F476450

General Info

Members Datasets Scaffolds Average Seq Length
706 317 1412 372

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100024080|Ga0070683_1000240801
Length 395
Sequence MTQSQFTRQELLRRGLAGSALLTVPGLLAACGSGSKGAASTSTTSGKQQLAKTLHFSNWTLYIDVNNKTKSHPSLQAFQQRYGTHVDYVEDINDNASYFGKIQGALSRGQSINRDIIVMTDNDRYLSLMIKKGWTEKLDKSAIPNIKNLVEVQRHPTFDPNREYSLPWQSGMTGIAYNDKLTDPVLSVTDLLENPKLKGKVTSLNSMGDALTLVMLANGDDPSHVTDKSFSAAFNRIKKAVDDKQIRQFTGNDYAPSLAKGDLAAAMSWSGDIAQIGNSHIHWNVPKDGGALWTDNMIIPKGGNVYTASVYMNYVYDPSVMGLMEAGDPKRNITGIYYIPPVIGAKQAALKLNPAVANNQLIFPSAETLSKVHLFDSAALNNQKYLTQWQNLISG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
179 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
180 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 2.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 14.31
Rhizosphere 84.42
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100024080 3300005329 Bacteria 5448
2 JGI25407J50210_10001565 3300003373 Bacteria 5212
3 JGI25404J52841_10024007 3300003659 Unclassified 1315
4 Ga0058862_10004946 3300004803 Bacteria 2033
5 Ga0058862_12749158 3300004803 Bacteria 1709
6 Ga0070658_10023603 3300005327 Bacteria 4935
7 Ga0070683_100120480 3300005329 Bacteria 2478
8 Ga0070683_100124997 3300005329 Bacteria 2431
9 Ga0070683_100152225 3300005329 Bacteria 2193
10 Ga0070690_100013723 3300005330 Bacteria 4798
11 Ga0068869_100087515 3300005334 Bacteria 2337
12 Ga0070666_10121607 3300005335 Unclassified 1811
13 Ga0070680_100007965 3300005336 Bacteria 8088
14 Ga0070680_100047719 3300005336 Bacteria 3487
15 Ga0070680_100073798 3300005336 Bacteria 2806
16 Ga0070680_100102155 3300005336 Bacteria 2381
17 Ga0070680_100107399 3300005336 Bacteria 2322
18 Ga0070680_100236375 3300005336 Bacteria 1544
19 Ga0070682_100020440 3300005337 Bacteria 3895
20 Ga0070682_100024510 3300005337 Bacteria 3592
21 Ga0068868_100048270 3300005338 Bacteria 3339
22 Ga0068868_100148533 3300005338 Bacteria 1929
23 Ga0070660_100005513 3300005339 Bacteria 8764
24 Ga0070660_100040732 3300005339 Bacteria 3537
25 Ga0070689_100008321 3300005340 Bacteria 7303
26 Ga0070691_10043552 3300005341 Bacteria 2126
27 Ga0070661_100014914 3300005344 Bacteria 5480
28 Ga0070661_100043625 3300005344 Bacteria 3276
29 Ga0070661_100130148 3300005344 Bacteria 1889
30 Ga0070692_10002761 3300005345 Bacteria 6912
31 Ga0070668_100030525 3300005347 Bacteria 4097
32 Ga0070668_100160967 3300005347 Bacteria 1821
33 Ga0070675_100243693 3300005354 Unclassified 1571
34 Ga0070674_100022407 3300005356 Bacteria 4074
35 Ga0070674_100023154 3300005356 Bacteria 4015
36 Ga0070688_100014573 3300005365 Bacteria 4458
37 Ga0070659_100042536 3300005366 Bacteria 3552
38 Ga0070659_100070140 3300005366 Bacteria 2783
39 Ga0070709_10008900 3300005434 Bacteria 5526
40 Ga0070709_10181712 3300005434 Unclassified 1477
41 Ga0070714_100014369 3300005435 Bacteria 6359
42 Ga0070714_100025272 3300005435 Bacteria 4899
43 Ga0070714_100056819 3300005435 Bacteria 3348
44 Ga0070713_100028424 3300005436 Bacteria 4415
45 Ga0070713_100050775 3300005436 Bacteria 3427
46 Ga0070713_100057501 3300005436 Bacteria 3239
47 Ga0070713_100258493 3300005436 Bacteria 1591
48 Ga0070710_10001625 3300005437 Bacteria 10618
49 Ga0070710_10005790 3300005437 Bacteria 5891
50 Ga0070711_100009827 3300005439 Bacteria 5900
51 Ga0070705_100012181 3300005440 Bacteria 4364
52 Ga0070705_100015497 3300005440 Bacteria 3944
53 Ga0070705_100022314 3300005440 Bacteria 3381
54 Ga0070705_100120813 3300005440 Unclassified 1691
55 Ga0070700_100028398 3300005441 Bacteria 3327
56 Ga0070700_100062090 3300005441 Bacteria 2360
57 Ga0070694_100021115 3300005444 Bacteria 4158
58 Ga0070694_100042816 3300005444 Bacteria 3025
59 Ga0070694_100108864 3300005444 Bacteria 1971
60 Ga0070708_100027320 3300005445 Bacteria 4896
61 Ga0070708_100028883 3300005445 Bacteria 4776
62 Ga0070708_100132313 3300005445 Bacteria 2309
63 Ga0070678_100000442 3300005456 Bacteria 19620
64 Ga0070678_100023110 3300005456 Bacteria 4137
65 Ga0070678_100084059 3300005456 Bacteria 2421
66 Ga0070662_100005385 3300005457 Bacteria 8170
67 Ga0070662_100068740 3300005457 Bacteria 2605
68 Ga0070681_10026263 3300005458 Bacteria 5853
69 Ga0070681_10069858 3300005458 Bacteria 3478
70 Ga0070681_10109059 3300005458 Bacteria 2708
71 Ga0068867_100006216 3300005459 Bacteria 8457
72 Ga0070685_10004918 3300005466 Bacteria 6759
73 Ga0070706_100005519 3300005467 Bacteria 12039
74 Ga0070706_100009854 3300005467 Bacteria 8877
75 Ga0070706_100178289 3300005467 Bacteria 1984
76 Ga0070707_100001518 3300005468 Bacteria 22613
77 Ga0070707_100010429 3300005468 Bacteria 8654
78 Ga0070707_100072782 3300005468 Bacteria 3313
79 Ga0070707_100151579 3300005468 Bacteria 2257
80 Ga0070707_100195534 3300005468 Bacteria 1972
81 Ga0070698_100001085 3300005471 Bacteria 29891
82 Ga0070698_100010575 3300005471 Bacteria 9836
83 Ga0070698_100011117 3300005471 Bacteria 9562
84 Ga0070699_100023472 3300005518 Bacteria 5313
85 Ga0070679_100027668 3300005530 Bacteria 5582
86 Ga0070679_100032458 3300005530 Bacteria 5165
87 Ga0070679_100077214 3300005530 Bacteria 3319
88 Ga0070684_100028844 3300005535 Bacteria 4697
89 Ga0070684_100087881 3300005535 Bacteria 2760
90 Ga0070684_100099924 3300005535 Bacteria 2590
91 Ga0070684_100134936 3300005535 Bacteria 2228
92 Ga0070697_100032076 3300005536 Bacteria 4225
93 Ga0070697_100070504 3300005536 Bacteria 2865
94 Ga0068853_100030464 3300005539 Bacteria 4556
95 Ga0070686_100023451 3300005544 Bacteria 3687
96 Ga0070695_100030883 3300005545 Bacteria 3337
97 Ga0070696_100039202 3300005546 Bacteria 3272
98 Ga0070696_100046404 3300005546 Bacteria 3012
99 Ga0070693_100024395 3300005547 Bacteria 3243
100 Ga0070693_100062394 3300005547 Bacteria 2169
101 Ga0070665_100035292 3300005548 Bacteria 5028
102 Ga0070665_100095175 3300005548 Bacteria 2983
103 Ga0070704_100026780 3300005549 Bacteria 3815
104 Ga0068855_100029141 3300005563 Bacteria 6602
105 Ga0068855_100051058 3300005563 Bacteria 4871
106 Ga0068855_100081129 3300005563 Bacteria 3760
107 Ga0068855_100110835 3300005563 Bacteria 3150
108 Ga0068855_100113296 3300005563 Bacteria 3111
109 Ga0068855_100280966 3300005563 Unclassified 1848
110 Ga0068855_100293109 3300005563 Bacteria 1803
111 Ga0068855_100318484 3300005563 Bacteria 1720
112 Ga0068857_100144954 3300005577 Bacteria 2149
113 Ga0068857_100160396 3300005577 Bacteria 2040
114 Ga0068856_100026471 3300005614 Bacteria 5656
115 Ga0068856_100035486 3300005614 Bacteria 4887
116 Ga0068856_100058209 3300005614 Bacteria 3816
117 Ga0068856_100326582 3300005614 Bacteria 1552
118 Ga0068856_100347152 3300005614 Bacteria 1502
119 Ga0070702_100012399 3300005615 Bacteria 4270
120 Ga0070702_100028539 3300005615 Bacteria 3025
121 Ga0070702_100048106 3300005615 Bacteria 2426
122 Ga0068852_100092908 3300005616 Bacteria 2703
123 Ga0068852_100111759 3300005616 Bacteria 2485
124 Ga0068864_100191535 3300005618 Bacteria 1875
125 Ga0068866_10004144 3300005718 Bacteria 5944
126 Ga0068861_100049753 3300005719 Bacteria 3175
127 Ga0068861_100076174 3300005719 Bacteria 2614
128 Ga0068861_100210483 3300005719 Bacteria 1637
129 Ga0081455_10001178 3300005937 Bacteria 32690
130 Ga0081455_10005512 3300005937 Bacteria 13870
131 Ga0081455_10048055 3300005937 Bacteria 3690
132 Ga0081538_10000138 3300005981 Bacteria 75121
133 Ga0081540_1002348 3300005983 Bacteria 15492
134 Ga0081540_1008368 3300005983 Bacteria 7229
135 Ga0070717_10030764 3300006028 Bacteria 4314
136 Ga0070717_10040175 3300006028 Bacteria 3809
137 Ga0070717_10054826 3300006028 Bacteria 3288
138 Ga0070717_10144535 3300006028 Bacteria 2054
139 Ga0075432_10009109 3300006058 Bacteria 3382
140 Ga0070715_10000120 3300006163 Bacteria 18786
141 Ga0070715_10113269 3300006163 Bacteria 1283
142 Ga0070716_100072825 3300006173 Bacteria 2025
143 Ga0070712_100006659 3300006175 Bacteria 7183
144 Ga0070712_100031018 3300006175 Bacteria 3598
145 Ga0075362_10021821 3300006177 Bacteria 2692
146 Ga0097621_100086202 3300006237 Bacteria 2620
147 Ga0097621_100167090 3300006237 Bacteria 1894
148 Ga0097621_100193196 3300006237 Bacteria 1764
149 Ga0068871_100003070 3300006358 Bacteria 11453
150 Ga0068871_100025871 3300006358 Bacteria 4572
151 Ga0068871_100068128 3300006358 Bacteria 2921
152 Ga0075428_100048614 3300006844 Bacteria 4655
153 Ga0075430_100014061 3300006846 Bacteria 6823
154 Ga0075433_10028527 3300006852 Bacteria 4746
155 Ga0075433_10038801 3300006852 Bacteria 4115
156 Ga0075434_100032472 3300006871 Bacteria 5147
157 Ga0075434_100036266 3300006871 Bacteria 4878
158 Ga0075434_100137850 3300006871 Bacteria 2459
159 Ga0075429_100189634 3300006880 Bacteria 1801
160 Ga0068865_100008117 3300006881 Bacteria 6479
161 Ga0068865_100304828 3300006881 Bacteria 1276
162 Ga0075436_100020126 3300006914 Bacteria 4580
163 Ga0075436_100148785 3300006914 Bacteria 1647
164 Ga0075435_100033701 3300007076 Bacteria 4052
165 Ga0105250_10025459 3300009092 Bacteria 2384
166 Ga0105240_10015896 3300009093 Bacteria 10208
167 Ga0105240_10039055 3300009093 Bacteria 6082
168 Ga0105240_10059512 3300009093 Bacteria 4767
169 Ga0111539_10099690 3300009094 Bacteria 3411
170 Ga0111539_10406537 3300009094 Bacteria 1585
171 Ga0105245_10011919 3300009098 Bacteria 7560
172 Ga0105245_10048211 3300009098 Bacteria 3810
173 Ga0105245_10077461 3300009098 Bacteria 3031
174 Ga0105245_10118994 3300009098 Bacteria 2465
175 Ga0105245_10189653 3300009098 Bacteria 1968
176 Ga0105247_10016213 3300009101 Bacteria 4464
177 Ga0114129_10171013 3300009147 Bacteria 2962
178 Ga0114129_10176202 3300009147 Bacteria 2912
179 Ga0105243_10006519 3300009148 Bacteria 9020
180 Ga0105243_10124923 3300009148 Bacteria 2175
181 Ga0105243_10307683 3300009148 Bacteria 1439
182 Ga0105241_10161272 3300009174 Bacteria 1843
183 Ga0105242_10018967 3300009176 Bacteria 5387
184 Ga0105242_10020103 3300009176 Bacteria 5233
185 Ga0105242_10061511 3300009176 Bacteria 3089
186 Ga0105242_10084480 3300009176 Bacteria 2660
187 Ga0105248_10081226 3300009177 Bacteria 3644
188 Ga0105248_10103575 3300009177 Bacteria 3208
189 Ga0105237_10010937 3300009545 Bacteria 9629
190 Ga0105237_10083602 3300009545 Bacteria 3183
191 Ga0105237_10109684 3300009545 Bacteria 2751
192 Ga0105238_10059323 3300009551 Bacteria 3833
193 Ga0105238_10164767 3300009551 Bacteria 2192
194 Ga0105238_10276644 3300009551 Bacteria 1659
195 Ga0105249_10000948 3300009553 Bacteria 25660
196 Ga0105249_10018638 3300009553 Bacteria 6181
197 Ga0105239_10039360 3300010375 Bacteria 5181
198 Ga0105239_10116859 3300010375 Bacteria 2960
199 Ga0105246_10121086 3300011119 Unclassified 1939
200 Ga0157371_10059178 3300013102 Bacteria 2716
201 Ga0157370_10030838 3300013104 Bacteria 5252
202 Ga0157369_10045756 3300013105 Bacteria 4758
203 Ga0157369_10337990 3300013105 Unclassified 1564
204 Ga0157369_10357056 3300013105 Bacteria 1517
205 Ga0157374_10034025 3300013296 Bacteria 4652
206 Ga0157374_10050794 3300013296 Bacteria 3855
207 Ga0157374_10053238 3300013296 Bacteria 3772
208 Ga0157374_10135952 3300013296 Bacteria 2383
209 Ga0157374_10183535 3300013296 Bacteria 2045
210 Ga0157378_10067816 3300013297 Bacteria 3198
211 Ga0157378_10255667 3300013297 Unclassified 1679
212 Ga0157378_10268832 3300013297 Bacteria 1639
213 Ga0163162_10023656 3300013306 Bacteria 6066
214 Ga0163162_10080663 3300013306 Bacteria 3322
215 Ga0163162_10168503 3300013306 Bacteria 2314
216 Ga0163162_10219089 3300013306 Bacteria 2033
217 Ga0157372_10011814 3300013307 Bacteria 9303
218 Ga0157372_10090271 3300013307 Bacteria 3483
219 Ga0157372_10206990 3300013307 Bacteria 2273
220 Ga0157372_10209151 3300013307 Bacteria 2261
221 Ga0157372_10227629 3300013307 Bacteria 2161
222 Ga0157372_10238196 3300013307 Bacteria 2111
223 Ga0157372_10383932 3300013307 Unclassified 1636
224 Ga0157375_10029269 3300013308 Bacteria 5177
225 Ga0157375_10129179 3300013308 Bacteria 2645
226 Ga0157377_10025925 3300014745 Bacteria 3131
227 Ga0157376_10005458 3300014969 Bacteria 8886
228 Ga0157376_10014185 3300014969 Bacteria 5971
229 Ga0163161_10237547 3300017792 Unclassified 1416
230 Ga0197907_11238927 3300020069 Bacteria 5708
231 Ga0197907_11268062 3300020069 Bacteria 2137
232 Ga0206350_10538545 3300020080 Bacteria 2267
233 Ga0224712_10009892 3300022467 Bacteria 2894
234 Ga0207696_1026201 3300025711 Bacteria 1806
235 Ga0207653_10023673 3300025885 Bacteria 1957
236 Ga0207653_10026817 3300025885 Bacteria 1848
237 Ga0207692_10008727 3300025898 Bacteria 4208
238 Ga0207688_10014206 3300025901 Bacteria 4333
239 Ga0207685_10001820 3300025905 Bacteria 4656
240 Ga0207699_10155119 3300025906 Unclassified 1519
241 Ga0207705_10011519 3300025909 Bacteria 6396
242 Ga0207705_10015166 3300025909 Bacteria 5538
243 Ga0207684_10015225 3300025910 Bacteria 6624
244 Ga0207684_10058065 3300025910 Bacteria 3283
245 Ga0207684_10060697 3300025910 Bacteria 3211
246 Ga0207654_10035652 3300025911 Bacteria 2773
247 Ga0207654_10054480 3300025911 Bacteria 2312
248 Ga0207707_10001761 3300025912 Bacteria 19878
249 Ga0207707_10002492 3300025912 Bacteria 16577
250 Ga0207707_10081311 3300025912 Bacteria 2828
251 Ga0207695_10071012 3300025913 Bacteria 3557
252 Ga0207695_10135545 3300025913 Bacteria 2415
253 Ga0207671_10075260 3300025914 Bacteria 2525
254 Ga0207671_10083725 3300025914 Bacteria 2395
255 Ga0207671_10148707 3300025914 Bacteria 1809
256 Ga0207693_10001119 3300025915 Bacteria 24079
257 Ga0207693_10004453 3300025915 Bacteria 11836
258 Ga0207693_10005339 3300025915 Bacteria 10737
259 Ga0207693_10007372 3300025915 Bacteria 9045
260 Ga0207693_10051308 3300025915 Bacteria 3238
261 Ga0207663_10002132 3300025916 Bacteria 9442
262 Ga0207663_10003179 3300025916 Bacteria 7990
263 Ga0207663_10007050 3300025916 Bacteria 5804
264 Ga0207660_10021336 3300025917 Bacteria 4355
265 Ga0207660_10099945 3300025917 Bacteria 2165
266 Ga0207660_10124308 3300025917 Unclassified 1958
267 Ga0207660_10279515 3300025917 Unclassified 1324
268 Ga0207657_10002585 3300025919 Bacteria 19586
269 Ga0207649_10107802 3300025920 Bacteria 1855
270 Ga0207649_10145876 3300025920 Bacteria 1624
271 Ga0207652_10022704 3300025921 Bacteria 5195
272 Ga0207652_10307791 3300025921 Unclassified 1430
273 Ga0207646_10001000 3300025922 Bacteria 36321
274 Ga0207646_10004378 3300025922 Bacteria 15370
275 Ga0207646_10011349 3300025922 Bacteria 8644
276 Ga0207646_10077203 3300025922 Bacteria 2977
277 Ga0207646_10144515 3300025922 Bacteria 2143
278 Ga0207694_10029083 3300025924 Bacteria 4214
279 Ga0207694_10039476 3300025924 Bacteria 3633
280 Ga0207694_10095017 3300025924 Bacteria 2356
281 Ga0207687_10010093 3300025927 Bacteria 6176
282 Ga0207687_10024082 3300025927 Bacteria 4063
283 Ga0207687_10033346 3300025927 Bacteria 3492
284 Ga0207687_10034212 3300025927 Bacteria 3450
285 Ga0207687_10213264 3300025927 Bacteria 1516
286 Ga0207664_10005273 3300025929 Bacteria 8832
287 Ga0207664_10011464 3300025929 Bacteria 6304
288 Ga0207664_10027751 3300025929 Bacteria 4296
289 Ga0207664_10097135 3300025929 Bacteria 2426
290 Ga0207664_10249890 3300025929 Bacteria 1547
291 Ga0207706_10019714 3300025933 Bacteria 6067
292 Ga0207706_10031554 3300025933 Bacteria 4720
293 Ga0207686_10010919 3300025934 Bacteria 4954
294 Ga0207709_10007136 3300025935 Bacteria 6238
295 Ga0207709_10096254 3300025935 Bacteria 1947
296 Ga0207709_10113013 3300025935 Unclassified 1820
297 Ga0207669_10048896 3300025937 Bacteria 2516
298 Ga0207669_10136885 3300025937 Unclassified 1693
299 Ga0207704_10021540 3300025938 Bacteria 3435
300 Ga0207665_10000462 3300025939 Bacteria 27963
301 Ga0207665_10005207 3300025939 Bacteria 8685
302 Ga0207665_10133595 3300025939 Bacteria 1764
303 Ga0207711_10033528 3300025941 Bacteria 4346
304 Ga0207689_10086235 3300025942 Bacteria 2580
305 Ga0207661_10035307 3300025944 Bacteria 3895
306 Ga0207661_10054152 3300025944 Bacteria 3213
307 Ga0207667_10182134 3300025949 Bacteria 2157
308 Ga0207712_10032372 3300025961 Bacteria 3529
309 Ga0207668_10025865 3300025972 Bacteria 3804
310 Ga0207677_10064293 3300026023 Bacteria 2554
311 Ga0207677_10323151 3300026023 Bacteria 1283
312 Ga0207639_10014973 3300026041 Bacteria 5464
313 Ga0207639_10091022 3300026041 Bacteria 2441
314 Ga0207639_10166859 3300026041 Bacteria 1861
315 Ga0207678_10166659 3300026067 Bacteria 1881
316 Ga0207708_10000564 3300026075 Bacteria 28643
317 Ga0207708_10003976 3300026075 Bacteria 10876
318 Ga0207702_10001525 3300026078 Bacteria 22924
319 Ga0207702_10195610 3300026078 Bacteria 1871
320 Ga0207702_10352381 3300026078 Bacteria 1409
321 Ga0207648_10001096 3300026089 Bacteria 30351
322 Ga0207674_10038198 3300026116 Bacteria 4988
323 Ga0207674_10108165 3300026116 Bacteria 2757
324 Ga0207674_10159079 3300026116 Bacteria 2214
325 Ga0207675_100001665 3300026118 Bacteria 22230
326 Ga0207675_100006719 3300026118 Bacteria 10877
327 Ga0207675_100015619 3300026118 Bacteria 7082
328 Ga0207683_10000251 3300026121 Bacteria 47816
329 Ga0207683_10054732 3300026121 Bacteria 3498
330 Ga0207683_10067003 3300026121 Bacteria 3167
331 Ga0207683_10079341 3300026121 Bacteria 2910
332 Ga0207698_10097487 3300026142 Bacteria 2426
333 Ga0207428_10001520 3300027907 Bacteria 24213
334 Ga0207428_10025482 3300027907 Bacteria 4950
335 Ga0268266_10030241 3300028379 Bacteria 4603
336 Ga0268265_10162969 3300028380 Bacteria 1897
337 Ga0307416_100101496 3300032002 Bacteria 2506
338 Ga0307415_100062748 3300032126 Bacteria 2579
339 Ga0373959_0015109 3300034820 Bacteria 1414
340 Ga0373926_0026293 3300035083 Unclassified 2035
341 Ga0373944_0004987 3300035089 Bacteria 3482
342 Ga0373949_0008840 3300035090 Bacteria 2204
343 Ga0373952_0009172 3300035092 Bacteria 1889
344 Ga0373943_0008505 3300035170 Bacteria 4603
345 Ga0373943_0056003 3300035170 Unclassified 1955
346 Ga0373943_0086308 3300035170 Bacteria 1618
347 Ga0373961_0008513 3300035241 Bacteria 2495
348 Ga0373962_0004784 3300035242 Bacteria 3269
349 Ga0373931_0097815 3300035691 Bacteria 1646
350 Ga0373947_0000990 3300035725 Bacteria 17360
351 Ga0373947_0011012 3300035725 Bacteria 5187
352 Ga0373947_0102738 3300035725 Bacteria 1798
353 Ga0373925_0005106 3300037068 Bacteria 9829
354 Ga0395899_0005076 3300037312 Bacteria 10243
355 Ga0395899_0022596 3300037312 Bacteria 4765
356 Ga0395899_0022769 3300037312 Bacteria 4747
357 Ga0395899_0038866 3300037312 Bacteria 3563
358 Ga0395899_0143662 3300037312 Bacteria 1696
359 Ga0395899_0190474 3300037312 Bacteria 1435
360 Ga0395900_0005855 3300037418 Bacteria 12833
361 Ga0395900_0031176 3300037418 Bacteria 5476
362 Ga0395900_0034666 3300037418 Bacteria 5198
363 Ga0395900_0106985 3300037418 Bacteria 2873
364 Ga0395900_0121236 3300037418 Bacteria 2683
365 Ga0395900_0216847 3300037418 Bacteria 1931
366 Ga0395900_0236821 3300037418 Bacteria 1833
367 Ga0395898_0008349 3300037466 Bacteria 10948
368 Ga0395898_0029219 3300037466 Bacteria 5523
369 Ga0395898_0070060 3300037466 Bacteria 3391
370 Ga0395898_0123718 3300037466 Bacteria 2478
371 Ga0395898_0195156 3300037466 Bacteria 1934
372 Ga0395905_0009181 3300037471 Bacteria 9682
373 Ga0395905_0012620 3300037471 Bacteria 8128
374 Ga0395905_0025616 3300037471 Bacteria 5562
375 Ga0395905_0032448 3300037471 Bacteria 4911
376 Ga0395905_0043620 3300037471 Bacteria 4207
377 Ga0395905_0060718 3300037471 Bacteria 3535
378 Ga0395905_0065436 3300037471 Bacteria 3403
379 Ga0395901_0003703 3300038443 Bacteria 15418
380 Ga0395901_0004641 3300038443 Bacteria 13858
381 Ga0395901_0007095 3300038443 Bacteria 11326
382 Ga0395901_0007530 3300038443 Bacteria 10995
383 Ga0395901_0028931 3300038443 Bacteria 5701
384 Ga0395901_0066078 3300038443 Bacteria 3767
385 Ga0395901_0119511 3300038443 Bacteria 2769
386 Ga0436365_0252283 3300039437 Bacteria 1791
387 Ga0436363_0663999 3300039450 Bacteria 1690
388 Ga0439466_0017749 3300041411 Bacteria 2560
389 Ga0451791_1521897 3300041451 Bacteria 1742
390 Ga0451793_0005940 3300041452 Bacteria 3019
391 Ga0451800_0432663 3300041459 Bacteria 4497
392 Ga0451807_0335557 3300041486 Bacteria 2696
393 Ga0451845_0378300 3300041501 Bacteria 2476
394 Ga0451849_0222363 3300041505 Bacteria 1788
395 Ga0451855_0079494 3300041511 Bacteria 1978
396 Ga0451853_4118874 3300041512 Bacteria 1127
397 Ga0439445_0008988 3300042004 Bacteria 2348
398 Ga0439448_0009102 3300042005 Bacteria 2922
399 Ga0439459_0007069 3300042438 Bacteria 1887
400 Ga0466969_0002327 3300044656 Bacteria 10143
401 Ga0466961_0024528 3300044693 Bacteria 3879
402 Ga0466963_0000937 3300044694 Bacteria 14912
403 Ga0466963_0001817 3300044694 Bacteria 11618
404 Ga0466963_0002367 3300044694 Bacteria 10527
405 Ga0466963_0010578 3300044694 Bacteria 5591
406 Ga0466963_0010802 3300044694 Bacteria 5543
407 Ga0466963_0015636 3300044694 Bacteria 4705
408 Ga0466963_0023242 3300044694 Bacteria 3933
409 Ga0466963_0025951 3300044694 Bacteria 3742
410 Ga0466964_0000516 3300044706 Bacteria 12053
411 Ga0466964_0002117 3300044706 Bacteria 6992
412 Ga0466964_0005030 3300044706 Bacteria 4888
413 Ga0466964_0009558 3300044706 Bacteria 3654
414 Ga0466964_0053777 3300044706 Bacteria 1658
415 Ga0453684_0388791 3300044712 Bacteria 1565
416 Ga0466971_0001657 3300044719 Bacteria 9417
417 Ga0466971_0008053 3300044719 Bacteria 4595
418 Ga0466968_0007423 3300044735 Bacteria 4168
419 Ga0466970_0005089 3300044765 Bacteria 6501
420 Ga0466957_0005885 3300044842 Bacteria 6913
421 Ga0466957_0008389 3300044842 Bacteria 5876
422 Ga0466957_0015756 3300044842 Bacteria 4416
423 Ga0466957_0019544 3300044842 Bacteria 3984
424 Ga0466957_0020192 3300044842 Bacteria 3920
425 Ga0466957_0027236 3300044842 Bacteria 3395
426 Ga0466957_0143628 3300044842 Bacteria 1539
427 Ga0466960_0006463 3300044901 Bacteria 4703
428 Ga0466960_0006907 3300044901 Bacteria 4577
429 Ga0466960_0056378 3300044901 Bacteria 1913
430 Ga0466960_0074805 3300044901 Bacteria 1693
431 Ga0466959_0012718 3300045049 Bacteria 6088
432 Ga0466959_0112699 3300045049 Bacteria 1940
433 Ga0451576_0310503 3300045051 Bacteria 1650
434 Ga0466958_0002160 3300045836 Bacteria 9790
435 Ga0466958_0002543 3300045836 Bacteria 9202
436 Ga0466958_0091473 3300045836 Bacteria 1883
437 Ga0466967_0001434 3300045976 Bacteria 13835
438 Ga0466967_0002259 3300045976 Bacteria 11875
439 Ga0466967_0002411 3300045976 Bacteria 11613
440 Ga0466967_0006109 3300045976 Bacteria 8470
441 Ga0466967_0016721 3300045976 Bacteria 5796
442 Ga0466967_0019588 3300045976 Bacteria 5446
443 Ga0466967_0023919 3300045976 Bacteria 5014
444 Ga0466967_0067681 3300045976 Bacteria 3186
445 Ga0466967_0081112 3300045976 Bacteria 2929
446 Ga0466967_0102874 3300045976 Bacteria 2613
447 Ga0466967_0270880 3300045976 Bacteria 1627
448 Ga0495592_0009452 3300046454 Bacteria 7331
449 Ga0495603_0002642 3300046455 Bacteria 10570
450 Ga0495603_0012821 3300046455 Bacteria 5069
451 Ga0495629_0005864 3300046459 Bacteria 9156
452 Ga0495629_0056317 3300046459 Bacteria 2749
453 Ga0495641_0006512 3300046461 Bacteria 7549
454 Ga0495653_0186384 3300046463 Bacteria 1419
455 Ga0495580_0142277 3300046472 Unclassified 1663
456 Ga0495582_0004644 3300046473 Bacteria 7719
457 Ga0495582_0014846 3300046473 Bacteria 4280
458 Ga0495582_0016561 3300046473 Bacteria 4037
459 Ga0495582_0019869 3300046473 Bacteria 3674
460 Ga0495582_0026243 3300046473 Bacteria 3193
461 Ga0495582_0136466 3300046473 Unclassified 1388
462 Ga0495605_0015705 3300046474 Bacteria 4115
463 Ga0495639_0007696 3300046475 Bacteria 4633
464 Ga0495639_0026756 3300046475 Bacteria 2551
465 Ga0495662_0006232 3300046476 Bacteria 5960
466 Ga0495662_0092499 3300046476 Unclassified 1475
467 Ga0495664_0003629 3300046477 Bacteria 8416
468 Ga0495664_0084204 3300046477 Bacteria 1908
469 Ga0495584_0025536 3300046491 Bacteria 2995
470 Ga0495584_0068242 3300046491 Bacteria 1786
471 Ga0495585_0053295 3300046492 Bacteria 2239
472 Ga0495594_0063630 3300046499 Bacteria 2044
473 Ga0495618_0013415 3300046514 Bacteria 4985
474 Ga0495628_0039126 3300046516 Bacteria 3794
475 Ga0495630_0024266 3300046517 Bacteria 4484
476 Ga0495630_0026086 3300046517 Bacteria 4325
477 Ga0495630_0047064 3300046517 Bacteria 3225
478 Ga0495637_0052657 3300046520 Unclassified 1698
479 Ga0495644_0006000 3300046523 Bacteria 4733
480 Ga0495666_0009712 3300046526 Bacteria 4808
481 Ga0495652_0029737 3300046529 Bacteria 4796
482 Ga0495652_0062185 3300046529 Bacteria 3148
483 Ga0495652_0100077 3300046529 Bacteria 2353
484 Ga0495640_0029565 3300046533 Bacteria 3932
485 Ga0495640_0063896 3300046533 Bacteria 2490
486 Ga0495586_0041080 3300046535 Bacteria 2490
487 Ga0495598_0030829 3300046537 Bacteria 1505
488 Ga0495609_0097242 3300046538 Bacteria 1277
489 Ga0495645_0031546 3300046543 Bacteria 3862
490 Ga0495656_0039955 3300046615 Bacteria 1952
491 Ga0495634_0031379 3300046642 Bacteria 3660
492 Ga0495634_0070456 3300046642 Bacteria 2304
493 Ga0495635_0010069 3300046663 Bacteria 6609
494 Ga0495635_0017982 3300046663 Bacteria 4936
495 Ga0495635_0031981 3300046663 Bacteria 3651
496 Ga0495659_0001548 3300046664 Bacteria 7750
497 Ga0495661_0025010 3300046665 Bacteria 3863
498 Ga0495588_0001771 3300046674 Bacteria 9194
499 Ga0495588_0027350 3300046674 Bacteria 2851
500 Ga0495657_0049489 3300046675 Bacteria 2830
501 Ga0495599_0010981 3300046678 Bacteria 5557
502 Ga0495599_0200897 3300046678 Unclassified 1225
503 Ga0495623_0088661 3300046679 Bacteria 1904
504 Ga0495647_0000117 3300046681 Bacteria 20211
505 Ga0495647_0034626 3300046681 Bacteria 1892
506 Ga0495658_0002481 3300046683 Bacteria 9285
507 Ga0495613_0009945 3300046689 Bacteria 7068
508 Ga0495624_0022706 3300046690 Bacteria 4142
509 Ga0495589_0086028 3300046794 Bacteria 1527
510 Ga0495581_0001867 3300047315 Bacteria 11790
511 Ga0495604_0019500 3300047317 Bacteria 5428
512 Ga0495636_0052064 3300047318 Bacteria 1717
513 Ga0495674_0022225 3300047319 Bacteria 5850
514 Ga0495674_0052921 3300047319 Bacteria 3570
515 Ga0495674_0059757 3300047319 Bacteria 3328
516 Ga0495674_0112669 3300047319 Bacteria 2304
517 Ga0495676_0009898 3300047321 Bacteria 8664
518 Ga0495676_0014000 3300047321 Bacteria 7183
519 Ga0495676_0040706 3300047321 Bacteria 3832
520 Ga0495676_0112888 3300047321 Bacteria 1990
521 Ga0495680_0048197 3300047322 Bacteria 3347
522 Ga0495680_0199141 3300047322 Unclassified 1437
523 Ga0495684_0008720 3300047471 Bacteria 7839
524 Ga0495684_0020652 3300047471 Bacteria 5074
525 Ga0495684_0042286 3300047471 Bacteria 3490
526 Ga0495684_0153100 3300047471 Bacteria 1723
527 Ga0495593_0022473 3300047673 Bacteria 3513
528 Ga0495614_0000404 3300048089 Bacteria 17590
529 Ga0495614_0046031 3300048089 Bacteria 1871
530 Ga0495614_0061859 3300048089 Unclassified 1609
531 Ga0496100_0009426 3300048903 Bacteria 5489
532 Ga0496100_0019470 3300048903 Bacteria 4050
533 Ga0496100_0041528 3300048903 Bacteria 2932
534 Ga0496100_0120722 3300048903 Bacteria 1833
535 Ga0496101_0021111 3300048904 Bacteria 4470
536 Ga0496101_0046911 3300048904 Bacteria 3100
537 Ga0496101_0064325 3300048904 Bacteria 2671
538 Ga0496101_0125314 3300048904 Bacteria 1946
539 Ga0496102_0018692 3300048905 Bacteria 6095
540 Ga0496102_0030582 3300048905 Bacteria 4820
541 Ga0496102_0032226 3300048905 Bacteria 4708
542 Ga0496102_0051932 3300048905 Bacteria 3734
543 Ga0496102_0096355 3300048905 Bacteria 2743
544 Ga0496102_0247926 3300048905 Bacteria 1679
545 Ga0496102_0365382 3300048905 Unclassified 1358
546 Ga0496103_0003512 3300048906 Bacteria 9582
547 Ga0496103_0009909 3300048906 Bacteria 5635
548 Ga0496103_0022753 3300048906 Bacteria 3775
549 Ga0496103_0023288 3300048906 Bacteria 3734
550 Ga0496103_0046501 3300048906 Bacteria 2680
551 Ga0496104_0000967 3300048907 Bacteria 24709
552 Ga0496104_0001618 3300048907 Bacteria 19424
553 Ga0496104_0004025 3300048907 Bacteria 12740
554 Ga0496104_0036093 3300048907 Bacteria 4618
555 Ga0496104_0192729 3300048907 Bacteria 1950
556 Ga0496104_0212206 3300048907 Bacteria 1847
557 Ga0496105_0001531 3300048908 Bacteria 16347
558 Ga0496105_0010763 3300048908 Bacteria 7202
559 Ga0496105_0022441 3300048908 Bacteria 5112
560 Ga0496105_0048930 3300048908 Bacteria 3490
561 Ga0496105_0072223 3300048908 Bacteria 2852
562 Ga0496105_0086124 3300048908 Bacteria 2596
563 Ga0496105_0138832 3300048908 Bacteria 2001
564 Ga0496105_0203733 3300048908 Bacteria 1614
565 Ga0496106_0034671 3300048909 Bacteria 3771
566 Ga0496106_0046232 3300048909 Bacteria 3271
567 Ga0496107_0002456 3300048910 Bacteria 12023
568 Ga0496107_0015873 3300048910 Bacteria 5283
569 Ga0496107_0027226 3300048910 Bacteria 4059
570 Ga0496107_0062318 3300048910 Bacteria 2701
571 Ga0496107_0127413 3300048910 Bacteria 1878
572 Ga0496107_0141033 3300048910 Bacteria 1781
573 Ga0496108_0000996 3300048911 Bacteria 22097
574 Ga0496108_0009734 3300048911 Bacteria 7788
575 Ga0496108_0011867 3300048911 Bacteria 7087
576 Ga0496108_0018681 3300048911 Bacteria 5680
577 Ga0496108_0029829 3300048911 Bacteria 4519
578 Ga0496108_0054560 3300048911 Bacteria 3354
579 Ga0496108_0146530 3300048911 Bacteria 2036
580 Ga0496109_0002166 3300048912 Bacteria 16321
581 Ga0496109_0010218 3300048912 Bacteria 8014
582 Ga0496109_0021918 3300048912 Bacteria 5656
583 Ga0496109_0025632 3300048912 Bacteria 5255
584 Ga0496109_0041517 3300048912 Bacteria 4166
585 Ga0496109_0043693 3300048912 Bacteria 4062
586 Ga0496109_0058433 3300048912 Bacteria 3522
587 Ga0496109_0059110 3300048912 Bacteria 3502
588 Ga0496109_0104455 3300048912 Bacteria 2630
589 Ga0496109_0155012 3300048912 Bacteria 2145
590 Ga0496109_0206625 3300048912 Bacteria 1846
591 Ga0496109_0289639 3300048912 Bacteria 1544
592 Ga0496109_0299076 3300048912 Bacteria 1517
593 Ga0496110_0002803 3300048913 Bacteria 13155
594 Ga0496110_0010506 3300048913 Bacteria 7535
595 Ga0496110_0019311 3300048913 Bacteria 5732
596 Ga0496110_0034994 3300048913 Bacteria 4355
597 Ga0496110_0057242 3300048913 Bacteria 3432
598 Ga0496111_0002099 3300048914 Bacteria 11894
599 Ga0496111_0009850 3300048914 Bacteria 6388
600 Ga0496111_0018459 3300048914 Bacteria 4834
601 Ga0496111_0038548 3300048914 Bacteria 3424
602 Ga0496111_0101553 3300048914 Bacteria 2113
603 Ga0496111_0191899 3300048914 Bacteria 1519
604 Ga0496112_0000886 3300048915 Bacteria 21512
605 Ga0496112_0001931 3300048915 Bacteria 16369
606 Ga0496112_0089625 3300048915 Bacteria 3044
607 Ga0496112_0105663 3300048915 Bacteria 2785
608 Ga0496112_0210589 3300048915 Unclassified 1901
609 Ga0496113_0000220 3300048916 Bacteria 26683
610 Ga0496113_0002691 3300048916 Bacteria 10424
611 Ga0496113_0016604 3300048916 Bacteria 5089
612 Ga0496113_0042602 3300048916 Bacteria 3356
613 Ga0496113_0043493 3300048916 Bacteria 3324
614 Ga0496113_0065107 3300048916 Bacteria 2758
615 Ga0496114_0014475 3300048917 Bacteria 6336
616 Ga0496114_0028399 3300048917 Bacteria 4591
617 Ga0496114_0046356 3300048917 Bacteria 3612
618 Ga0496114_0078998 3300048917 Bacteria 2776
619 Ga0496114_0095404 3300048917 Bacteria 2531
620 Ga0496114_0126725 3300048917 Bacteria 2201
621 Ga0496115_0001489 3300048918 Bacteria 16848
622 Ga0496115_0012093 3300048918 Bacteria 6490
623 Ga0496115_0018782 3300048918 Bacteria 5314
624 Ga0496115_0021559 3300048918 Bacteria 4978
625 Ga0496115_0037231 3300048918 Bacteria 3855
626 Ga0496115_0068253 3300048918 Bacteria 2878
627 Ga0496115_0072142 3300048918 Bacteria 2801
628 Ga0501031_0006030 3300049568 Bacteria 7909
629 Ga0501033_0002997 3300049570 Bacteria 14096
630 Ga0501036_0002978 3300049572 Bacteria 13462
631 Ga0501039_0073694 3300049575 Bacteria 2652
632 Ga0501040_0022541 3300049576 Bacteria 4215
633 Ga0501041_0016007 3300049577 Bacteria 4456
634 Ga0501042_0001350 3300049578 Bacteria 14365
635 Ga0501043_0000497 3300049579 Bacteria 35330
636 Ga0501046_0013268 3300049580 Bacteria 6981
637 Ga0501048_0015601 3300049582 Bacteria 5609
638 Ga0501067_0000403 3300049583 Bacteria 23610
639 Ga0501067_0002219 3300049583 Bacteria 10737
640 Ga0501067_0058614 3300049583 Bacteria 2132
641 Ga0501068_0000389 3300049584 Bacteria 22250
642 Ga0501068_0032324 3300049584 Bacteria 3112
643 Ga0501069_0000952 3300049585 Bacteria 13786
644 Ga0501069_0001235 3300049585 Bacteria 12499
645 Ga0501069_0010500 3300049585 Bacteria 4905
646 Ga0501069_0013533 3300049585 Bacteria 4350
647 Ga0501069_0024422 3300049585 Bacteria 3296
648 Ga0501069_0061627 3300049585 Bacteria 2095
649 Ga0501070_0002833 3300049586 Bacteria 15133
650 Ga0501070_0011361 3300049586 Bacteria 7525
651 Ga0501070_0018181 3300049586 Bacteria 5896
652 Ga0501071_0003382 3300049587 Bacteria 9966
653 Ga0501072_0016860 3300049588 Bacteria 5611
654 Ga0501072_0095976 3300049588 Bacteria 2356
655 Ga0501072_0213645 3300049588 Bacteria 1537
656 Ga0501073_0009385 3300049589 Bacteria 7223
657 Ga0501074_0011074 3300049590 Bacteria 6547
658 Ga0501074_0018763 3300049590 Bacteria 5025
659 Ga0501075_0020605 3300049591 Bacteria 4798
660 Ga0501076_0022990 3300049592 Bacteria 4798
661 Ga0501077_0016385 3300049593 Bacteria 4669
662 Ga0501080_0004561 3300049742 Bacteria 12347
663 Ga0501081_0002878 3300049743 Bacteria 10927
664 Ga0501083_0015988 3300049744 Bacteria 5254
665 Ga0501083_0017888 3300049744 Bacteria 4944
666 Ga0501035_0025276 3300049822 Bacteria 5444
667 Ga0501045_0013061 3300049824 Bacteria 5856
668 nmdc:mga00v17_76714_c1 3300050491 Bacteria 2080
669 nmdc:mga0yw44_11054_c1 3300050492 Bacteria 4639
670 nmdc:mga05p37_232956_c1 3300050507 Bacteria 2218
671 nmdc:mga08y16_45920_c1 3300050511 Bacteria 4576
672 nmdc:mga0n895_133081_c1 3300050512 Bacteria 2513
673 nmdc:mga0n895_58746_c1 3300050512 Bacteria 3793
674 nmdc:mga0n895_6178_c1 3300050512 Bacteria 10125
675 nmdc:mga0rr50_12702_c1 3300050513 Bacteria 5455
676 nmdc:mga0rr50_26342_c1 3300050513 Bacteria 4055
677 nmdc:mga08x19_35580_c1 3300050514 Bacteria 3152
678 nmdc:mga0a205_17646_c1 3300050515 Bacteria 6699
679 nmdc:mga0a205_291573_c1 3300050515 Unclassified 1506
680 Ga0495601_0073381 3300053077 Bacteria 2187
681 Ga0495601_0200943 3300053077 Bacteria 1302
682 Ga0495612_0013669 3300053078 Bacteria 3270
683 Ga0495612_0035484 3300053078 Bacteria 2021
684 Ga0495655_0007585 3300053083 Bacteria 2024
685 Ga0495595_0003635 3300053084 Bacteria 6131
686 Ga0495619_0035019 3300053085 Bacteria 3265
687 Ga0495619_0119130 3300053085 Bacteria 1809
688 Ga0501084_0024288 3300054114 Bacteria 5054
689 Ga0501084_0038387 3300054114 Bacteria 4004
690 Ga0587077_005055 3300059493 Bacteria 1779
691 Ga0587077_007509 3300059493 Bacteria 1592
692 Ga0587080_001633 3300059503 Bacteria 2480
693 Ga0587082_002517 3300059504 Bacteria 2079
694 Ga0587083_0011793 3300059505 Unclassified 1451
695 Ga0587085_001208 3300059506 Bacteria 2312
696 Ga0587086_003052 3300059507 Bacteria 1651
697 Ga0587088_004135 3300059508 Bacteria 1813
698 Ga0587067_003050 3300059640 Bacteria 2058
699 Ga0587069_007020 3300059642 Unclassified 1375
700 Ga0587072_006636 3300059643 Bacteria 1770
701 Ga0587107_002115 3300059652 Bacteria 1745
702 Ga0587111_0003738 3300060346 Bacteria 2198
703 Ga0501082_0017499 3300060353 Bacteria 6175
704 Ga0530510_0008013 3300061734 Bacteria 7368
705 Ga0530510_0017002 3300061734 Bacteria 5152
706 Ga0530510_0137580 3300061734 Bacteria 1798
707 Ga0070683_100024080
708 JGI25407J50210_10001565
709 JGI25404J52841_10024007
710 Ga0058862_10004946
711 Ga0058862_12749158
712 Ga0070658_10023603
713 Ga0070683_100120480
714 Ga0070683_100124997
715 Ga0070683_100152225
716 Ga0070690_100013723
717 Ga0068869_100087515
718 Ga0070666_10121607
719 Ga0070680_100007965
720 Ga0070680_100047719
721 Ga0070680_100073798
722 Ga0070680_100102155
723 Ga0070680_100107399
724 Ga0070680_100236375
725 Ga0070682_100020440
726 Ga0070682_100024510
727 Ga0068868_100048270
728 Ga0068868_100148533
729 Ga0070660_100005513
730 Ga0070660_100040732
731 Ga0070689_100008321
732 Ga0070691_10043552
733 Ga0070661_100014914
734 Ga0070661_100043625
735 Ga0070661_100130148
736 Ga0070692_10002761
737 Ga0070668_100030525
738 Ga0070668_100160967
739 Ga0070675_100243693
740 Ga0070674_100022407
741 Ga0070674_100023154
742 Ga0070688_100014573
743 Ga0070659_100042536
744 Ga0070659_100070140
745 Ga0070709_10008900
746 Ga0070709_10181712
747 Ga0070714_100014369
748 Ga0070714_100025272
749 Ga0070714_100056819
750 Ga0070713_100028424
751 Ga0070713_100050775
752 Ga0070713_100057501
753 Ga0070713_100258493
754 Ga0070710_10001625
755 Ga0070710_10005790
756 Ga0070711_100009827
757 Ga0070705_100012181
758 Ga0070705_100015497
759 Ga0070705_100022314
760 Ga0070705_100120813
761 Ga0070700_100028398
762 Ga0070700_100062090
763 Ga0070694_100021115
764 Ga0070694_100042816
765 Ga0070694_100108864
766 Ga0070708_100027320
767 Ga0070708_100028883
768 Ga0070708_100132313
769 Ga0070678_100000442
770 Ga0070678_100023110
771 Ga0070678_100084059
772 Ga0070662_100005385
773 Ga0070662_100068740
774 Ga0070681_10026263
775 Ga0070681_10069858
776 Ga0070681_10109059
777 Ga0068867_100006216
778 Ga0070685_10004918
779 Ga0070706_100005519
780 Ga0070706_100009854
781 Ga0070706_100178289
782 Ga0070707_100001518
783 Ga0070707_100010429
784 Ga0070707_100072782
785 Ga0070707_100151579
786 Ga0070707_100195534
787 Ga0070698_100001085
788 Ga0070698_100010575
789 Ga0070698_100011117
790 Ga0070699_100023472
791 Ga0070679_100027668
792 Ga0070679_100032458
793 Ga0070679_100077214
794 Ga0070684_100028844
795 Ga0070684_100087881
796 Ga0070684_100099924
797 Ga0070684_100134936
798 Ga0070697_100032076
799 Ga0070697_100070504
800 Ga0068853_100030464
801 Ga0070686_100023451
802 Ga0070695_100030883
803 Ga0070696_100039202
804 Ga0070696_100046404
805 Ga0070693_100024395
806 Ga0070693_100062394
807 Ga0070665_100035292
808 Ga0070665_100095175
809 Ga0070704_100026780
810 Ga0068855_100029141
811 Ga0068855_100051058
812 Ga0068855_100081129
813 Ga0068855_100110835
814 Ga0068855_100113296
815 Ga0068855_100280966
816 Ga0068855_100293109
817 Ga0068855_100318484
818 Ga0068857_100144954
819 Ga0068857_100160396
820 Ga0068856_100026471
821 Ga0068856_100035486
822 Ga0068856_100058209
823 Ga0068856_100326582
824 Ga0068856_100347152
825 Ga0070702_100012399
826 Ga0070702_100028539
827 Ga0070702_100048106
828 Ga0068852_100092908
829 Ga0068852_100111759
830 Ga0068864_100191535
831 Ga0068866_10004144
832 Ga0068861_100049753
833 Ga0068861_100076174
834 Ga0068861_100210483
835 Ga0081455_10001178
836 Ga0081455_10005512
837 Ga0081455_10048055
838 Ga0081538_10000138
839 Ga0081540_1002348
840 Ga0081540_1008368
841 Ga0070717_10030764
842 Ga0070717_10040175
843 Ga0070717_10054826
844 Ga0070717_10144535
845 Ga0075432_10009109
846 Ga0070715_10000120
847 Ga0070715_10113269
848 Ga0070716_100072825
849 Ga0070712_100006659
850 Ga0070712_100031018
851 Ga0075362_10021821
852 Ga0097621_100086202
853 Ga0097621_100167090
854 Ga0097621_100193196
855 Ga0068871_100003070
856 Ga0068871_100025871
857 Ga0068871_100068128
858 Ga0075428_100048614
859 Ga0075430_100014061
860 Ga0075433_10028527
861 Ga0075433_10038801
862 Ga0075434_100032472
863 Ga0075434_100036266
864 Ga0075434_100137850
865 Ga0075429_100189634
866 Ga0068865_100008117
867 Ga0068865_100304828
868 Ga0075436_100020126
869 Ga0075436_100148785
870 Ga0075435_100033701
871 Ga0105250_10025459
872 Ga0105240_10015896
873 Ga0105240_10039055
874 Ga0105240_10059512
875 Ga0111539_10099690
876 Ga0111539_10406537
877 Ga0105245_10011919
878 Ga0105245_10048211
879 Ga0105245_10077461
880 Ga0105245_10118994
881 Ga0105245_10189653
882 Ga0105247_10016213
883 Ga0114129_10171013
884 Ga0114129_10176202
885 Ga0105243_10006519
886 Ga0105243_10124923
887 Ga0105243_10307683
888 Ga0105241_10161272
889 Ga0105242_10018967
890 Ga0105242_10020103
891 Ga0105242_10061511
892 Ga0105242_10084480
893 Ga0105248_10081226
894 Ga0105248_10103575
895 Ga0105237_10010937
896 Ga0105237_10083602
897 Ga0105237_10109684
898 Ga0105238_10059323
899 Ga0105238_10164767
900 Ga0105238_10276644
901 Ga0105249_10000948
902 Ga0105249_10018638
903 Ga0105239_10039360
904 Ga0105239_10116859
905 Ga0105246_10121086
906 Ga0157371_10059178
907 Ga0157370_10030838
908 Ga0157369_10045756
909 Ga0157369_10337990
910 Ga0157369_10357056
911 Ga0157374_10034025
912 Ga0157374_10050794
913 Ga0157374_10053238
914 Ga0157374_10135952
915 Ga0157374_10183535
916 Ga0157378_10067816
917 Ga0157378_10255667
918 Ga0157378_10268832
919 Ga0163162_10023656
920 Ga0163162_10080663
921 Ga0163162_10168503
922 Ga0163162_10219089
923 Ga0157372_10011814
924 Ga0157372_10090271
925 Ga0157372_10206990
926 Ga0157372_10209151
927 Ga0157372_10227629
928 Ga0157372_10238196
929 Ga0157372_10383932
930 Ga0157375_10029269
931 Ga0157375_10129179
932 Ga0157377_10025925
933 Ga0157376_10005458
934 Ga0157376_10014185
935 Ga0163161_10237547
936 Ga0197907_11238927
937 Ga0197907_11268062
938 Ga0206350_10538545
939 Ga0224712_10009892
940 Ga0207696_1026201
941 Ga0207653_10023673
942 Ga0207653_10026817
943 Ga0207692_10008727
944 Ga0207688_10014206
945 Ga0207685_10001820
946 Ga0207699_10155119
947 Ga0207705_10011519
948 Ga0207705_10015166
949 Ga0207684_10015225
950 Ga0207684_10058065
951 Ga0207684_10060697
952 Ga0207654_10035652
953 Ga0207654_10054480
954 Ga0207707_10001761
955 Ga0207707_10002492
956 Ga0207707_10081311
957 Ga0207695_10071012
958 Ga0207695_10135545
959 Ga0207671_10075260
960 Ga0207671_10083725
961 Ga0207671_10148707
962 Ga0207693_10001119
963 Ga0207693_10004453
964 Ga0207693_10005339
965 Ga0207693_10007372
966 Ga0207693_10051308
967 Ga0207663_10002132
968 Ga0207663_10003179
969 Ga0207663_10007050
970 Ga0207660_10021336
971 Ga0207660_10099945
972 Ga0207660_10124308
973 Ga0207660_10279515
974 Ga0207657_10002585
975 Ga0207649_10107802
976 Ga0207649_10145876
977 Ga0207652_10022704
978 Ga0207652_10307791
979 Ga0207646_10001000
980 Ga0207646_10004378
981 Ga0207646_10011349
982 Ga0207646_10077203
983 Ga0207646_10144515
984 Ga0207694_10029083
985 Ga0207694_10039476
986 Ga0207694_10095017
987 Ga0207687_10010093
988 Ga0207687_10024082
989 Ga0207687_10033346
990 Ga0207687_10034212
991 Ga0207687_10213264
992 Ga0207664_10005273
993 Ga0207664_10011464
994 Ga0207664_10027751
995 Ga0207664_10097135
996 Ga0207664_10249890
997 Ga0207706_10019714
998 Ga0207706_10031554
999 Ga0207686_10010919
1000 Ga0207709_10007136
1001 Ga0207709_10096254
1002 Ga0207709_10113013
1003 Ga0207669_10048896
1004 Ga0207669_10136885
1005 Ga0207704_10021540
1006 Ga0207665_10000462
1007 Ga0207665_10005207
1008 Ga0207665_10133595
1009 Ga0207711_10033528
1010 Ga0207689_10086235
1011 Ga0207661_10035307
1012 Ga0207661_10054152
1013 Ga0207667_10182134
1014 Ga0207712_10032372
1015 Ga0207668_10025865
1016 Ga0207677_10064293
1017 Ga0207677_10323151
1018 Ga0207639_10014973
1019 Ga0207639_10091022
1020 Ga0207639_10166859
1021 Ga0207678_10166659
1022 Ga0207708_10000564
1023 Ga0207708_10003976
1024 Ga0207702_10001525
1025 Ga0207702_10195610
1026 Ga0207702_10352381
1027 Ga0207648_10001096
1028 Ga0207674_10038198
1029 Ga0207674_10108165
1030 Ga0207674_10159079
1031 Ga0207675_100001665
1032 Ga0207675_100006719
1033 Ga0207675_100015619
1034 Ga0207683_10000251
1035 Ga0207683_10054732
1036 Ga0207683_10067003
1037 Ga0207683_10079341
1038 Ga0207698_10097487
1039 Ga0207428_10001520
1040 Ga0207428_10025482
1041 Ga0268266_10030241
1042 Ga0268265_10162969
1043 Ga0307416_100101496
1044 Ga0307415_100062748
1045 Ga0373959_0015109
1046 Ga0373926_0026293
1047 Ga0373944_0004987
1048 Ga0373949_0008840
1049 Ga0373952_0009172
1050 Ga0373943_0008505
1051 Ga0373943_0056003
1052 Ga0373943_0086308
1053 Ga0373961_0008513
1054 Ga0373962_0004784
1055 Ga0373931_0097815
1056 Ga0373947_0000990
1057 Ga0373947_0011012
1058 Ga0373947_0102738
1059 Ga0373925_0005106
1060 Ga0395899_0005076
1061 Ga0395899_0022596
1062 Ga0395899_0022769
1063 Ga0395899_0038866
1064 Ga0395899_0143662
1065 Ga0395899_0190474
1066 Ga0395900_0005855
1067 Ga0395900_0031176
1068 Ga0395900_0034666
1069 Ga0395900_0106985
1070 Ga0395900_0121236
1071 Ga0395900_0216847
1072 Ga0395900_0236821
1073 Ga0395898_0008349
1074 Ga0395898_0029219
1075 Ga0395898_0070060
1076 Ga0395898_0123718
1077 Ga0395898_0195156
1078 Ga0395905_0009181
1079 Ga0395905_0012620
1080 Ga0395905_0025616
1081 Ga0395905_0032448
1082 Ga0395905_0043620
1083 Ga0395905_0060718
1084 Ga0395905_0065436
1085 Ga0395901_0003703
1086 Ga0395901_0004641
1087 Ga0395901_0007095
1088 Ga0395901_0007530
1089 Ga0395901_0028931
1090 Ga0395901_0066078
1091 Ga0395901_0119511
1092 Ga0436365_0252283
1093 Ga0436363_0663999
1094 Ga0439466_0017749
1095 Ga0451791_1521897
1096 Ga0451793_0005940
1097 Ga0451800_0432663
1098 Ga0451807_0335557
1099 Ga0451845_0378300
1100 Ga0451849_0222363
1101 Ga0451855_0079494
1102 Ga0451853_4118874
1103 Ga0439445_0008988
1104 Ga0439448_0009102
1105 Ga0439459_0007069
1106 Ga0466969_0002327
1107 Ga0466961_0024528
1108 Ga0466963_0000937
1109 Ga0466963_0001817
1110 Ga0466963_0002367
1111 Ga0466963_0010578
1112 Ga0466963_0010802
1113 Ga0466963_0015636
1114 Ga0466963_0023242
1115 Ga0466963_0025951
1116 Ga0466964_0000516
1117 Ga0466964_0002117
1118 Ga0466964_0005030
1119 Ga0466964_0009558
1120 Ga0466964_0053777
1121 Ga0453684_0388791
1122 Ga0466971_0001657
1123 Ga0466971_0008053
1124 Ga0466968_0007423
1125 Ga0466970_0005089
1126 Ga0466957_0005885
1127 Ga0466957_0008389
1128 Ga0466957_0015756
1129 Ga0466957_0019544
1130 Ga0466957_0020192
1131 Ga0466957_0027236
1132 Ga0466957_0143628
1133 Ga0466960_0006463
1134 Ga0466960_0006907
1135 Ga0466960_0056378
1136 Ga0466960_0074805
1137 Ga0466959_0012718
1138 Ga0466959_0112699
1139 Ga0451576_0310503
1140 Ga0466958_0002160
1141 Ga0466958_0002543
1142 Ga0466958_0091473
1143 Ga0466967_0001434
1144 Ga0466967_0002259
1145 Ga0466967_0002411
1146 Ga0466967_0006109
1147 Ga0466967_0016721
1148 Ga0466967_0019588
1149 Ga0466967_0023919
1150 Ga0466967_0067681
1151 Ga0466967_0081112
1152 Ga0466967_0102874
1153 Ga0466967_0270880
1154 Ga0495592_0009452
1155 Ga0495603_0002642
1156 Ga0495603_0012821
1157 Ga0495629_0005864
1158 Ga0495629_0056317
1159 Ga0495641_0006512
1160 Ga0495653_0186384
1161 Ga0495580_0142277
1162 Ga0495582_0004644
1163 Ga0495582_0014846
1164 Ga0495582_0016561
1165 Ga0495582_0019869
1166 Ga0495582_0026243
1167 Ga0495582_0136466
1168 Ga0495605_0015705
1169 Ga0495639_0007696
1170 Ga0495639_0026756
1171 Ga0495662_0006232
1172 Ga0495662_0092499
1173 Ga0495664_0003629
1174 Ga0495664_0084204
1175 Ga0495584_0025536
1176 Ga0495584_0068242
1177 Ga0495585_0053295
1178 Ga0495594_0063630
1179 Ga0495618_0013415
1180 Ga0495628_0039126
1181 Ga0495630_0024266
1182 Ga0495630_0026086
1183 Ga0495630_0047064
1184 Ga0495637_0052657
1185 Ga0495644_0006000
1186 Ga0495666_0009712
1187 Ga0495652_0029737
1188 Ga0495652_0062185
1189 Ga0495652_0100077
1190 Ga0495640_0029565
1191 Ga0495640_0063896
1192 Ga0495586_0041080
1193 Ga0495598_0030829
1194 Ga0495609_0097242
1195 Ga0495645_0031546
1196 Ga0495656_0039955
1197 Ga0495634_0031379
1198 Ga0495634_0070456
1199 Ga0495635_0010069
1200 Ga0495635_0017982
1201 Ga0495635_0031981
1202 Ga0495659_0001548
1203 Ga0495661_0025010
1204 Ga0495588_0001771
1205 Ga0495588_0027350
1206 Ga0495657_0049489
1207 Ga0495599_0010981
1208 Ga0495599_0200897
1209 Ga0495623_0088661
1210 Ga0495647_0000117
1211 Ga0495647_0034626
1212 Ga0495658_0002481
1213 Ga0495613_0009945
1214 Ga0495624_0022706
1215 Ga0495589_0086028
1216 Ga0495581_0001867
1217 Ga0495604_0019500
1218 Ga0495636_0052064
1219 Ga0495674_0022225
1220 Ga0495674_0052921
1221 Ga0495674_0059757
1222 Ga0495674_0112669
1223 Ga0495676_0009898
1224 Ga0495676_0014000
1225 Ga0495676_0040706
1226 Ga0495676_0112888
1227 Ga0495680_0048197
1228 Ga0495680_0199141
1229 Ga0495684_0008720
1230 Ga0495684_0020652
1231 Ga0495684_0042286
1232 Ga0495684_0153100
1233 Ga0495593_0022473
1234 Ga0495614_0000404
1235 Ga0495614_0046031
1236 Ga0495614_0061859
1237 Ga0496100_0009426
1238 Ga0496100_0019470
1239 Ga0496100_0041528
1240 Ga0496100_0120722
1241 Ga0496101_0021111
1242 Ga0496101_0046911
1243 Ga0496101_0064325
1244 Ga0496101_0125314
1245 Ga0496102_0018692
1246 Ga0496102_0030582
1247 Ga0496102_0032226
1248 Ga0496102_0051932
1249 Ga0496102_0096355
1250 Ga0496102_0247926
1251 Ga0496102_0365382
1252 Ga0496103_0003512
1253 Ga0496103_0009909
1254 Ga0496103_0022753
1255 Ga0496103_0023288
1256 Ga0496103_0046501
1257 Ga0496104_0000967
1258 Ga0496104_0001618
1259 Ga0496104_0004025
1260 Ga0496104_0036093
1261 Ga0496104_0192729
1262 Ga0496104_0212206
1263 Ga0496105_0001531
1264 Ga0496105_0010763
1265 Ga0496105_0022441
1266 Ga0496105_0048930
1267 Ga0496105_0072223
1268 Ga0496105_0086124
1269 Ga0496105_0138832
1270 Ga0496105_0203733
1271 Ga0496106_0034671
1272 Ga0496106_0046232
1273 Ga0496107_0002456
1274 Ga0496107_0015873
1275 Ga0496107_0027226
1276 Ga0496107_0062318
1277 Ga0496107_0127413
1278 Ga0496107_0141033
1279 Ga0496108_0000996
1280 Ga0496108_0009734
1281 Ga0496108_0011867
1282 Ga0496108_0018681
1283 Ga0496108_0029829
1284 Ga0496108_0054560
1285 Ga0496108_0146530
1286 Ga0496109_0002166
1287 Ga0496109_0010218
1288 Ga0496109_0021918
1289 Ga0496109_0025632
1290 Ga0496109_0041517
1291 Ga0496109_0043693
1292 Ga0496109_0058433
1293 Ga0496109_0059110
1294 Ga0496109_0104455
1295 Ga0496109_0155012
1296 Ga0496109_0206625
1297 Ga0496109_0289639
1298 Ga0496109_0299076
1299 Ga0496110_0002803
1300 Ga0496110_0010506
1301 Ga0496110_0019311
1302 Ga0496110_0034994
1303 Ga0496110_0057242
1304 Ga0496111_0002099
1305 Ga0496111_0009850
1306 Ga0496111_0018459
1307 Ga0496111_0038548
1308 Ga0496111_0101553
1309 Ga0496111_0191899
1310 Ga0496112_0000886
1311 Ga0496112_0001931
1312 Ga0496112_0089625
1313 Ga0496112_0105663
1314 Ga0496112_0210589
1315 Ga0496113_0000220
1316 Ga0496113_0002691
1317 Ga0496113_0016604
1318 Ga0496113_0042602
1319 Ga0496113_0043493
1320 Ga0496113_0065107
1321 Ga0496114_0014475
1322 Ga0496114_0028399
1323 Ga0496114_0046356
1324 Ga0496114_0078998
1325 Ga0496114_0095404
1326 Ga0496114_0126725
1327 Ga0496115_0001489
1328 Ga0496115_0012093
1329 Ga0496115_0018782
1330 Ga0496115_0021559
1331 Ga0496115_0037231
1332 Ga0496115_0068253
1333 Ga0496115_0072142
1334 Ga0501031_0006030
1335 Ga0501033_0002997
1336 Ga0501036_0002978
1337 Ga0501039_0073694
1338 Ga0501040_0022541
1339 Ga0501041_0016007
1340 Ga0501042_0001350
1341 Ga0501043_0000497
1342 Ga0501046_0013268
1343 Ga0501048_0015601
1344 Ga0501067_0000403
1345 Ga0501067_0002219
1346 Ga0501067_0058614
1347 Ga0501068_0000389
1348 Ga0501068_0032324
1349 Ga0501069_0000952
1350 Ga0501069_0001235
1351 Ga0501069_0010500
1352 Ga0501069_0013533
1353 Ga0501069_0024422
1354 Ga0501069_0061627
1355 Ga0501070_0002833
1356 Ga0501070_0011361
1357 Ga0501070_0018181
1358 Ga0501071_0003382
1359 Ga0501072_0016860
1360 Ga0501072_0095976
1361 Ga0501072_0213645
1362 Ga0501073_0009385
1363 Ga0501074_0011074
1364 Ga0501074_0018763
1365 Ga0501075_0020605
1366 Ga0501076_0022990
1367 Ga0501077_0016385
1368 Ga0501080_0004561
1369 Ga0501081_0002878
1370 Ga0501083_0015988
1371 Ga0501083_0017888
1372 Ga0501035_0025276
1373 Ga0501045_0013061
1374 nmdc:mga00v17_76714_c1
1375 nmdc:mga0yw44_11054_c1
1376 nmdc:mga05p37_232956_c1
1377 nmdc:mga08y16_45920_c1
1378 nmdc:mga0n895_133081_c1
1379 nmdc:mga0n895_58746_c1
1380 nmdc:mga0n895_6178_c1
1381 nmdc:mga0rr50_12702_c1
1382 nmdc:mga0rr50_26342_c1
1383 nmdc:mga08x19_35580_c1
1384 nmdc:mga0a205_17646_c1
1385 nmdc:mga0a205_291573_c1
1386 Ga0495601_0073381
1387 Ga0495601_0200943
1388 Ga0495612_0013669
1389 Ga0495612_0035484
1390 Ga0495655_0007585
1391 Ga0495595_0003635
1392 Ga0495619_0035019
1393 Ga0495619_0119130
1394 Ga0501084_0024288
1395 Ga0501084_0038387
1396 Ga0587077_005055
1397 Ga0587077_007509
1398 Ga0587080_001633
1399 Ga0587082_002517
1400 Ga0587083_0011793
1401 Ga0587085_001208
1402 Ga0587086_003052
1403 Ga0587088_004135
1404 Ga0587067_003050
1405 Ga0587069_007020
1406 Ga0587072_006636
1407 Ga0587107_002115
1408 Ga0587111_0003738
1409 Ga0501082_0017499
1410 Ga0530510_0008013
1411 Ga0530510_0017002
1412 Ga0530510_0137580

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

112

371

0.87

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

74

325

0.86

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

67

319

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8563 22 362
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8538 22 362
1poy-assembly1.cif.gz_2 spermidine/putrescine-binding protein complexed with spermidine (dimer form) 0.8455 21 361
1poy-assembly1.cif.gz_2 spermidine/putrescine-binding protein complexed with spermidine (dimer form) 0.8384 21 361
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.8326 21 360
ID Description Score Start End Superfamily
2v84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8762 22 315 3.40.190.10
1poy101 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8719 21 326 3.40.190.10
2v84A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8668 144 262 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8621 22 359 3.40.190.10
1potA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8586 142 362 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1C4IVZ4-F1-model_v4 deleted 0.9646 21 361
AF-A0A1Q3Q4T1-F1-model_v4 deleted 0.9642 16 362
AF-A0A6B1N6T3-F1-model_v4 deleted 0.9548 65 362
AF-A0A2U3C5K2-F1-model_v4 ABC transporter substrate-binding protein 0.9426 17 362 GO:0015846
GO:0019808
GO:0042597
AF-A0A6B1N6T3-F1-model_v4 deleted 0.9425 65 362

Map