Bacteria | 17360 |
| 351 | Ga0373947_0011012 | 3300035725 | Bacteria | 5187 |
| 352 | Ga0373947_0102738 | 3300035725 | Bacteria | 1798 |
| 353 | Ga0373925_0005106 | 3300037068 | Bacteria | 9829 |
| 354 | Ga0395899_0005076 | 3300037312 | Bacteria | 10243 |
| 355 | Ga0395899_0022596 | 3300037312 | Bacteria | 4765 |
| 356 | Ga0395899_0022769 | 3300037312 | Bacteria | 4747 |
| 357 | Ga0395899_0038866 | 3300037312 | Bacteria | 3563 |
| 358 | Ga0395899_0143662 | 3300037312 | Bacteria | 1696 |
| 359 | Ga0395899_0190474 | 3300037312 | Bacteria | 1435 |
| 360 | Ga0395900_0005855 | 3300037418 | Bacteria | 12833 |
| 361 | Ga0395900_0031176 | 3300037418 | Bacteria | 5476 |
| 362 | Ga0395900_0034666 | 3300037418 | Bacteria | 5198 |
| 363 | Ga0395900_0106985 | 3300037418 | Bacteria | 2873 |
| 364 | Ga0395900_0121236 | 3300037418 | Bacteria | 2683 |
| 365 | Ga0395900_0216847 | 3300037418 | Bacteria | 1931 |
| 366 | Ga0395900_0236821 | 3300037418 | Bacteria | 1833 |
| 367 | Ga0395898_0008349 | 3300037466 | Bacteria | 10948 |
| 368 | Ga0395898_0029219 | 3300037466 | Bacteria | 5523 |
| 369 | Ga0395898_0070060 | 3300037466 | Bacteria | 3391 |
| 370 | Ga0395898_0123718 | 3300037466 | Bacteria | 2478 |
| 371 | Ga0395898_0195156 | 3300037466 | Bacteria | 1934 |
| 372 | Ga0395905_0009181 | 3300037471 | Bacteria | 9682 |
| 373 | Ga0395905_0012620 | 3300037471 | Bacteria | 8128 |
| 374 | Ga0395905_0025616 | 3300037471 | Bacteria | 5562 |
| 375 | Ga0395905_0032448 | 3300037471 | Bacteria | 4911 |
| 376 | Ga0395905_0043620 | 3300037471 | Bacteria | 4207 |
| 377 | Ga0395905_0060718 | 3300037471 | Bacteria | 3535 |
| 378 | Ga0395905_0065436 | 3300037471 | Bacteria | 3403 |
| 379 | Ga0395901_0003703 | 3300038443 | Bacteria | 15418 |
| 380 | Ga0395901_0004641 | 3300038443 | Bacteria | 13858 |
| 381 | Ga0395901_0007095 | 3300038443 | Bacteria | 11326 |
| 382 | Ga0395901_0007530 | 3300038443 | Bacteria | 10995 |
| 383 | Ga0395901_0028931 | 3300038443 | Bacteria | 5701 |
| 384 | Ga0395901_0066078 | 3300038443 | Bacteria | 3767 |
| 385 | Ga0395901_0119511 | 3300038443 | Bacteria | 2769 |
| 386 | Ga0436365_0252283 | 3300039437 | Bacteria | 1791 |
| 387 | Ga0436363_0663999 | 3300039450 | Bacteria | 1690 |
| 388 | Ga0439466_0017749 | 3300041411 | Bacteria | 2560 |
| 389 | Ga0451791_1521897 | 3300041451 | Bacteria | 1742 |
| 390 | Ga0451793_0005940 | 3300041452 | Bacteria | 3019 |
| 391 | Ga0451800_0432663 | 3300041459 | Bacteria | 4497 |
| 392 | Ga0451807_0335557 | 3300041486 | Bacteria | 2696 |
| 393 | Ga0451845_0378300 | 3300041501 | Bacteria | 2476 |
| 394 | Ga0451849_0222363 | 3300041505 | Bacteria | 1788 |
| 395 | Ga0451855_0079494 | 3300041511 | Bacteria | 1978 |
| 396 | Ga0451853_4118874 | 3300041512 | Bacteria | 1127 |
| 397 | Ga0439445_0008988 | 3300042004 | Bacteria | 2348 |
| 398 | Ga0439448_0009102 | 3300042005 | Bacteria | 2922 |
| 399 | Ga0439459_0007069 | 3300042438 | Bacteria | 1887 |
| 400 | Ga0466969_0002327 | 3300044656 | Bacteria | 10143 |
| 401 | Ga0466961_0024528 | 3300044693 | Bacteria | 3879 |
| 402 | Ga0466963_0000937 | 3300044694 | Bacteria | 14912 |
| 403 | Ga0466963_0001817 | 3300044694 | Bacteria | 11618 |
| 404 | Ga0466963_0002367 | 3300044694 | Bacteria | 10527 |
| 405 | Ga0466963_0010578 | 3300044694 | Bacteria | 5591 |
| 406 | Ga0466963_0010802 | 3300044694 | Bacteria | 5543 |
| 407 | Ga0466963_0015636 | 3300044694 | Bacteria | 4705 |
| 408 | Ga0466963_0023242 | 3300044694 | Bacteria | 3933 |
| 409 | Ga0466963_0025951 | 3300044694 | Bacteria | 3742 |
| 410 | Ga0466964_0000516 | 3300044706 | Bacteria | 12053 |
| 411 | Ga0466964_0002117 | 3300044706 | Bacteria | 6992 |
| 412 | Ga0466964_0005030 | 3300044706 | Bacteria | 4888 |
| 413 | Ga0466964_0009558 | 3300044706 | Bacteria | 3654 |
| 414 | Ga0466964_0053777 | 3300044706 | Bacteria | 1658 |
| 415 | Ga0453684_0388791 | 3300044712 | Bacteria | 1565 |
| 416 | Ga0466971_0001657 | 3300044719 | Bacteria | 9417 |
| 417 | Ga0466971_0008053 | 3300044719 | Bacteria | 4595 |
| 418 | Ga0466968_0007423 | 3300044735 | Bacteria | 4168 |
| 419 | Ga0466970_0005089 | 3300044765 | Bacteria | 6501 |
| 420 | Ga0466957_0005885 | 3300044842 | Bacteria | 6913 |
| 421 | Ga0466957_0008389 | 3300044842 | Bacteria | 5876 |
| 422 | Ga0466957_0015756 | 3300044842 | Bacteria | 4416 |
| 423 | Ga0466957_0019544 | 3300044842 | Bacteria | 3984 |
| 424 | Ga0466957_0020192 | 3300044842 | Bacteria | 3920 |
| 425 | Ga0466957_0027236 | 3300044842 | Bacteria | 3395 |
| 426 | Ga0466957_0143628 | 3300044842 | Bacteria | 1539 |
| 427 | Ga0466960_0006463 | 3300044901 | Bacteria | 4703 |
| 428 | Ga0466960_0006907 | 3300044901 | Bacteria | 4577 |
| 429 | Ga0466960_0056378 | 3300044901 | Bacteria | 1913 |
| 430 | Ga0466960_0074805 | 3300044901 | Bacteria | 1693 |
| 431 | Ga0466959_0012718 | 3300045049 | Bacteria | 6088 |
| 432 | Ga0466959_0112699 | 3300045049 | Bacteria | 1940 |
| 433 | Ga0451576_0310503 | 3300045051 | Bacteria | 1650 |
| 434 | Ga0466958_0002160 | 3300045836 | Bacteria | 9790 |
| 435 | Ga0466958_0002543 | 3300045836 | Bacteria | 9202 |
| 436 | Ga0466958_0091473 | 3300045836 | Bacteria | 1883 |
| 437 | Ga0466967_0001434 | 3300045976 | Bacteria | 13835 |
| 438 | Ga0466967_0002259 | 3300045976 | Bacteria | 11875 |
| 439 | Ga0466967_0002411 | 3300045976 | Bacteria | 11613 |
| 440 | Ga0466967_0006109 | 3300045976 | Bacteria | 8470 |
| 441 | Ga0466967_0016721 | 3300045976 | Bacteria | 5796 |
| 442 | Ga0466967_0019588 | 3300045976 | Bacteria | 5446 |
| 443 | Ga0466967_0023919 | 3300045976 | Bacteria | 5014 |
| 444 | Ga0466967_0067681 | 3300045976 | Bacteria | 3186 |
| 445 | Ga0466967_0081112 | 3300045976 | Bacteria | 2929 |
| 446 | Ga0466967_0102874 | 3300045976 | Bacteria | 2613 |
| 447 | Ga0466967_0270880 | 3300045976 | Bacteria | 1627 |
| 448 | Ga0495592_0009452 | 3300046454 | Bacteria | 7331 |
| 449 | Ga0495603_0002642 | 3300046455 | Bacteria | 10570 |
| 450 | Ga0495603_0012821 | 3300046455 | Bacteria | 5069 |
| 451 | Ga0495629_0005864 | 3300046459 | Bacteria | 9156 |
| 452 | Ga0495629_0056317 | 3300046459 | Bacteria | 2749 |
| 453 | Ga0495641_0006512 | 3300046461 | Bacteria | 7549 |
| 454 | Ga0495653_0186384 | 3300046463 | Bacteria | 1419 |
| 455 | Ga0495580_0142277 | 3300046472 | Unclassified | 1663 |
| 456 | Ga0495582_0004644 | 3300046473 | Bacteria | 7719 |
| 457 | Ga0495582_0014846 | 3300046473 | Bacteria | 4280 |
| 458 | Ga0495582_0016561 | 3300046473 | Bacteria | 4037 |
| 459 | Ga0495582_0019869 | 3300046473 | Bacteria | 3674 |
| 460 | Ga0495582_0026243 | 3300046473 | Bacteria | 3193 |
| 461 | Ga0495582_0136466 | 3300046473 | Unclassified | 1388 |
| 462 | Ga0495605_0015705 | 3300046474 | Bacteria | 4115 |
| 463 | Ga0495639_0007696 | 3300046475 | Bacteria | 4633 |
| 464 | Ga0495639_0026756 | 3300046475 | Bacteria | 2551 |
| 465 | Ga0495662_0006232 | 3300046476 | Bacteria | 5960 |
| 466 | Ga0495662_0092499 | 3300046476 | Unclassified | 1475 |
| 467 | Ga0495664_0003629 | 3300046477 | Bacteria | 8416 |
| 468 | Ga0495664_0084204 | 3300046477 | Bacteria | 1908 |
| 469 | Ga0495584_0025536 | 3300046491 | Bacteria | 2995 |
| 470 | Ga0495584_0068242 | 3300046491 | Bacteria | 1786 |
| 471 | Ga0495585_0053295 | 3300046492 | Bacteria | 2239 |
| 472 | Ga0495594_0063630 | 3300046499 | Bacteria | 2044 |
| 473 | Ga0495618_0013415 | 3300046514 | Bacteria | 4985 |
| 474 | Ga0495628_0039126 | 3300046516 | Bacteria | 3794 |
| 475 | Ga0495630_0024266 | 3300046517 | Bacteria | 4484 |
| 476 | Ga0495630_0026086 | 3300046517 | Bacteria | 4325 |
| 477 | Ga0495630_0047064 | 3300046517 | Bacteria | 3225 |
| 478 | Ga0495637_0052657 | 3300046520 | Unclassified | 1698 |
| 479 | Ga0495644_0006000 | 3300046523 | Bacteria | 4733 |
| 480 | Ga0495666_0009712 | 3300046526 | Bacteria | 4808 |
| 481 | Ga0495652_0029737 | 3300046529 | Bacteria | 4796 |
| 482 | Ga0495652_0062185 | 3300046529 | Bacteria | 3148 |
| 483 | Ga0495652_0100077 | 3300046529 | Bacteria | 2353 |
| 484 | Ga0495640_0029565 | 3300046533 | Bacteria | 3932 |
| 485 | Ga0495640_0063896 | 3300046533 | Bacteria | 2490 |
| 486 | Ga0495586_0041080 | 3300046535 | Bacteria | 2490 |
| 487 | Ga0495598_0030829 | 3300046537 | Bacteria | 1505 |
| 488 | Ga0495609_0097242 | 3300046538 | Bacteria | 1277 |
| 489 | Ga0495645_0031546 | 3300046543 | Bacteria | 3862 |
| 490 | Ga0495656_0039955 | 3300046615 | Bacteria | 1952 |
| 491 | Ga0495634_0031379 | 3300046642 | Bacteria | 3660 |
| 492 | Ga0495634_0070456 | 3300046642 | Bacteria | 2304 |
| 493 | Ga0495635_0010069 | 3300046663 | Bacteria | 6609 |
| 494 | Ga0495635_0017982 | 3300046663 | Bacteria | 4936 |
| 495 | Ga0495635_0031981 | 3300046663 | Bacteria | 3651 |
| 496 | Ga0495659_0001548 | 3300046664 | Bacteria | 7750 |
| 497 | Ga0495661_0025010 | 3300046665 | Bacteria | 3863 |
| 498 | Ga0495588_0001771 | 3300046674 | Bacteria | 9194 |
| 499 | Ga0495588_0027350 | 3300046674 | Bacteria | 2851 |
| 500 | Ga0495657_0049489 | 3300046675 | Bacteria | 2830 |
| 501 | Ga0495599_0010981 | 3300046678 | Bacteria | 5557 |
| 502 | Ga0495599_0200897 | 3300046678 | Unclassified | 1225 |
| 503 | Ga0495623_0088661 | 3300046679 | Bacteria | 1904 |
| 504 | Ga0495647_0000117 | 3300046681 | Bacteria | 20211 |
| 505 | Ga0495647_0034626 | 3300046681 | Bacteria | 1892 |
| 506 | Ga0495658_0002481 | 3300046683 | Bacteria | 9285 |
| 507 | Ga0495613_0009945 | 3300046689 | Bacteria | 7068 |
| 508 | Ga0495624_0022706 | 3300046690 | Bacteria | 4142 |
| 509 | Ga0495589_0086028 | 3300046794 | Bacteria | 1527 |
| 510 | Ga0495581_0001867 | 3300047315 | Bacteria | 11790 |
| 511 | Ga0495604_0019500 | 3300047317 | Bacteria | 5428 |
| 512 | Ga0495636_0052064 | 3300047318 | Bacteria | 1717 |
| 513 | Ga0495674_0022225 | 3300047319 | Bacteria | 5850 |
| 514 | Ga0495674_0052921 | 3300047319 | Bacteria | 3570 |
| 515 | Ga0495674_0059757 | 3300047319 | Bacteria | 3328 |
| 516 | Ga0495674_0112669 | 3300047319 | Bacteria | 2304 |
| 517 | Ga0495676_0009898 | 3300047321 | Bacteria | 8664 |
| 518 | Ga0495676_0014000 | 3300047321 | Bacteria | 7183 |
| 519 | Ga0495676_0040706 | 3300047321 | Bacteria | 3832 |
| 520 | Ga0495676_0112888 | 3300047321 | Bacteria | 1990 |
| 521 | Ga0495680_0048197 | 3300047322 | Bacteria | 3347 |
| 522 | Ga0495680_0199141 | 3300047322 | Unclassified | 1437 |
| 523 | Ga0495684_0008720 | 3300047471 | Bacteria | 7839 |
| 524 | Ga0495684_0020652 | 3300047471 | Bacteria | 5074 |
| 525 | Ga0495684_0042286 | 3300047471 | Bacteria | 3490 |
| 526 | Ga0495684_0153100 | 3300047471 | Bacteria | 1723 |
| 527 | Ga0495593_0022473 | 3300047673 | Bacteria | 3513 |
| 528 | Ga0495614_0000404 | 3300048089 | Bacteria | 17590 |
| 529 | Ga0495614_0046031 | 3300048089 | Bacteria | 1871 |
| 530 | Ga0495614_0061859 | 3300048089 | Unclassified | 1609 |
| 531 | Ga0496100_0009426 | 3300048903 | Bacteria | 5489 |
| 532 | Ga0496100_0019470 | 3300048903 | Bacteria | 4050 |
| 533 | Ga0496100_0041528 | 3300048903 | Bacteria | 2932 |
| 534 | Ga0496100_0120722 | 3300048903 | Bacteria | 1833 |
| 535 | Ga0496101_0021111 | 3300048904 | Bacteria | 4470 |
| 536 | Ga0496101_0046911 | 3300048904 | Bacteria | 3100 |
| 537 | Ga0496101_0064325 | 3300048904 | Bacteria | 2671 |
| 538 | Ga0496101_0125314 | 3300048904 | Bacteria | 1946 |
| 539 | Ga0496102_0018692 | 3300048905 | Bacteria | 6095 |
| 540 | Ga0496102_0030582 | 3300048905 | Bacteria | 4820 |
| 541 | Ga0496102_0032226 | 3300048905 | Bacteria | 4708 |
| 542 | Ga0496102_0051932 | 3300048905 | Bacteria | 3734 |
| 543 | Ga0496102_0096355 | 3300048905 | Bacteria | 2743 |
| 544 | Ga0496102_0247926 | 3300048905 | Bacteria | 1679 |
| 545 | Ga0496102_0365382 | 3300048905 | Unclassified | 1358 |
| 546 | Ga0496103_0003512 | 3300048906 | Bacteria | 9582 |
| 547 | Ga0496103_0009909 | 3300048906 | Bacteria | 5635 |
| 548 | Ga0496103_0022753 | 3300048906 | Bacteria | 3775 |
| 549 | Ga0496103_0023288 | 3300048906 | Bacteria | 3734 |
| 550 | Ga0496103_0046501 | 3300048906 | Bacteria | 2680 |
| 551 | Ga0496104_0000967 | 3300048907 | Bacteria | 24709 |
| 552 | Ga0496104_0001618 | 3300048907 | Bacteria | 19424 |
| 553 | Ga0496104_0004025 | 3300048907 | Bacteria | 12740 |
| 554 | Ga0496104_0036093 | 3300048907 | Bacteria | 4618 |
| 555 | Ga0496104_0192729 | 3300048907 | Bacteria | 1950 |
| 556 | Ga0496104_0212206 | 3300048907 | Bacteria | 1847 |
| 557 | Ga0496105_0001531 | 3300048908 | Bacteria | 16347 |
| 558 | Ga0496105_0010763 | 3300048908 | Bacteria | 7202 |
| 559 | Ga0496105_0022441 | 3300048908 | Bacteria | 5112 |
| 560 | Ga0496105_0048930 | 3300048908 | Bacteria | 3490 |
| 561 | Ga0496105_0072223 | 3300048908 | Bacteria | 2852 |
| 562 | Ga0496105_0086124 | 3300048908 | Bacteria | 2596 |
| 563 | Ga0496105_0138832 | 3300048908 | Bacteria | 2001 |
| 564 | Ga0496105_0203733 | 3300048908 | Bacteria | 1614 |
| 565 | Ga0496106_0034671 | 3300048909 | Bacteria | 3771 |
| 566 | Ga0496106_0046232 | 3300048909 | Bacteria | 3271 |
| 567 | Ga0496107_0002456 | 3300048910 | Bacteria | 12023 |
| 568 | Ga0496107_0015873 | 3300048910 | Bacteria | 5283 |
| 569 | Ga0496107_0027226 | 3300048910 | Bacteria | 4059 |
| 570 | Ga0496107_0062318 | 3300048910 | Bacteria | 2701 |
| 571 | Ga0496107_0127413 | 3300048910 | Bacteria | 1878 |
| 572 | Ga0496107_0141033 | 3300048910 | Bacteria | 1781 |
| 573 | Ga0496108_0000996 | 3300048911 | Bacteria | 22097 |
| 574 | Ga0496108_0009734 | 3300048911 | Bacteria | 7788 |
| 575 | Ga0496108_0011867 | 3300048911 | Bacteria | 7087 |
| 576 | Ga0496108_0018681 | 3300048911 | Bacteria | 5680 |
| 577 | Ga0496108_0029829 | 3300048911 | Bacteria | 4519 |
| 578 | Ga0496108_0054560 | 3300048911 | Bacteria | 3354 |
| 579 | Ga0496108_0146530 | 3300048911 | Bacteria | 2036 |
| 580 | Ga0496109_0002166 | 3300048912 | Bacteria | 16321 |
| 581 | Ga0496109_0010218 | 3300048912 | Bacteria | 8014 |
| 582 | Ga0496109_0021918 | 3300048912 | Bacteria | 5656 |
| 583 | Ga0496109_0025632 | 3300048912 | Bacteria | 5255 |
| 584 | Ga0496109_0041517 | 3300048912 | Bacteria | 4166 |
| 585 | Ga0496109_0043693 | 3300048912 | Bacteria | 4062 |
| 586 | Ga0496109_0058433 | 3300048912 | Bacteria | 3522 |
| 587 | Ga0496109_0059110 | 3300048912 | Bacteria | 3502 |
| 588 | Ga0496109_0104455 | 3300048912 | Bacteria | 2630 |
| 589 | Ga0496109_0155012 | 3300048912 | Bacteria | 2145 |
| 590 | Ga0496109_0206625 | 3300048912 | Bacteria | 1846 |
| 591 | Ga0496109_0289639 | 3300048912 | Bacteria | 1544 |
| 592 | Ga0496109_0299076 | 3300048912 | Bacteria | 1517 |
| 593 | Ga0496110_0002803 | 3300048913 | Bacteria | 13155 |
| 594 | Ga0496110_0010506 | 3300048913 | Bacteria | 7535 |
| 595 | Ga0496110_0019311 | 3300048913 | Bacteria | 5732 |
| 596 | Ga0496110_0034994 | 3300048913 | Bacteria | 4355 |
| 597 | Ga0496110_0057242 | 3300048913 | Bacteria | 3432 |
| 598 | Ga0496111_0002099 | 3300048914 | Bacteria | 11894 |
| 599 | Ga0496111_0009850 | 3300048914 | Bacteria | 6388 |
| 600 | Ga0496111_0018459 | 3300048914 | Bacteria | 4834 |
| 601 | Ga0496111_0038548 | 3300048914 | Bacteria | 3424 |
| 602 | Ga0496111_0101553 | 3300048914 | Bacteria | 2113 |
| 603 | Ga0496111_0191899 | 3300048914 | Bacteria | 1519 |
| 604 | Ga0496112_0000886 | 3300048915 | Bacteria | 21512 |
| 605 | Ga0496112_0001931 | 3300048915 | Bacteria | 16369 |
| 606 | Ga0496112_0089625 | 3300048915 | Bacteria | 3044 |
| 607 | Ga0496112_0105663 | 3300048915 | Bacteria | 2785 |
| 608 | Ga0496112_0210589 | 3300048915 | Unclassified | 1901 |
| 609 | Ga0496113_0000220 | 3300048916 | Bacteria | 26683 |
| 610 | Ga0496113_0002691 | 3300048916 | Bacteria | 10424 |
| 611 | Ga0496113_0016604 | 3300048916 | Bacteria | 5089 |
| 612 | Ga0496113_0042602 | 3300048916 | Bacteria | 3356 |
| 613 | Ga0496113_0043493 | 3300048916 | Bacteria | 3324 |
| 614 | Ga0496113_0065107 | 3300048916 | Bacteria | 2758 |
| 615 | Ga0496114_0014475 | 3300048917 | Bacteria | 6336 |
| 616 | Ga0496114_0028399 | 3300048917 | Bacteria | 4591 |
| 617 | Ga0496114_0046356 | 3300048917 | Bacteria | 3612 |
| 618 | Ga0496114_0078998 | 3300048917 | Bacteria | 2776 |
| 619 | Ga0496114_0095404 | 3300048917 | Bacteria | 2531 |
| 620 | Ga0496114_0126725 | 3300048917 | Bacteria | 2201 |
| 621 | Ga0496115_0001489 | 3300048918 | Bacteria | 16848 |
| 622 | Ga0496115_0012093 | 3300048918 | Bacteria | 6490 |
| 623 | Ga0496115_0018782 | 3300048918 | Bacteria | 5314 |
| 624 | Ga0496115_0021559 | 3300048918 | Bacteria | 4978 |
| 625 | Ga0496115_0037231 | 3300048918 | Bacteria | 3855 |
| 626 | Ga0496115_0068253 | 3300048918 | Bacteria | 2878 |
| 627 | Ga0496115_0072142 | 3300048918 | Bacteria | 2801 |
| 628 | Ga0501031_0006030 | 3300049568 | Bacteria | 7909 |
| 629 | Ga0501033_0002997 | 3300049570 | Bacteria | 14096 |
| 630 | Ga0501036_0002978 | 3300049572 | Bacteria | 13462 |
| 631 | Ga0501039_0073694 | 3300049575 | Bacteria | 2652 |
| 632 | Ga0501040_0022541 | 3300049576 | Bacteria | 4215 |
| 633 | Ga0501041_0016007 | 3300049577 | Bacteria | 4456 |
| 634 | Ga0501042_0001350 | 3300049578 | Bacteria | 14365 |
| 635 | Ga0501043_0000497 | 3300049579 | Bacteria | 35330 |
| 636 | Ga0501046_0013268 | 3300049580 | Bacteria | 6981 |
| 637 | Ga0501048_0015601 | 3300049582 | Bacteria | 5609 |
| 638 | Ga0501067_0000403 | 3300049583 | Bacteria | 23610 |
| 639 | Ga0501067_0002219 | 3300049583 | Bacteria | 10737 |
| 640 | Ga0501067_0058614 | 3300049583 | Bacteria | 2132 |
| 641 | Ga0501068_0000389 | 3300049584 | Bacteria | 22250 |
| 642 | Ga0501068_0032324 | 3300049584 | Bacteria | 3112 |
| 643 | Ga0501069_0000952 | 3300049585 | Bacteria | 13786 |
| 644 | Ga0501069_0001235 | 3300049585 | Bacteria | 12499 |
| 645 | Ga0501069_0010500 | 3300049585 | Bacteria | 4905 |
| 646 | Ga0501069_0013533 | 3300049585 | Bacteria | 4350 |
| 647 | Ga0501069_0024422 | 3300049585 | Bacteria | 3296 |
| 648 | Ga0501069_0061627 | 3300049585 | Bacteria | 2095 |
| 649 | Ga0501070_0002833 | 3300049586 | Bacteria | 15133 |
| 650 | Ga0501070_0011361 | 3300049586 | Bacteria | 7525 |
| 651 | Ga0501070_0018181 | 3300049586 | Bacteria | 5896 |
| 652 | Ga0501071_0003382 | 3300049587 | Bacteria | 9966 |
| 653 | Ga0501072_0016860 | 3300049588 | Bacteria | 5611 |
| 654 | Ga0501072_0095976 | 3300049588 | Bacteria | 2356 |
| 655 | Ga0501072_0213645 | 3300049588 | Bacteria | 1537 |
| 656 | Ga0501073_0009385 | 3300049589 | Bacteria | 7223 |
| 657 | Ga0501074_0011074 | 3300049590 | Bacteria | 6547 |
| 658 | Ga0501074_0018763 | 3300049590 | Bacteria | 5025 |
| 659 | Ga0501075_0020605 | 3300049591 | Bacteria | 4798 |
| 660 | Ga0501076_0022990 | 3300049592 | Bacteria | 4798 |
| 661 | Ga0501077_0016385 | 3300049593 | Bacteria | 4669 |
| 662 | Ga0501080_0004561 | 3300049742 | Bacteria | 12347 |
| 663 | Ga0501081_0002878 | 3300049743 | Bacteria | 10927 |
| 664 | Ga0501083_0015988 | 3300049744 | Bacteria | 5254 |
| 665 | Ga0501083_0017888 | 3300049744 | Bacteria | 4944 |
| 666 | Ga0501035_0025276 | 3300049822 | Bacteria | 5444 |
| 667 | Ga0501045_0013061 | 3300049824 | Bacteria | 5856 |
| 668 | nmdc:mga00v17_76714_c1 | 3300050491 | Bacteria | 2080 |
| 669 | nmdc:mga0yw44_11054_c1 | 3300050492 | Bacteria | 4639 |
| 670 | nmdc:mga05p37_232956_c1 | 3300050507 | Bacteria | 2218 |
| 671 | nmdc:mga08y16_45920_c1 | 3300050511 | Bacteria | 4576 |
| 672 | nmdc:mga0n895_133081_c1 | 3300050512 | Bacteria | 2513 |
| 673 | nmdc:mga0n895_58746_c1 | 3300050512 | Bacteria | 3793 |
| 674 | nmdc:mga0n895_6178_c1 | 3300050512 | Bacteria | 10125 |
| 675 | nmdc:mga0rr50_12702_c1 | 3300050513 | Bacteria | 5455 |
| 676 | nmdc:mga0rr50_26342_c1 | 3300050513 | Bacteria | 4055 |
| 677 | nmdc:mga08x19_35580_c1 | 3300050514 | Bacteria | 3152 |
| 678 | nmdc:mga0a205_17646_c1 | 3300050515 | Bacteria | 6699 |
| 679 | nmdc:mga0a205_291573_c1 | 3300050515 | Unclassified | 1506 |
| 680 | Ga0495601_0073381 | 3300053077 | Bacteria | 2187 |
| 681 | Ga0495601_0200943 | 3300053077 | Bacteria | 1302 |
| 682 | Ga0495612_0013669 | 3300053078 | Bacteria | 3270 |
| 683 | Ga0495612_0035484 | 3300053078 | Bacteria | 2021 |
| 684 | Ga0495655_0007585 | 3300053083 | Bacteria | 2024 |
| 685 | Ga0495595_0003635 | 3300053084 | Bacteria | 6131 |
| 686 | Ga0495619_0035019 | 3300053085 | Bacteria | 3265 |
| 687 | Ga0495619_0119130 | 3300053085 | Bacteria | 1809 |
| 688 | Ga0501084_0024288 | 3300054114 | Bacteria | 5054 |
| 689 | Ga0501084_0038387 | 3300054114 | Bacteria | 4004 |
| 690 | Ga0587077_005055 | 3300059493 | Bacteria | 1779 |
| 691 | Ga0587077_007509 | 3300059493 | Bacteria | 1592 |
| 692 | Ga0587080_001633 | 3300059503 | Bacteria | 2480 |
| 693 | Ga0587082_002517 | 3300059504 | Bacteria | 2079 |
| 694 | Ga0587083_0011793 | 3300059505 | Unclassified | 1451 |
| 695 | Ga0587085_001208 | 3300059506 | Bacteria | 2312 |
| 696 | Ga0587086_003052 | 3300059507 | Bacteria | 1651 |
| 697 | Ga0587088_004135 | 3300059508 | Bacteria | 1813 |
| 698 | Ga0587067_003050 | 3300059640 | Bacteria | 2058 |
| 699 | Ga0587069_007020 | 3300059642 | Unclassified | 1375 |
| 700 | Ga0587072_006636 | 3300059643 | Bacteria | 1770 |
| 701 | Ga0587107_002115 | 3300059652 | Bacteria | 1745 |
| 702 | Ga0587111_0003738 | 3300060346 | Bacteria | 2198 |
| 703 | Ga0501082_0017499 | 3300060353 | Bacteria | 6175 |
| 704 | Ga0530510_0008013 | 3300061734 | Bacteria | 7368 |
| 705 | Ga0530510_0017002 | 3300061734 | Bacteria | 5152 |
| 706 | Ga0530510_0137580 | 3300061734 | Bacteria | 1798 |
| 707 | Ga0070683_100024080 | |||
| 708 | JGI25407J50210_10001565 | |||
| 709 | JGI25404J52841_10024007 | |||
| 710 | Ga0058862_10004946 | |||
| 711 | Ga0058862_12749158 | |||
| 712 | Ga0070658_10023603 | |||
| 713 | Ga0070683_100120480 | |||
| 714 | Ga0070683_100124997 | |||
| 715 | Ga0070683_100152225 | |||
| 716 | Ga0070690_100013723 | |||
| 717 | Ga0068869_100087515 | |||
| 718 | Ga0070666_10121607 | |||
| 719 | Ga0070680_100007965 | |||
| 720 | Ga0070680_100047719 | |||
| 721 | Ga0070680_100073798 | |||
| 722 | Ga0070680_100102155 | |||
| 723 | Ga0070680_100107399 | |||
| 724 | Ga0070680_100236375 | |||
| 725 | Ga0070682_100020440 | |||
| 726 | Ga0070682_100024510 | |||
| 727 | Ga0068868_100048270 | |||
| 728 | Ga0068868_100148533 | |||
| 729 | Ga0070660_100005513 | |||
| 730 | Ga0070660_100040732 | |||
| 731 | Ga0070689_100008321 | |||
| 732 | Ga0070691_10043552 | |||
| 733 | Ga0070661_100014914 | |||
| 734 | Ga0070661_100043625 | |||
| 735 | Ga0070661_100130148 | |||
| 736 | Ga0070692_10002761 | |||
| 737 | Ga0070668_100030525 | |||
| 738 | Ga0070668_100160967 | |||
| 739 | Ga0070675_100243693 | |||
| 740 | Ga0070674_100022407 | |||
| 741 | Ga0070674_100023154 | |||
| 742 | Ga0070688_100014573 | |||
| 743 | Ga0070659_100042536 | |||
| 744 | Ga0070659_100070140 | |||
| 745 | Ga0070709_10008900 | |||
| 746 | Ga0070709_10181712 | |||
| 747 | Ga0070714_100014369 | |||
| 748 | Ga0070714_100025272 | |||
| 749 | Ga0070714_100056819 | |||
| 750 | Ga0070713_100028424 | |||
| 751 | Ga0070713_100050775 | |||
| 752 | Ga0070713_100057501 | |||
| 753 | Ga0070713_100258493 | |||
| 754 | Ga0070710_10001625 | |||
| 755 | Ga0070710_10005790 | |||
| 756 | Ga0070711_100009827 | |||
| 757 | Ga0070705_100012181 | |||
| 758 | Ga0070705_100015497 | |||
| 759 | Ga0070705_100022314 | |||
| 760 | Ga0070705_100120813 | |||
| 761 | Ga0070700_100028398 | |||
| 762 | Ga0070700_100062090 | |||
| 763 | Ga0070694_100021115 | |||
| 764 | Ga0070694_100042816 | |||
| 765 | Ga0070694_100108864 | |||
| 766 | Ga0070708_100027320 | |||
| 767 | Ga0070708_100028883 | |||
| 768 | Ga0070708_100132313 | |||
| 769 | Ga0070678_100000442 | |||
| 770 | Ga0070678_100023110 | |||
| 771 | Ga0070678_100084059 | |||
| 772 | Ga0070662_100005385 | |||
| 773 | Ga0070662_100068740 | |||
| 774 | Ga0070681_10026263 | |||
| 775 | Ga0070681_10069858 | |||
| 776 | Ga0070681_10109059 | |||
| 777 | Ga0068867_100006216 | |||
| 778 | Ga0070685_10004918 | |||
| 779 | Ga0070706_100005519 | |||
| 780 | Ga0070706_100009854 | |||
| 781 | Ga0070706_100178289 | |||
| 782 | Ga0070707_100001518 | |||
| 783 | Ga0070707_100010429 | |||
| 784 | Ga0070707_100072782 | |||
| 785 | Ga0070707_100151579 | |||
| 786 | Ga0070707_100195534 | |||
| 787 | Ga0070698_100001085 | |||
| 788 | Ga0070698_100010575 | |||
| 789 | Ga0070698_100011117 | |||
| 790 | Ga0070699_100023472 | |||
| 791 | Ga0070679_100027668 | |||
| 792 | Ga0070679_100032458 | |||
| 793 | Ga0070679_100077214 | |||
| 794 | Ga0070684_100028844 | |||
| 795 | Ga0070684_100087881 | |||
| 796 | Ga0070684_100099924 | |||
| 797 | Ga0070684_100134936 | |||
| 798 | Ga0070697_100032076 | |||
| 799 | Ga0070697_100070504 | |||
| 800 | Ga0068853_100030464 | |||
| 801 | Ga0070686_100023451 | |||
| 802 | Ga0070695_100030883 | |||
| 803 | Ga0070696_100039202 | |||
| 804 | Ga0070696_100046404 | |||
| 805 | Ga0070693_100024395 | |||
| 806 | Ga0070693_100062394 | |||
| 807 | Ga0070665_100035292 | |||
| 808 | Ga0070665_100095175 | |||
| 809 | Ga0070704_100026780 | |||
| 810 | Ga0068855_100029141 | |||
| 811 | Ga0068855_100051058 | |||
| 812 | Ga0068855_100081129 | |||
| 813 | Ga0068855_100110835 | |||
| 814 | Ga0068855_100113296 | |||
| 815 | Ga0068855_100280966 | |||
| 816 | Ga0068855_100293109 | |||
| 817 | Ga0068855_100318484 | |||
| 818 | Ga0068857_100144954 | |||
| 819 | Ga0068857_100160396 | |||
| 820 | Ga0068856_100026471 | |||
| 821 | Ga0068856_100035486 | |||
| 822 | Ga0068856_100058209 | |||
| 823 | Ga0068856_100326582 | |||
| 824 | Ga0068856_100347152 | |||
| 825 | Ga0070702_100012399 | |||
| 826 | Ga0070702_100028539 | |||
| 827 | Ga0070702_100048106 | |||
| 828 | Ga0068852_100092908 | |||
| 829 | Ga0068852_100111759 | |||
| 830 | Ga0068864_100191535 | |||
| 831 | Ga0068866_10004144 | |||
| 832 | Ga0068861_100049753 | |||
| 833 | Ga0068861_100076174 | |||
| 834 | Ga0068861_100210483 | |||
| 835 | Ga0081455_10001178 | |||
| 836 | Ga0081455_10005512 | |||
| 837 | Ga0081455_10048055 | |||
| 838 | Ga0081538_10000138 | |||
| 839 | Ga0081540_1002348 | |||
| 840 | Ga0081540_1008368 | |||
| 841 | Ga0070717_10030764 | |||
| 842 | Ga0070717_10040175 | |||
| 843 | Ga0070717_10054826 | |||
| 844 | Ga0070717_10144535 | |||
| 845 | Ga0075432_10009109 | |||
| 846 | Ga0070715_10000120 | |||
| 847 | Ga0070715_10113269 | |||
| 848 | Ga0070716_100072825 | |||
| 849 | Ga0070712_100006659 | |||
| 850 | Ga0070712_100031018 | |||
| 851 | Ga0075362_10021821 | |||
| 852 | Ga0097621_100086202 | |||
| 853 | Ga0097621_100167090 | |||
| 854 | Ga0097621_100193196 | |||
| 855 | Ga0068871_100003070 | |||
| 856 | Ga0068871_100025871 | |||
| 857 | Ga0068871_100068128 | |||
| 858 | Ga0075428_100048614 | |||
| 859 | Ga0075430_100014061 | |||
| 860 | Ga0075433_10028527 | |||
| 861 | Ga0075433_10038801 | |||
| 862 | Ga0075434_100032472 | |||
| 863 | Ga0075434_100036266 | |||
| 864 | Ga0075434_100137850 | |||
| 865 | Ga0075429_100189634 | |||
| 866 | Ga0068865_100008117 | |||
| 867 | Ga0068865_100304828 | |||
| 868 | Ga0075436_100020126 | |||
| 869 | Ga0075436_100148785 | |||
| 870 | Ga0075435_100033701 | |||
| 871 | Ga0105250_10025459 | |||
| 872 | Ga0105240_10015896 | |||
| 873 | Ga0105240_10039055 | |||
| 874 | Ga0105240_10059512 | |||
| 875 | Ga0111539_10099690 | |||
| 876 | Ga0111539_10406537 | |||
| 877 | Ga0105245_10011919 | |||
| 878 | Ga0105245_10048211 | |||
| 879 | Ga0105245_10077461 | |||
| 880 | Ga0105245_10118994 | |||
| 881 | Ga0105245_10189653 | |||
| 882 | Ga0105247_10016213 | |||
| 883 | Ga0114129_10171013 | |||
| 884 | Ga0114129_10176202 | |||
| 885 | Ga0105243_10006519 | |||
| 886 | Ga0105243_10124923 | |||
| 887 | Ga0105243_10307683 | |||
| 888 | Ga0105241_10161272 | |||
| 889 | Ga0105242_10018967 | |||
| 890 | Ga0105242_10020103 | |||
| 891 | Ga0105242_10061511 | |||
| 892 | Ga0105242_10084480 | |||
| 893 | Ga0105248_10081226 | |||
| 894 | Ga0105248_10103575 | |||
| 895 | Ga0105237_10010937 | |||
| 896 | Ga0105237_10083602 | |||
| 897 | Ga0105237_10109684 | |||
| 898 | Ga0105238_10059323 | |||
| 899 | Ga0105238_10164767 | |||
| 900 | Ga0105238_10276644 | |||
| 901 | Ga0105249_10000948 | |||
| 902 | Ga0105249_10018638 | |||
| 903 | Ga0105239_10039360 | |||
| 904 | Ga0105239_10116859 | |||
| 905 | Ga0105246_10121086 | |||
| 906 | Ga0157371_10059178 | |||
| 907 | Ga0157370_10030838 | |||
| 908 | Ga0157369_10045756 | |||
| 909 | Ga0157369_10337990 | |||
| 910 | Ga0157369_10357056 | |||
| 911 | Ga0157374_10034025 | |||
| 912 | Ga0157374_10050794 | |||
| 913 | Ga0157374_10053238 | |||
| 914 | Ga0157374_10135952 | |||
| 915 | Ga0157374_10183535 | |||
| 916 | Ga0157378_10067816 | |||
| 917 | Ga0157378_10255667 | |||
| 918 | Ga0157378_10268832 | |||
| 919 | Ga0163162_10023656 | |||
| 920 | Ga0163162_10080663 | |||
| 921 | Ga0163162_10168503 | |||
| 922 | Ga0163162_10219089 | |||
| 923 | Ga0157372_10011814 | |||
| 924 | Ga0157372_10090271 | |||
| 925 | Ga0157372_10206990 | |||
| 926 | Ga0157372_10209151 | |||
| 927 | Ga0157372_10227629 | |||
| 928 | Ga0157372_10238196 | |||
| 929 | Ga0157372_10383932 | |||
| 930 | Ga0157375_10029269 | |||
| 931 | Ga0157375_10129179 | |||
| 932 | Ga0157377_10025925 | |||
| 933 | Ga0157376_10005458 | |||
| 934 | Ga0157376_10014185 | |||
| 935 | Ga0163161_10237547 | |||
| 936 | Ga0197907_11238927 | |||
| 937 | Ga0197907_11268062 | |||
| 938 | Ga0206350_10538545 | |||
| 939 | Ga0224712_10009892 | |||
| 940 | Ga0207696_1026201 | |||
| 941 | Ga0207653_10023673 | |||
| 942 | Ga0207653_10026817 | |||
| 943 | Ga0207692_10008727 | |||
| 944 | Ga0207688_10014206 | |||
| 945 | Ga0207685_10001820 | |||
| 946 | Ga0207699_10155119 | |||
| 947 | Ga0207705_10011519 | |||
| 948 | Ga0207705_10015166 | |||
| 949 | Ga0207684_10015225 | |||
| 950 | Ga0207684_10058065 | |||
| 951 | Ga0207684_10060697 | |||
| 952 | Ga0207654_10035652 | |||
| 953 | Ga0207654_10054480 | |||
| 954 | Ga0207707_10001761 | |||
| 955 | Ga0207707_10002492 | |||
| 956 | Ga0207707_10081311 | |||
| 957 | Ga0207695_10071012 | |||
| 958 | Ga0207695_10135545 | |||
| 959 | Ga0207671_10075260 | |||
| 960 | Ga0207671_10083725 | |||
| 961 | Ga0207671_10148707 | |||
| 962 | Ga0207693_10001119 | |||
| 963 | Ga0207693_10004453 | |||
| 964 | Ga0207693_10005339 | |||
| 965 | Ga0207693_10007372 | |||
| 966 | Ga0207693_10051308 | |||
| 967 | Ga0207663_10002132 | |||
| 968 | Ga0207663_10003179 | |||
| 969 | Ga0207663_10007050 | |||
| 970 | Ga0207660_10021336 | |||
| 971 | Ga0207660_10099945 | |||
| 972 | Ga0207660_10124308 | |||
| 973 | Ga0207660_10279515 | |||
| 974 | Ga0207657_10002585 | |||
| 975 | Ga0207649_10107802 | |||
| 976 | Ga0207649_10145876 | |||
| 977 | Ga0207652_10022704 | |||
| 978 | Ga0207652_10307791 | |||
| 979 | Ga0207646_10001000 | |||
| 980 | Ga0207646_10004378 | |||
| 981 | Ga0207646_10011349 | |||
| 982 | Ga0207646_10077203 | |||
| 983 | Ga0207646_10144515 | |||
| 984 | Ga0207694_10029083 | |||
| 985 | Ga0207694_10039476 | |||
| 986 | Ga0207694_10095017 | |||
| 987 | Ga0207687_10010093 | |||
| 988 | Ga0207687_10024082 | |||
| 989 | Ga0207687_10033346 | |||
| 990 | Ga0207687_10034212 | |||
| 991 | Ga0207687_10213264 | |||
| 992 | Ga0207664_10005273 | |||
| 993 | Ga0207664_10011464 | |||
| 994 | Ga0207664_10027751 | |||
| 995 | Ga0207664_10097135 | |||
| 996 | Ga0207664_10249890 | |||
| 997 | Ga0207706_10019714 | |||
| 998 | Ga0207706_10031554 | |||
| 999 | Ga0207686_10010919 | |||
| 1000 | Ga0207709_10007136 | |||
| 1001 | Ga0207709_10096254 | |||
| 1002 | Ga0207709_10113013 | |||
| 1003 | Ga0207669_10048896 | |||
| 1004 | Ga0207669_10136885 | |||
| 1005 | Ga0207704_10021540 | |||
| 1006 | Ga0207665_10000462 | |||
| 1007 | Ga0207665_10005207 | |||
| 1008 | Ga0207665_10133595 | |||
| 1009 | Ga0207711_10033528 | |||
| 1010 | Ga0207689_10086235 | |||
| 1011 | Ga0207661_10035307 | |||
| 1012 | Ga0207661_10054152 | |||
| 1013 | Ga0207667_10182134 | |||
| 1014 | Ga0207712_10032372 | |||
| 1015 | Ga0207668_10025865 | |||
| 1016 | Ga0207677_10064293 | |||
| 1017 | Ga0207677_10323151 | |||
| 1018 | Ga0207639_10014973 | |||
| 1019 | Ga0207639_10091022 | |||
| 1020 | Ga0207639_10166859 | |||
| 1021 | Ga0207678_10166659 | |||
| 1022 | Ga0207708_10000564 | |||
| 1023 | Ga0207708_10003976 | |||
| 1024 | Ga0207702_10001525 | |||
| 1025 | Ga0207702_10195610 | |||
| 1026 | Ga0207702_10352381 | |||
| 1027 | Ga0207648_10001096 | |||
| 1028 | Ga0207674_10038198 | |||
| 1029 | Ga0207674_10108165 | |||
| 1030 | Ga0207674_10159079 | |||
| 1031 | Ga0207675_100001665 | |||
| 1032 | Ga0207675_100006719 | |||
| 1033 | Ga0207675_100015619 | |||
| 1034 | Ga0207683_10000251 | |||
| 1035 | Ga0207683_10054732 | |||
| 1036 | Ga0207683_10067003 | |||
| 1037 | Ga0207683_10079341 | |||
| 1038 | Ga0207698_10097487 | |||
| 1039 | Ga0207428_10001520 | |||
| 1040 | Ga0207428_10025482 | |||
| 1041 | Ga0268266_10030241 | |||
| 1042 | Ga0268265_10162969 | |||
| 1043 | Ga0307416_100101496 | |||
| 1044 | Ga0307415_100062748 | |||
| 1045 | Ga0373959_0015109 | |||
| 1046 | Ga0373926_0026293 | |||
| 1047 | Ga0373944_0004987 | |||
| 1048 | Ga0373949_0008840 | |||
| 1049 | Ga0373952_0009172 | |||
| 1050 | Ga0373943_0008505 | |||
| 1051 | Ga0373943_0056003 | |||
| 1052 | Ga0373943_0086308 | |||
| 1053 | Ga0373961_0008513 | |||
| 1054 | Ga0373962_0004784 | |||
| 1055 | Ga0373931_0097815 | |||
| 1056 | Ga0373947_0000990 | |||
| 1057 | Ga0373947_0011012 | |||
| 1058 | Ga0373947_0102738 | |||
| 1059 | Ga0373925_0005106 | |||
| 1060 | Ga0395899_0005076 | |||
| 1061 | Ga0395899_0022596 | |||
| 1062 | Ga0395899_0022769 | |||
| 1063 | Ga0395899_0038866 | |||
| 1064 | Ga0395899_0143662 | |||
| 1065 | Ga0395899_0190474 | |||
| 1066 | Ga0395900_0005855 | |||
| 1067 | Ga0395900_0031176 | |||
| 1068 | Ga0395900_0034666 | |||
| 1069 | Ga0395900_0106985 | |||
| 1070 | Ga0395900_0121236 | |||
| 1071 | Ga0395900_0216847 | |||
| 1072 | Ga0395900_0236821 | |||
| 1073 | Ga0395898_0008349 | |||
| 1074 | Ga0395898_0029219 | |||
| 1075 | Ga0395898_0070060 | |||
| 1076 | Ga0395898_0123718 | |||
| 1077 | Ga0395898_0195156 | |||
| 1078 | Ga0395905_0009181 | |||
| 1079 | Ga0395905_0012620 | |||
| 1080 | Ga0395905_0025616 | |||
| 1081 | Ga0395905_0032448 | |||
| 1082 | Ga0395905_0043620 | |||
| 1083 | Ga0395905_0060718 | |||
| 1084 | Ga0395905_0065436 | |||
| 1085 | Ga0395901_0003703 | |||
| 1086 | Ga0395901_0004641 | |||
| 1087 | Ga0395901_0007095 | |||
| 1088 | Ga0395901_0007530 | |||
| 1089 | Ga0395901_0028931 | |||
| 1090 | Ga0395901_0066078 | |||
| 1091 | Ga0395901_0119511 | |||
| 1092 | Ga0436365_0252283 | |||
| 1093 | Ga0436363_0663999 | |||
| 1094 | Ga0439466_0017749 | |||
| 1095 | Ga0451791_1521897 | |||
| 1096 | Ga0451793_0005940 | |||
| 1097 | Ga0451800_0432663 | |||
| 1098 | Ga0451807_0335557 | |||
| 1099 | Ga0451845_0378300 | |||
| 1100 | Ga0451849_0222363 | |||
| 1101 | Ga0451855_0079494 | |||
| 1102 | Ga0451853_4118874 | |||
| 1103 | Ga0439445_0008988 | |||
| 1104 | Ga0439448_0009102 | |||
| 1105 | Ga0439459_0007069 | |||
| 1106 | Ga0466969_0002327 | |||
| 1107 | Ga0466961_0024528 | |||
| 1108 | Ga0466963_0000937 | |||
| 1109 | Ga0466963_0001817 | |||
| 1110 | Ga0466963_0002367 | |||
| 1111 | Ga0466963_0010578 | |||
| 1112 | Ga0466963_0010802 | |||
| 1113 | Ga0466963_0015636 | |||
| 1114 | Ga0466963_0023242 | |||
| 1115 | Ga0466963_0025951 | |||
| 1116 | Ga0466964_0000516 | |||
| 1117 | Ga0466964_0002117 | |||
| 1118 | Ga0466964_0005030 | |||
| 1119 | Ga0466964_0009558 | |||
| 1120 | Ga0466964_0053777 | |||
| 1121 | Ga0453684_0388791 | |||
| 1122 | Ga0466971_0001657 | |||
| 1123 | Ga0466971_0008053 | |||
| 1124 | Ga0466968_0007423 | |||
| 1125 | Ga0466970_0005089 | |||
| 1126 | Ga0466957_0005885 | |||
| 1127 | Ga0466957_0008389 | |||
| 1128 | Ga0466957_0015756 | |||
| 1129 | Ga0466957_0019544 | |||
| 1130 | Ga0466957_0020192 | |||
| 1131 | Ga0466957_0027236 | |||
| 1132 | Ga0466957_0143628 | |||
| 1133 | Ga0466960_0006463 | |||
| 1134 | Ga0466960_0006907 | |||
| 1135 | Ga0466960_0056378 | |||
| 1136 | Ga0466960_0074805 | |||
| 1137 | Ga0466959_0012718 | |||
| 1138 | Ga0466959_0112699 | |||
| 1139 | Ga0451576_0310503 | |||
| 1140 | Ga0466958_0002160 | |||
| 1141 | Ga0466958_0002543 | |||
| 1142 | Ga0466958_0091473 | |||
| 1143 | Ga0466967_0001434 | |||
| 1144 | Ga0466967_0002259 | |||
| 1145 | Ga0466967_0002411 | |||
| 1146 | Ga0466967_0006109 | |||
| 1147 | Ga0466967_0016721 | |||
| 1148 | Ga0466967_0019588 | |||
| 1149 | Ga0466967_0023919 | |||
| 1150 | Ga0466967_0067681 | |||
| 1151 | Ga0466967_0081112 | |||
| 1152 | Ga0466967_0102874 | |||
| 1153 | Ga0466967_0270880 | |||
| 1154 | Ga0495592_0009452 | |||
| 1155 | Ga0495603_0002642 | |||
| 1156 | Ga0495603_0012821 | |||
| 1157 | Ga0495629_0005864 | |||
| 1158 | Ga0495629_0056317 | |||
| 1159 | Ga0495641_0006512 | |||
| 1160 | Ga0495653_0186384 | |||
| 1161 | Ga0495580_0142277 | |||
| 1162 | Ga0495582_0004644 | |||
| 1163 | Ga0495582_0014846 | |||
| 1164 | Ga0495582_0016561 | |||
| 1165 | Ga0495582_0019869 | |||
| 1166 | Ga0495582_0026243 | |||
| 1167 | Ga0495582_0136466 | |||
| 1168 | Ga0495605_0015705 | |||
| 1169 | Ga0495639_0007696 | |||
| 1170 | Ga0495639_0026756 | |||
| 1171 | Ga0495662_0006232 | |||
| 1172 | Ga0495662_0092499 | |||
| 1173 | Ga0495664_0003629 | |||
| 1174 | Ga0495664_0084204 | |||
| 1175 | Ga0495584_0025536 | |||
| 1176 | Ga0495584_0068242 | |||
| 1177 | Ga0495585_0053295 | |||
| 1178 | Ga0495594_0063630 | |||
| 1179 | Ga0495618_0013415 | |||
| 1180 | Ga0495628_0039126 | |||
| 1181 | Ga0495630_0024266 | |||
| 1182 | Ga0495630_0026086 | |||
| 1183 | Ga0495630_0047064 | |||
| 1184 | Ga0495637_0052657 | |||
| 1185 | Ga0495644_0006000 | |||
| 1186 | Ga0495666_0009712 | |||
| 1187 | Ga0495652_0029737 | |||
| 1188 | Ga0495652_0062185 | |||
| 1189 | Ga0495652_0100077 | |||
| 1190 | Ga0495640_0029565 | |||
| 1191 | Ga0495640_0063896 | |||
| 1192 | Ga0495586_0041080 | |||
| 1193 | Ga0495598_0030829 | |||
| 1194 | Ga0495609_0097242 | |||
| 1195 | Ga0495645_0031546 | |||
| 1196 | Ga0495656_0039955 | |||
| 1197 | Ga0495634_0031379 | |||
| 1198 | Ga0495634_0070456 | |||
| 1199 | Ga0495635_0010069 | |||
| 1200 | Ga0495635_0017982 | |||
| 1201 | Ga0495635_0031981 | |||
| 1202 | Ga0495659_0001548 | |||
| 1203 | Ga0495661_0025010 | |||
| 1204 | Ga0495588_0001771 | |||
| 1205 | Ga0495588_0027350 | |||
| 1206 | Ga0495657_0049489 | |||
| 1207 | Ga0495599_0010981 | |||
| 1208 | Ga0495599_0200897 | |||
| 1209 | Ga0495623_0088661 | |||
| 1210 | Ga0495647_0000117 | |||
| 1211 | Ga0495647_0034626 | |||
| 1212 | Ga0495658_0002481 | |||
| 1213 | Ga0495613_0009945 | |||
| 1214 | Ga0495624_0022706 | |||
| 1215 | Ga0495589_0086028 | |||
| 1216 | Ga0495581_0001867 | |||
| 1217 | Ga0495604_0019500 | |||
| 1218 | Ga0495636_0052064 | |||
| 1219 | Ga0495674_0022225 | |||
| 1220 | Ga0495674_0052921 | |||
| 1221 | Ga0495674_0059757 | |||
| 1222 | Ga0495674_0112669 | |||
| 1223 | Ga0495676_0009898 | |||
| 1224 | Ga0495676_0014000 | |||
| 1225 | Ga0495676_0040706 | |||
| 1226 | Ga0495676_0112888 | |||
| 1227 | Ga0495680_0048197 | |||
| 1228 | Ga0495680_0199141 | |||
| 1229 | Ga0495684_0008720 | |||
| 1230 | Ga0495684_0020652 | |||
| 1231 | Ga0495684_0042286 | |||
| 1232 | Ga0495684_0153100 | |||
| 1233 | Ga0495593_0022473 | |||
| 1234 | Ga0495614_0000404 | |||
| 1235 | Ga0495614_0046031 | |||
| 1236 | Ga0495614_0061859 | |||
| 1237 | Ga0496100_0009426 | |||
| 1238 | Ga0496100_0019470 | |||
| 1239 | Ga0496100_0041528 | |||
| 1240 | Ga0496100_0120722 | |||
| 1241 | Ga0496101_0021111 | |||
| 1242 | Ga0496101_0046911 | |||
| 1243 | Ga0496101_0064325 | |||
| 1244 | Ga0496101_0125314 | |||
| 1245 | Ga0496102_0018692 | |||
| 1246 | Ga0496102_0030582 | |||
| 1247 | Ga0496102_0032226 | |||
| 1248 | Ga0496102_0051932 | |||
| 1249 | Ga0496102_0096355 | |||
| 1250 | Ga0496102_0247926 | |||
| 1251 | Ga0496102_0365382 | |||
| 1252 | Ga0496103_0003512 | |||
| 1253 | Ga0496103_0009909 | |||
| 1254 | Ga0496103_0022753 | |||
| 1255 | Ga0496103_0023288 | |||
| 1256 | Ga0496103_0046501 | |||
| 1257 | Ga0496104_0000967 | |||
| 1258 | Ga0496104_0001618 | |||
| 1259 | Ga0496104_0004025 | |||
| 1260 | Ga0496104_0036093 | |||
| 1261 | Ga0496104_0192729 | |||
| 1262 | Ga0496104_0212206 | |||
| 1263 | Ga0496105_0001531 | |||
| 1264 | Ga0496105_0010763 | |||
| 1265 | Ga0496105_0022441 | |||
| 1266 | Ga0496105_0048930 | |||
| 1267 | Ga0496105_0072223 | |||
| 1268 | Ga0496105_0086124 | |||
| 1269 | Ga0496105_0138832 | |||
| 1270 | Ga0496105_0203733 | |||
| 1271 | Ga0496106_0034671 | |||
| 1272 | Ga0496106_0046232 | |||
| 1273 | Ga0496107_0002456 | |||
| 1274 | Ga0496107_0015873 | |||
| 1275 | Ga0496107_0027226 | |||
| 1276 | Ga0496107_0062318 | |||
| 1277 | Ga0496107_0127413 | |||
| 1278 | Ga0496107_0141033 | |||
| 1279 | Ga0496108_0000996 | |||
| 1280 | Ga0496108_0009734 | |||
| 1281 | Ga0496108_0011867 | |||
| 1282 | Ga0496108_0018681 | |||
| 1283 | Ga0496108_0029829 | |||
| 1284 | Ga0496108_0054560 | |||
| 1285 | Ga0496108_0146530 | |||
| 1286 | Ga0496109_0002166 | |||
| 1287 | Ga0496109_0010218 | |||
| 1288 | Ga0496109_0021918 | |||
| 1289 | Ga0496109_0025632 | |||
| 1290 | Ga0496109_0041517 | |||
| 1291 | Ga0496109_0043693 | |||
| 1292 | Ga0496109_0058433 | |||
| 1293 | Ga0496109_0059110 | |||
| 1294 | Ga0496109_0104455 | |||
| 1295 | Ga0496109_0155012 | |||
| 1296 | Ga0496109_0206625 | |||
| 1297 | Ga0496109_0289639 | |||
| 1298 | Ga0496109_0299076 | |||
| 1299 | Ga0496110_0002803 | |||
| 1300 | Ga0496110_0010506 | |||
| 1301 | Ga0496110_0019311 | |||
| 1302 | Ga0496110_0034994 | |||
| 1303 | Ga0496110_0057242 | |||
| 1304 | Ga0496111_0002099 | |||
| 1305 | Ga0496111_0009850 | |||
| 1306 | Ga0496111_0018459 | |||
| 1307 | Ga0496111_0038548 | |||
| 1308 | Ga0496111_0101553 | |||
| 1309 | Ga0496111_0191899 | |||
| 1310 | Ga0496112_0000886 | |||
| 1311 | Ga0496112_0001931 | |||
| 1312 | Ga0496112_0089625 | |||
| 1313 | Ga0496112_0105663 | |||
| 1314 | Ga0496112_0210589 | |||
| 1315 | Ga0496113_0000220 | |||
| 1316 | Ga0496113_0002691 | |||
| 1317 | Ga0496113_0016604 | |||
| 1318 | Ga0496113_0042602 | |||
| 1319 | Ga0496113_0043493 | |||
| 1320 | Ga0496113_0065107 | |||
| 1321 | Ga0496114_0014475 | |||
| 1322 | Ga0496114_0028399 | |||
| 1323 | Ga0496114_0046356 | |||
| 1324 | Ga0496114_0078998 | |||
| 1325 | Ga0496114_0095404 | |||
| 1326 | Ga0496114_0126725 | |||
| 1327 | Ga0496115_0001489 | |||
| 1328 | Ga0496115_0012093 | |||
| 1329 | Ga0496115_0018782 | |||
| 1330 | Ga0496115_0021559 | |||
| 1331 | Ga0496115_0037231 | |||
| 1332 | Ga0496115_0068253 | |||
| 1333 | Ga0496115_0072142 | |||
| 1334 | Ga0501031_0006030 | |||
| 1335 | Ga0501033_0002997 | |||
| 1336 | Ga0501036_0002978 | |||
| 1337 | Ga0501039_0073694 | |||
| 1338 | Ga0501040_0022541 | |||
| 1339 | Ga0501041_0016007 | |||
| 1340 | Ga0501042_0001350 | |||
| 1341 | Ga0501043_0000497 | |||
| 1342 | Ga0501046_0013268 | |||
| 1343 | Ga0501048_0015601 | |||
| 1344 | Ga0501067_0000403 | |||
| 1345 | Ga0501067_0002219 | |||
| 1346 | Ga0501067_0058614 | |||
| 1347 | Ga0501068_0000389 | |||
| 1348 | Ga0501068_0032324 | |||
| 1349 | Ga0501069_0000952 | |||
| 1350 | Ga0501069_0001235 | |||
| 1351 | Ga0501069_0010500 | |||
| 1352 | Ga0501069_0013533 | |||
| 1353 | Ga0501069_0024422 | |||
| 1354 | Ga0501069_0061627 | |||
| 1355 | Ga0501070_0002833 | |||
| 1356 | Ga0501070_0011361 | |||
| 1357 | Ga0501070_0018181 | |||
| 1358 | Ga0501071_0003382 | |||
| 1359 | Ga0501072_0016860 | |||
| 1360 | Ga0501072_0095976 | |||
| 1361 | Ga0501072_0213645 | |||
| 1362 | Ga0501073_0009385 | |||
| 1363 | Ga0501074_0011074 | |||
| 1364 | Ga0501074_0018763 | |||
| 1365 | Ga0501075_0020605 | |||
| 1366 | Ga0501076_0022990 | |||
| 1367 | Ga0501077_0016385 | |||
| 1368 | Ga0501080_0004561 | |||
| 1369 | Ga0501081_0002878 | |||
| 1370 | Ga0501083_0015988 | |||
| 1371 | Ga0501083_0017888 | |||
| 1372 | Ga0501035_0025276 | |||
| 1373 | Ga0501045_0013061 | |||
| 1374 | nmdc:mga00v17_76714_c1 | |||
| 1375 | nmdc:mga0yw44_11054_c1 | |||
| 1376 | nmdc:mga05p37_232956_c1 | |||
| 1377 | nmdc:mga08y16_45920_c1 | |||
| 1378 | nmdc:mga0n895_133081_c1 | |||
| 1379 | nmdc:mga0n895_58746_c1 | |||
| 1380 | nmdc:mga0n895_6178_c1 | |||
| 1381 | nmdc:mga0rr50_12702_c1 | |||
| 1382 | nmdc:mga0rr50_26342_c1 | |||
| 1383 | nmdc:mga08x19_35580_c1 | |||
| 1384 | nmdc:mga0a205_17646_c1 | |||
| 1385 | nmdc:mga0a205_291573_c1 | |||
| 1386 | Ga0495601_0073381 | |||
| 1387 | Ga0495601_0200943 | |||
| 1388 | Ga0495612_0013669 | |||
| 1389 | Ga0495612_0035484 | |||
| 1390 | Ga0495655_0007585 | |||
| 1391 | Ga0495595_0003635 | |||
| 1392 | Ga0495619_0035019 | |||
| 1393 | Ga0495619_0119130 | |||
| 1394 | Ga0501084_0024288 | |||
| 1395 | Ga0501084_0038387 | |||
| 1396 | Ga0587077_005055 | |||
| 1397 | Ga0587077_007509 | |||
| 1398 | Ga0587080_001633 | |||
| 1399 | Ga0587082_002517 | |||
| 1400 | Ga0587083_0011793 | |||
| 1401 | Ga0587085_001208 | |||
| 1402 | Ga0587086_003052 | |||
| 1403 | Ga0587088_004135 | |||
| 1404 | Ga0587067_003050 | |||
| 1405 | Ga0587069_007020 | |||
| 1406 | Ga0587072_006636 | |||
| 1407 | Ga0587107_002115 | |||
| 1408 | Ga0587111_0003738 | |||
| 1409 | Ga0501082_0017499 | |||
| 1410 | Ga0530510_0008013 | |||
| 1411 | Ga0530510_0017002 | |||
| 1412 | Ga0530510_0137580 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v84-assembly1.cif.gz_A | crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum | 0.8563 | 22 | 362 |
| 2v84-assembly1.cif.gz_A | crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum | 0.8538 | 22 | 362 |
| 1poy-assembly1.cif.gz_2 | spermidine/putrescine-binding protein complexed with spermidine (dimer form) | 0.8455 | 21 | 361 |
| 1poy-assembly1.cif.gz_2 | spermidine/putrescine-binding protein complexed with spermidine (dimer form) | 0.8384 | 21 | 361 |
| 4eqb-assembly2.cif.gz_B | 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes | 0.8326 | 21 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v84A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8762 | 22 | 315 | 3.40.190.10 |
| 1poy101 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8719 | 21 | 326 | 3.40.190.10 |
| 2v84A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8668 | 144 | 262 | 3.40.190.10 |
| af_Q2G2A8_33_356_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8621 | 22 | 359 | 3.40.190.10 |
| 1potA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8586 | 142 | 362 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C4IVZ4-F1-model_v4 | deleted | 0.9646 | 21 | 361 |
|
| AF-A0A1Q3Q4T1-F1-model_v4 | deleted | 0.9642 | 16 | 362 |
|
| AF-A0A6B1N6T3-F1-model_v4 | deleted | 0.9548 | 65 | 362 |
|
| AF-A0A2U3C5K2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9426 | 17 | 362 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A6B1N6T3-F1-model_v4 | deleted | 0.9425 | 65 | 362 |
|