F476263

General Info

Members Datasets Scaffolds Average Seq Length
703 294 1406 255

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100431036|Ga0068864_1004310362
Length 282
Sequence MTIPKAARGLAVEANSFERNLGTSPTPRKILAVGLLAASLVVPSAFAQTAPAGTPAPTANAVDAASIQALKDMGAFLQTLKRFHVSTEATGERVLADGQKLQHVATAELDVDRPNKLRAVIRNARSQRDIIYDGNTATFYTPAQKYYSTVEFSESIGGLIDKLEQRYGVQLPLQDLFLFGTPMARLDKIESAMNAGQDFIDEDLCDHYAFRQGTIDWQIWISSTAGKPLPRKIVITNRADEARPQSISVIDWNLRPTFKDSVFKFTPPPGAKKIEIVPRKTS

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
96 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
97 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0.43
Rhizoplane 2.7
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100431036 3300005618 Bacteria 1258
2 JGI24738J21930_10043217 3300002075 Unclassified 916
3 JGI24035J26624_1008640 3300002126 Unclassified 998
4 JGI24742J22300_10008629 3300002244 Unclassified 1682
5 JGI25407J50210_10029203 3300003373 Bacteria 1430
6 JGI25405J52794_10035860 3300003911 Bacteria 1039
7 Ga0065704_10087861 3300005289 Bacteria 2988
8 Ga0065712_10116381 3300005290 Bacteria 1736
9 Ga0065712_10142599 3300005290 Unclassified 1436
10 Ga0065715_10019639 3300005293 Bacteria 2744
11 Ga0065715_10026691 3300005293 Bacteria 1193
12 Ga0065715_10225238 3300005293 Bacteria 1255
13 Ga0065707_10039324 3300005295 Bacteria 1260
14 Ga0065707_10188819 3300005295 Bacteria 1373
15 Ga0070676_10000975 3300005328 Bacteria 14221
16 Ga0070676_10002135 3300005328 Bacteria 10068
17 Ga0070676_10015485 3300005328 Bacteria 4207
18 Ga0070676_10107765 3300005328 Bacteria 1730
19 Ga0070676_10261016 3300005328 Bacteria 1160
20 Ga0070683_100667172 3300005329 Bacteria 996
21 Ga0070690_100034061 3300005330 Bacteria 3190
22 Ga0070670_100027612 3300005331 Bacteria 4883
23 Ga0070670_100031399 3300005331 Bacteria 4574
24 Ga0070670_100083408 3300005331 Bacteria 2746
25 Ga0070670_100237511 3300005331 Bacteria 1586
26 Ga0070670_100257941 3300005331 Bacteria 1519
27 Ga0070677_10167417 3300005333 Bacteria 1036
28 Ga0068869_100002711 3300005334 Bacteria 10717
29 Ga0068869_100019735 3300005334 Bacteria 4612
30 Ga0068869_100040177 3300005334 Bacteria 3344
31 Ga0068869_100191623 3300005334 Bacteria 1608
32 Ga0070666_10020055 3300005335 Bacteria 4318
33 Ga0070666_10195165 3300005335 Bacteria 1423
34 Ga0070666_10257775 3300005335 Bacteria 1236
35 Ga0070666_10482808 3300005335 Bacteria 897
36 Ga0070680_100040135 3300005336 Bacteria 3788
37 Ga0070682_100399014 3300005337 Bacteria 1040
38 Ga0068868_100002552 3300005338 Bacteria 12660
39 Ga0068868_100086231 3300005338 Bacteria 2524
40 Ga0068868_100146893 3300005338 Bacteria 1939
41 Ga0070660_100018644 3300005339 Bacteria 5074
42 Ga0070660_100155457 3300005339 Bacteria 1841
43 Ga0070689_100022204 3300005340 Bacteria 4737
44 Ga0070687_100042360 3300005343 Unclassified 2306
45 Ga0070687_100320757 3300005343 Bacteria 990
46 Ga0070661_100224948 3300005344 Bacteria 1440
47 Ga0070661_100315081 3300005344 Bacteria 1221
48 Ga0070692_10089133 3300005345 Unclassified 1674
49 Ga0070668_100002222 3300005347 Bacteria 14258
50 Ga0070668_100010370 3300005347 Bacteria 6921
51 Ga0070668_100011053 3300005347 Bacteria 6720
52 Ga0070668_100087413 3300005347 Bacteria 2453
53 Ga0070668_100121944 3300005347 Bacteria 2085
54 Ga0070668_100126229 3300005347 Bacteria 2049
55 Ga0070668_100688720 3300005347 Bacteria 901
56 Ga0070669_100005048 3300005353 Bacteria 9539
57 Ga0070669_100013760 3300005353 Bacteria 5752
58 Ga0070669_100067353 3300005353 Bacteria 2641
59 Ga0070669_100150198 3300005353 Bacteria 1803
60 Ga0070669_100247848 3300005353 Bacteria 1417
61 Ga0070669_100281736 3300005353 Bacteria 1332
62 Ga0070669_100604555 3300005353 Bacteria 919
63 Ga0070675_100016143 3300005354 Bacteria 5921
64 Ga0070675_100036588 3300005354 Bacteria 3995
65 Ga0070675_100051583 3300005354 Bacteria 3381
66 Ga0070675_100055790 3300005354 Bacteria 3253
67 Ga0070675_100073196 3300005354 Bacteria 2845
68 Ga0070675_100448251 3300005354 Unclassified 1157
69 Ga0070671_100002986 3300005355 Bacteria 13164
70 Ga0070671_100012292 3300005355 Bacteria 6891
71 Ga0070671_100018971 3300005355 Bacteria 5593
72 Ga0070671_100034631 3300005355 Bacteria 4181
73 Ga0070671_100246776 3300005355 Bacteria 1516
74 Ga0070674_100006351 3300005356 Bacteria 6891
75 Ga0070674_100051453 3300005356 Bacteria 2839
76 Ga0070674_100288953 3300005356 Bacteria 1303
77 Ga0070673_100002879 3300005364 Bacteria 10583
78 Ga0070673_100005830 3300005364 Bacteria 7938
79 Ga0070673_100010665 3300005364 Bacteria 6231
80 Ga0070673_100219831 3300005364 Bacteria 1644
81 Ga0070673_100227417 3300005364 Bacteria 1617
82 Ga0070673_100236390 3300005364 Bacteria 1587
83 Ga0070688_100027163 3300005365 Bacteria 3408
84 Ga0070688_100042356 3300005365 Bacteria 2800
85 Ga0070659_100043040 3300005366 Bacteria 3531
86 Ga0070659_100111933 3300005366 Bacteria 2204
87 Ga0070659_100415367 3300005366 Bacteria 1137
88 Ga0070667_100017218 3300005367 Bacteria 5986
89 Ga0070667_100076142 3300005367 Bacteria 2865
90 Ga0070667_100229068 3300005367 Bacteria 1656
91 Ga0070667_100293055 3300005367 Bacteria 1464
92 Ga0070713_100000018 3300005436 Bacteria 118409
93 Ga0070701_10091095 3300005438 Bacteria 1671
94 Ga0070701_10292118 3300005438 Bacteria 999
95 Ga0070711_100320779 3300005439 Bacteria 1238
96 Ga0070705_100168032 3300005440 Unclassified 1473
97 Ga0070700_100126568 3300005441 Bacteria 1719
98 Ga0070700_100500860 3300005441 Bacteria 934
99 Ga0070663_100022683 3300005455 Bacteria 4199
100 Ga0070663_100076103 3300005455 Bacteria 2454
101 Ga0070663_100580147 3300005455 Bacteria 941
102 Ga0070678_100001518 3300005456 Bacteria 12390
103 Ga0070678_100002689 3300005456 Bacteria 9798
104 Ga0070678_100055739 3300005456 Bacteria 2887
105 Ga0070678_100131031 3300005456 Bacteria 1992
106 Ga0070678_100280963 3300005456 Bacteria 1408
107 Ga0070662_100054607 3300005457 Bacteria 2895
108 Ga0070662_100134135 3300005457 Bacteria 1913
109 Ga0070681_10094972 3300005458 Bacteria 2930
110 Ga0068867_100013870 3300005459 Bacteria 5705
111 Ga0068867_100037800 3300005459 Bacteria 3511
112 Ga0068867_100141730 3300005459 Bacteria 1880
113 Ga0068867_100209875 3300005459 Bacteria 1563
114 Ga0068867_100342843 3300005459 Bacteria 1244
115 Ga0070685_10136877 3300005466 Unclassified 1537
116 Ga0074259_11477881 3300005507 Bacteria 1189
117 Ga0070699_100559106 3300005518 Bacteria 1042
118 Ga0070679_100079495 3300005530 Bacteria 3268
119 Ga0070697_100087493 3300005536 Bacteria 2572
120 Ga0068853_100036464 3300005539 Bacteria 4182
121 Ga0068853_100090407 3300005539 Bacteria 2691
122 Ga0068853_100307208 3300005539 Bacteria 1467
123 Ga0068853_100601940 3300005539 Bacteria 1044
124 Ga0070672_100006506 3300005543 Bacteria 7852
125 Ga0070672_100022100 3300005543 Bacteria 4665
126 Ga0070672_100095404 3300005543 Bacteria 2405
127 Ga0070672_100136190 3300005543 Bacteria 2023
128 Ga0070672_100366739 3300005543 Bacteria 1230
129 Ga0070672_100499500 3300005543 Unclassified 1052
130 Ga0070686_100030309 3300005544 Bacteria 3298
131 Ga0070696_100116469 3300005546 Bacteria 1930
132 Ga0070693_100191818 3300005547 Bacteria 1322
133 Ga0070693_100297853 3300005547 Unclassified 1086
134 Ga0070693_100483640 3300005547 Unclassified 875
135 Ga0070665_100001417 3300005548 Bacteria 28129
136 Ga0070665_100014910 3300005548 Bacteria 7802
137 Ga0070665_100225991 3300005548 Bacteria 1872
138 Ga0070665_100280959 3300005548 Bacteria 1667
139 Ga0070665_100454627 3300005548 Unclassified 1290
140 Ga0070704_100492571 3300005549 Bacteria 1062
141 Ga0068855_100064485 3300005563 Bacteria 4272
142 Ga0070664_100102937 3300005564 Bacteria 2485
143 Ga0070664_100361809 3300005564 Bacteria 1321
144 Ga0070664_100759923 3300005564 Unclassified 905
145 Ga0068857_100249612 3300005577 Bacteria 1626
146 Ga0068854_100458871 3300005578 Bacteria 1066
147 Ga0068856_100599482 3300005614 Bacteria 1123
148 Ga0068852_100012670 3300005616 Bacteria 6413
149 Ga0068852_100355067 3300005616 Bacteria 1432
150 Ga0068852_100358077 3300005616 Bacteria 1426
151 Ga0068859_100016391 3300005617 Bacteria 7443
152 Ga0068859_100044040 3300005617 Bacteria 4485
153 Ga0068859_100100447 3300005617 Bacteria 2949
154 Ga0068864_100017853 3300005618 Bacteria 5918
155 Ga0068864_100030585 3300005618 Bacteria 4564
156 Ga0068864_100150710 3300005618 Bacteria 2106
157 Ga0068864_100376484 3300005618 Bacteria 1344
158 Ga0068864_100542015 3300005618 Bacteria 1124
159 Ga0068864_100598330 3300005618 Unclassified 1070
160 Ga0068864_100606345 3300005618 Bacteria 1063
161 Ga0068861_100005831 3300005719 Bacteria 8362
162 Ga0068861_100199995 3300005719 Unclassified 1676
163 Ga0068861_100574215 3300005719 Bacteria 1031
164 Ga0068851_10044527 3300005834 Bacteria 2240
165 Ga0068851_10075807 3300005834 Bacteria 1748
166 Ga0068870_10004919 3300005840 Bacteria 5785
167 Ga0068870_10201316 3300005840 Bacteria 1207
168 Ga0068863_100017336 3300005841 Bacteria 6905
169 Ga0068863_100036668 3300005841 Bacteria 4670
170 Ga0068863_100127013 3300005841 Bacteria 2433
171 Ga0068858_100005578 3300005842 Bacteria 12311
172 Ga0068858_100201293 3300005842 Unclassified 1883
173 Ga0068858_100257607 3300005842 Bacteria 1658
174 Ga0068860_100008471 3300005843 Bacteria 10247
175 Ga0068860_100028522 3300005843 Bacteria 5373
176 Ga0068860_100159936 3300005843 Bacteria 2171
177 Ga0068860_100185902 3300005843 Bacteria 2009
178 Ga0068860_100473929 3300005843 Bacteria 1247
179 Ga0068860_100764127 3300005843 Bacteria 979
180 Ga0068862_100088908 3300005844 Bacteria 2688
181 Ga0068862_100101616 3300005844 Bacteria 2515
182 Ga0068862_100136406 3300005844 Bacteria 2174
183 Ga0068862_100225050 3300005844 Bacteria 1700
184 Ga0068862_100640728 3300005844 Bacteria 1024
185 Ga0081455_10003769 3300005937 Bacteria 17307
186 Ga0081455_10008430 3300005937 Bacteria 10723
187 Ga0081538_10027160 3300005981 Bacteria 3977
188 Ga0081540_1004836 3300005983 Bacteria 10149
189 Ga0070716_100203905 3300006173 Bacteria 1316
190 Ga0070712_100058113 3300006175 Bacteria 2720
191 Ga0097621_100004591 3300006237 Bacteria 9640
192 Ga0097621_100005686 3300006237 Bacteria 8801
193 Ga0097621_100021827 3300006237 Bacteria 4961
194 Ga0097621_100125352 3300006237 Bacteria 2181
195 Ga0068871_100018980 3300006358 Bacteria 5240
196 Ga0068871_100027638 3300006358 Bacteria 4438
197 Ga0068871_100047131 3300006358 Bacteria 3474
198 Ga0068871_100211176 3300006358 Bacteria 1679
199 Ga0075428_100005766 3300006844 Bacteria 13752
200 Ga0075428_100214532 3300006844 Bacteria 2079
201 Ga0075431_100130661 3300006847 Bacteria 2590
202 Ga0075431_100403694 3300006847 Bacteria 1367
203 Ga0068865_100061479 3300006881 Bacteria 2633
204 Ga0068865_100070366 3300006881 Bacteria 2479
205 Ga0068865_100096536 3300006881 Bacteria 2155
206 Ga0075436_100059708 3300006914 Bacteria 2634
207 Ga0097620_100016393 3300006931 Bacteria 7443
208 Ga0097620_100044039 3300006931 Bacteria 4485
209 Ga0097620_100100445 3300006931 Bacteria 2949
210 Ga0099826_10000011 3300006948 Bacteria 287659
211 Ga0075435_100135692 3300007076 Bacteria 2061
212 Ga0075435_100642144 3300007076 Bacteria 921
213 Ga0105240_10228926 3300009093 Bacteria 2162
214 Ga0111539_10024009 3300009094 Bacteria 7489
215 Ga0111539_10061824 3300009094 Bacteria 4436
216 Ga0111539_10163168 3300009094 Bacteria 2606
217 Ga0111539_10203616 3300009094 Bacteria 2307
218 Ga0105245_10042107 3300009098 Bacteria 4074
219 Ga0105243_10287383 3300009148 Bacteria 1484
220 Ga0105243_10353242 3300009148 Bacteria 1351
221 Ga0105242_10045598 3300009176 Unclassified 3553
222 Ga0105242_10117411 3300009176 Bacteria 2278
223 Ga0105242_10638421 3300009176 Bacteria 1034
224 Ga0105248_10011610 3300009177 Bacteria 9703
225 Ga0105248_10074951 3300009177 Bacteria 3803
226 Ga0105248_10077339 3300009177 Bacteria 3741
227 Ga0105248_10129661 3300009177 Bacteria 2845
228 Ga0105248_10241137 3300009177 Bacteria 2035
229 Ga0105248_10423687 3300009177 Bacteria 1499
230 Ga0105238_10503437 3300009551 Unclassified 1212
231 Ga0105249_10010855 3300009553 Bacteria 8005
232 Ga0105249_10047654 3300009553 Bacteria 3906
233 Ga0105249_10387764 3300009553 Bacteria 1424
234 Ga0105249_10496866 3300009553 Bacteria 1265
235 Ga0105239_10213147 3300010375 Unclassified 2165
236 Ga0105246_10048981 3300011119 Bacteria 2891
237 Ga0157339_1004740 3300012505 Bacteria 1045
238 Ga0157324_1005326 3300012506 Bacteria 927
239 Ga0157342_1006533 3300012507 Bacteria 1106
240 Ga0157371_10240643 3300013102 Bacteria 1302
241 Ga0157374_10006699 3300013296 Bacteria 9789
242 Ga0157374_10056525 3300013296 Bacteria 3663
243 Ga0157374_10067409 3300013296 Bacteria 3364
244 Ga0157374_10513789 3300013296 Bacteria 1203
245 Ga0157378_10001136 3300013297 Bacteria 24233
246 Ga0157378_10080279 3300013297 Bacteria 2946
247 Ga0157378_10127484 3300013297 Bacteria 2352
248 Ga0157378_10245924 3300013297 Bacteria 1711
249 Ga0157378_10699282 3300013297 Bacteria 1033
250 Ga0163162_10022806 3300013306 Bacteria 6172
251 Ga0163162_10120791 3300013306 Unclassified 2724
252 Ga0163162_10123285 3300013306 Bacteria 2697
253 Ga0163162_10299488 3300013306 Bacteria 1740
254 Ga0163162_10313634 3300013306 Unclassified 1701
255 Ga0157372_10723937 3300013307 Bacteria 1157
256 Ga0157375_10002818 3300013308 Bacteria 15049
257 Ga0157375_10006021 3300013308 Bacteria 10577
258 Ga0157375_10056082 3300013308 Bacteria 3888
259 Ga0157375_10108045 3300013308 Bacteria 2876
260 Ga0157375_10116983 3300013308 Unclassified 2771
261 Ga0157375_10269978 3300013308 Bacteria 1863
262 Ga0163163_10038175 3300014325 Bacteria 4678
263 Ga0163163_10117872 3300014325 Bacteria 2687
264 Ga0163163_10248358 3300014325 Bacteria 1830
265 Ga0163163_10666477 3300014325 Bacteria 1104
266 Ga0157380_10071861 3300014326 Bacteria 2800
267 Ga0157380_10134290 3300014326 Bacteria 2115
268 Ga0157380_10200556 3300014326 Bacteria 1770
269 Ga0157380_10477153 3300014326 Bacteria 1205
270 Ga0157377_10108401 3300014745 Bacteria 1666
271 Ga0157377_10134513 3300014745 Bacteria 1513
272 Ga0157379_10025158 3300014968 Bacteria 5285
273 Ga0157379_10304046 3300014968 Bacteria 1454
274 Ga0157376_10008496 3300014969 Bacteria 7415
275 Ga0157376_10014256 3300014969 Bacteria 5959
276 Ga0163161_10013285 3300017792 Bacteria 5726
277 Ga0163161_10085555 3300017792 Bacteria 2326
278 Ga0163161_10149521 3300017792 Bacteria 1774
279 Ga0163161_10271783 3300017792 Bacteria 1326
280 Ga0207673_1006080 3300025290 Bacteria 1487
281 Ga0209051_1029342 3300025303 Bacteria 2154
282 Ga0207697_10005090 3300025315 Bacteria 6155
283 Ga0207697_10013373 3300025315 Unclassified 3425
284 Ga0207697_10159257 3300025315 Bacteria 984
285 Ga0207682_10000061 3300025893 Bacteria 46850
286 Ga0207682_10004222 3300025893 Bacteria 6069
287 Ga0207682_10009958 3300025893 Bacteria 3734
288 Ga0207642_10170822 3300025899 Bacteria 1176
289 Ga0207688_10001314 3300025901 Bacteria 12904
290 Ga0207688_10043967 3300025901 Bacteria 2489
291 Ga0207688_10213613 3300025901 Unclassified 1160
292 Ga0207688_10260564 3300025901 Bacteria 1052
293 Ga0207680_10029278 3300025903 Bacteria 3091
294 Ga0207680_10202578 3300025903 Bacteria 1353
295 Ga0207645_10000234 3300025907 Bacteria 45978
296 Ga0207645_10002609 3300025907 Bacteria 14052
297 Ga0207645_10030208 3300025907 Bacteria 3492
298 Ga0207645_10037290 3300025907 Bacteria 3119
299 Ga0207645_10137311 3300025907 Bacteria 1592
300 Ga0207645_10255506 3300025907 Bacteria 1160
301 Ga0207643_10005370 3300025908 Bacteria 6859
302 Ga0207643_10012233 3300025908 Bacteria 4641
303 Ga0207643_10052599 3300025908 Bacteria 2313
304 Ga0207705_10424956 3300025909 Bacteria 1029
305 Ga0207707_10022220 3300025912 Bacteria 5545
306 Ga0207693_10049822 3300025915 Bacteria 3289
307 Ga0207693_10256561 3300025915 Bacteria 1371
308 Ga0207663_10520219 3300025916 Bacteria 926
309 Ga0207662_10016289 3300025918 Bacteria 4192
310 Ga0207657_10007938 3300025919 Bacteria 10823
311 Ga0207657_10239394 3300025919 Bacteria 1449
312 Ga0207649_10024431 3300025920 Bacteria 3512
313 Ga0207649_10083345 3300025920 Bacteria 2075
314 Ga0207652_10201176 3300025921 Bacteria 1792
315 Ga0207681_10004560 3300025923 Bacteria 8524
316 Ga0207681_10051923 3300025923 Bacteria 2778
317 Ga0207681_10290849 3300025923 Bacteria 1289
318 Ga0207650_10006259 3300025925 Bacteria 8113
319 Ga0207650_10024331 3300025925 Bacteria 4303
320 Ga0207650_10046952 3300025925 Bacteria 3181
321 Ga0207650_10067052 3300025925 Bacteria 2692
322 Ga0207650_10077477 3300025925 Bacteria 2513
323 Ga0207650_10317758 3300025925 Bacteria 1275
324 Ga0207659_10034083 3300025926 Bacteria 3509
325 Ga0207659_10059568 3300025926 Bacteria 2745
326 Ga0207659_10080350 3300025926 Bacteria 2408
327 Ga0207659_10086742 3300025926 Bacteria 2328
328 Ga0207659_10120434 3300025926 Bacteria 2010
329 Ga0207659_10123788 3300025926 Bacteria 1985
330 Ga0207659_10306330 3300025926 Bacteria 1306
331 Ga0207700_10000862 3300025928 Bacteria 17453
332 Ga0207644_10007716 3300025931 Bacteria 7022
333 Ga0207644_10015490 3300025931 Bacteria 5119
334 Ga0207644_10042000 3300025931 Unclassified 3238
335 Ga0207644_10069592 3300025931 Bacteria 2570
336 Ga0207644_10074971 3300025931 Unclassified 2485
337 Ga0207644_10253376 3300025931 Bacteria 1405
338 Ga0207644_10586802 3300025931 Unclassified 924
339 Ga0207690_10022801 3300025932 Bacteria 3898
340 Ga0207690_10305912 3300025932 Unclassified 1245
341 Ga0207706_10033212 3300025933 Bacteria 4593
342 Ga0207706_10087653 3300025933 Bacteria 2737
343 Ga0207686_10064092 3300025934 Bacteria 2339
344 Ga0207686_10563627 3300025934 Bacteria 892
345 Ga0207709_10073234 3300025935 Bacteria 2182
346 Ga0207670_10302780 3300025936 Unclassified 1252
347 Ga0207669_10036734 3300025937 Bacteria 2803
348 Ga0207669_10037769 3300025937 Bacteria 2774
349 Ga0207669_10054999 3300025937 Bacteria 2407
350 Ga0207669_10080048 3300025937 Bacteria 2088
351 Ga0207669_10135473 3300025937 Bacteria 1700
352 Ga0207669_10605359 3300025937 Bacteria 891
353 Ga0207704_10195765 3300025938 Bacteria 1474
354 Ga0207665_10048354 3300025939 Bacteria 2855
355 Ga0207691_10000016 3300025940 Bacteria 141024
356 Ga0207691_10005386 3300025940 Bacteria 12354
357 Ga0207691_10074906 3300025940 Bacteria 3052
358 Ga0207691_10079035 3300025940 Bacteria 2961
359 Ga0207691_10089774 3300025940 Bacteria 2755
360 Ga0207691_10117048 3300025940 Bacteria 2365
361 Ga0207691_10527872 3300025940 Bacteria 1001
362 Ga0207711_10007632 3300025941 Bacteria 9045
363 Ga0207711_10043718 3300025941 Bacteria 3823
364 Ga0207711_10127478 3300025941 Bacteria 2278
365 Ga0207711_10323022 3300025941 Unclassified 1426
366 Ga0207689_10007085 3300025942 Bacteria 9856
367 Ga0207689_10015321 3300025942 Bacteria 6489
368 Ga0207689_10026630 3300025942 Bacteria 4843
369 Ga0207689_10200933 3300025942 Bacteria 1645
370 Ga0207679_10103693 3300025945 Bacteria 2230
371 Ga0207679_10171847 3300025945 Bacteria 1785
372 Ga0207679_10501389 3300025945 Bacteria 1083
373 Ga0207667_10185112 3300025949 Bacteria 2138
374 Ga0207651_10024243 3300025960 Bacteria 3749
375 Ga0207651_10243105 3300025960 Bacteria 1468
376 Ga0207651_10339860 3300025960 Unclassified 1261
377 Ga0207651_10546328 3300025960 Bacteria 1007
378 Ga0207651_10598378 3300025960 Bacteria 963
379 Ga0207712_10022453 3300025961 Bacteria 4155
380 Ga0207712_10182933 3300025961 Unclassified 1648
381 Ga0207668_10020325 3300025972 Bacteria 4216
382 Ga0207668_10050195 3300025972 Bacteria 2873
383 Ga0207668_10097432 3300025972 Bacteria 2176
384 Ga0207668_10331202 3300025972 Bacteria 1267
385 Ga0207668_10551987 3300025972 Bacteria 998
386 Ga0207668_10851268 3300025972 Unclassified 809
387 Ga0207640_10108187 3300025981 Bacteria 1964
388 Ga0207640_10291085 3300025981 Bacteria 1287
389 Ga0207658_10016699 3300025986 Bacteria 5051
390 Ga0207658_10017583 3300025986 Bacteria 4930
391 Ga0207658_10022908 3300025986 Bacteria 4352
392 Ga0207658_10557277 3300025986 Unclassified 1026
393 Ga0207677_10056021 3300026023 Bacteria 2698
394 Ga0207677_10133420 3300026023 Bacteria 1889
395 Ga0207677_10239529 3300026023 Bacteria 1467
396 Ga0207677_10375519 3300026023 Bacteria 1198
397 Ga0207677_10630263 3300026023 Bacteria 944
398 Ga0207703_10021506 3300026035 Bacteria 5051
399 Ga0207703_10370026 3300026035 Unclassified 1324
400 Ga0207639_10197305 3300026041 Bacteria 1723
401 Ga0207639_10298850 3300026041 Bacteria 1422
402 Ga0207678_10007404 3300026067 Bacteria 9721
403 Ga0207678_10034583 3300026067 Bacteria 4401
404 Ga0207678_10091879 3300026067 Bacteria 2594
405 Ga0207708_10012811 3300026075 Bacteria 6253
406 Ga0207708_10016794 3300026075 Bacteria 5510
407 Ga0207708_10190293 3300026075 Bacteria 1633
408 Ga0207702_10564244 3300026078 Bacteria 1114
409 Ga0207641_10003489 3300026088 Bacteria 13926
410 Ga0207641_10044586 3300026088 Unclassified 3730
411 Ga0207641_10089960 3300026088 Bacteria 2683
412 Ga0207641_10179650 3300026088 Bacteria 1937
413 Ga0207641_10187796 3300026088 Bacteria 1897
414 Ga0207648_10033233 3300026089 Bacteria 4550
415 Ga0207648_10051515 3300026089 Bacteria 3598
416 Ga0207648_10069438 3300026089 Bacteria 3070
417 Ga0207648_10091606 3300026089 Unclassified 2657
418 Ga0207648_10116554 3300026089 Bacteria 2347
419 Ga0207648_10169286 3300026089 Bacteria 1931
420 Ga0207648_10488305 3300026089 Bacteria 1126
421 Ga0207676_10015358 3300026095 Bacteria 5521
422 Ga0207676_10023667 3300026095 Bacteria 4536
423 Ga0207676_10170707 3300026095 Bacteria 1895
424 Ga0207676_10243618 3300026095 Bacteria 1614
425 Ga0207676_10255828 3300026095 Bacteria 1578
426 Ga0207676_10314229 3300026095 Bacteria 1435
427 Ga0207674_10019905 3300026116 Bacteria 7261
428 Ga0207675_100060037 3300026118 Bacteria 3549
429 Ga0207675_100061354 3300026118 Bacteria 3510
430 Ga0207675_100066038 3300026118 Bacteria 3381
431 Ga0207675_100192666 3300026118 Unclassified 1956
432 Ga0207675_100306012 3300026118 Bacteria 1549
433 Ga0207683_10000322 3300026121 Bacteria 43758
434 Ga0207683_10006756 3300026121 Bacteria 9814
435 Ga0207683_10058022 3300026121 Bacteria 3398
436 Ga0207683_10132700 3300026121 Bacteria 2240
437 Ga0207683_10152859 3300026121 Bacteria 2083
438 Ga0207683_10164412 3300026121 Bacteria 2007
439 Ga0207683_10272690 3300026121 Bacteria 1546
440 Ga0207683_10786749 3300026121 Bacteria 883
441 Ga0207698_10213857 3300026142 Bacteria 1736
442 Ga0207698_10228506 3300026142 Bacteria 1687
443 Ga0209982_1008653 3300027552 Bacteria 1496
444 Ga0209282_1000056 3300027666 Bacteria 100584
445 Ga0209971_1026362 3300027682 Bacteria 1389
446 Ga0207428_10101655 3300027907 Bacteria 2221
447 Ga0207428_10118878 3300027907 Bacteria 2028
448 Ga0207428_10413939 3300027907 Bacteria 986
449 Ga0268266_10064492 3300028379 Bacteria 3165
450 Ga0268266_10081516 3300028379 Bacteria 2821
451 Ga0268266_10157144 3300028379 Bacteria 2055
452 Ga0268266_10339311 3300028379 Bacteria 1410
453 Ga0268266_10339583 3300028379 Unclassified 1409
454 Ga0268266_10366071 3300028379 Bacteria 1357
455 Ga0268265_10030333 3300028380 Bacteria 3893
456 Ga0268265_10079412 3300028380 Bacteria 2584
457 Ga0268265_10365877 3300028380 Bacteria 1322
458 Ga0268265_10401558 3300028380 Bacteria 1267
459 Ga0268264_10030758 3300028381 Bacteria 4400
460 Ga0268264_10040596 3300028381 Bacteria 3845
461 Ga0268264_10244646 3300028381 Bacteria 1663
462 Ga0268264_10307204 3300028381 Bacteria 1495
463 Ga0307508_10049670 3300031616 Bacteria 3736
464 Ga0373929_0074480 3300035085 Bacteria 817
465 Ga0373939_0024886 3300035114 Bacteria 1672
466 Ga0373941_0008236 3300035115 Bacteria 2583
467 Ga0373943_0245874 3300035170 Bacteria 1003
468 Ga0373946_0078116 3300035171 Bacteria 1444
469 Ga0373962_0029902 3300035242 Bacteria 1488
470 Ga0373924_0036913 3300035410 Bacteria 1987
471 Ga0373931_0048360 3300035691 Bacteria 2255
472 Ga0373935_0172764 3300035692 Bacteria 1479
473 Ga0373927_0005043 3300035695 Bacteria 9139
474 Ga0373927_0196729 3300035695 Bacteria 1323
475 Ga0373933_0165711 3300035724 Bacteria 1405
476 Ga0373947_0055220 3300035725 Bacteria 2398
477 Ga0373937_0355578 3300036401 Bacteria 1388
478 Ga0373925_0286122 3300037068 Bacteria 1328
479 Ga0453684_0192503 3300044712 Bacteria 2385
480 Ga0451576_0258727 3300045051 Bacteria 1819
481 Ga0495592_0025118 3300046454 Bacteria 4524
482 Ga0495592_0066966 3300046454 Plasmid 2626
483 Ga0495603_0003585 3300046455 Bacteria 9242
484 Ga0495603_0027702 3300046455 Bacteria 3419
485 Ga0495591_002203 3300046458 Bacteria 11128
486 Ga0495629_0002374 3300046459 Bacteria 14481
487 Ga0495629_0026054 3300046459 Bacteria 4155
488 Ga0495629_0037990 3300046459 Bacteria 3393
489 Ga0495651_0047485 3300046462 Bacteria 3319
490 Ga0495651_0307364 3300046462 Bacteria 1062
491 Ga0495653_0017749 3300046463 Bacteria 5785
492 Ga0495653_0050313 3300046463 Bacteria 3205
493 Ga0495650_0067770 3300046471 Bacteria 1409
494 Ga0495580_0005271 3300046472 Bacteria 10739
495 Ga0495580_0009900 3300046472 Bacteria 7465
496 Ga0495580_0029862 3300046472 Unclassified 3953
497 Ga0495582_0004382 3300046473 Bacteria 7938
498 Ga0495582_0020899 3300046473 Bacteria 3584
499 Ga0495582_0051171 3300046473 Bacteria 2277
500 Ga0495639_0023404 3300046475 Unclassified 2715
501 Ga0495662_0097599 3300046476 Bacteria 1436
502 Ga0495664_0002625 3300046477 Bacteria 9668
503 Ga0495664_0054036 3300046477 Bacteria 2388
504 Ga0495664_0063360 3300046477 Bacteria 2203
505 Ga0495585_0306138 3300046492 Unclassified 780
506 Ga0495594_0017844 3300046499 Plasmid 3754
507 Ga0495594_0121304 3300046499 Bacteria 1478
508 Ga0495596_0001062 3300046500 Bacteria 16329
509 Ga0495608_0031416 3300046511 Plasmid 3591
510 Ga0495618_0001602 3300046514 Bacteria 15107
511 Ga0495618_0002795 3300046514 Bacteria 11069
512 Ga0495628_0017779 3300046516 Bacteria 5906
513 Ga0495630_0011705 3300046517 Bacteria 6356
514 Ga0495630_0044500 3300046517 Bacteria 3317
515 Ga0495648_0009776 3300046524 Bacteria 7385
516 Ga0495648_0030165 3300046524 Bacteria 3589
517 Ga0495666_0000355 3300046526 Bacteria 20140
518 Ga0495666_0001099 3300046526 Bacteria 12927
519 Ga0495666_0023107 3300046526 Unclassified 3076
520 Ga0495666_0170146 3300046526 Bacteria 1008
521 Ga0495642_0011911 3300046528 Bacteria 3349
522 Ga0495652_0014099 3300046529 Bacteria 7178
523 Ga0495654_0001636 3300046530 Bacteria 15177
524 Ga0495654_0070469 3300046530 Unclassified 1658
525 Ga0495665_0002812 3300046531 Bacteria 9389
526 Ga0495665_0005020 3300046531 Bacteria 7134
527 Ga0495665_0007474 3300046531 Bacteria 5911
528 Ga0495640_0014286 3300046533 Bacteria 6015
529 Ga0495640_0254187 3300046533 Bacteria 1099
530 Ga0495586_0002569 3300046535 Bacteria 9822
531 Ga0495586_0032736 3300046535 Bacteria 2788
532 Ga0495586_0133480 3300046535 Bacteria 1391
533 Ga0495586_0237700 3300046535 Unclassified 1038
534 Ga0495587_0003720 3300046536 Bacteria 10125
535 Ga0495587_0004798 3300046536 Bacteria 8877
536 Ga0495587_0164152 3300046536 Bacteria 1263
537 Ga0495621_0044246 3300046539 Unclassified 1573
538 Ga0495621_0165802 3300046539 Bacteria 876
539 Ga0495645_0000787 3300046543 Bacteria 21705
540 Ga0495645_0012219 3300046543 Bacteria 6047
541 Ga0495645_0289836 3300046543 Bacteria 1073
542 Ga0495667_0068066 3300046559 Bacteria 2326
543 Ga0495656_0095350 3300046615 Bacteria 1367
544 Ga0495634_0001762 3300046642 Bacteria 18735
545 Ga0495634_0073755 3300046642 Bacteria 2243
546 Ga0495634_0178613 3300046642 Unclassified 1330
547 Ga0495634_0293443 3300046642 Bacteria 985
548 Ga0495611_0073101 3300046648 Bacteria 1569
549 Ga0495635_0004438 3300046663 Bacteria 9722
550 Ga0495635_0007339 3300046663 Bacteria 7694
551 Ga0495661_0005958 3300046665 Bacteria 8605
552 Ga0495661_0036656 3300046665 Unclassified 3068
553 Ga0495588_0032079 3300046674 Bacteria 2647
554 Ga0495588_0206559 3300046674 Bacteria 1037
555 Ga0495599_0001568 3300046678 Bacteria 13153
556 Ga0495599_0065943 3300046678 Bacteria 2262
557 Ga0495599_0115480 3300046678 Bacteria 1670
558 Ga0495623_0013341 3300046679 Bacteria 5330
559 Ga0495646_0002710 3300046680 Bacteria 10952
560 Ga0495646_0013730 3300046680 Bacteria 5149
561 Ga0495647_0077363 3300046681 Bacteria 1343
562 Ga0495669_0070630 3300046684 Unclassified 1591
563 Ga0495669_0164057 3300046684 Bacteria 1055
564 Ga0495613_0007791 3300046689 Bacteria 7968
565 Ga0495613_0018119 3300046689 Bacteria 5247
566 Ga0495613_0210825 3300046689 Bacteria 1366
567 Ga0495624_0008165 3300046690 Bacteria 7323
568 Ga0495624_0038909 3300046690 Bacteria 3052
569 Ga0495624_0334631 3300046690 Bacteria 911
570 Ga0495589_0003652 3300046794 Bacteria 8313
571 Ga0495589_0164701 3300046794 Bacteria 1055
572 Ga0495600_0032705 3300046809 Unclassified 3375
573 Ga0495600_0187882 3300046809 Unclassified 1330
574 Ga0495600_0209076 3300046809 Bacteria 1251
575 Ga0495581_0018324 3300047315 Plasmid 4066
576 Ga0495581_0118021 3300047315 Bacteria 1543
577 Ga0495581_0183659 3300047315 Bacteria 1223
578 Ga0495604_0002942 3300047317 Bacteria 13638
579 Ga0495604_0009426 3300047317 Bacteria 7723
580 Ga0495604_0318194 3300047317 Unclassified 1040
581 Ga0495676_0001071 3300047321 Bacteria 23197
582 Ga0495676_0039784 3300047321 Bacteria 3890
583 Ga0495683_0003201 3300047323 Bacteria 9568
584 Ga0495675_0011606 3300047444 Bacteria 5532
585 Ga0495675_0020720 3300047444 Bacteria 4184
586 Ga0495679_000779 3300047446 Bacteria 20177
587 Ga0495679_002600 3300047446 Bacteria 9071
588 Ga0495673_0007278 3300047469 Bacteria 6389
589 Ga0495684_0050780 3300047471 Plasmid 3166
590 Ga0495684_0055359 3300047471 Bacteria 3025
591 Ga0495593_0002822 3300047673 Bacteria 10463
592 Ga0495602_0009355 3300048088 Bacteria 10191
593 Ga0495614_0005059 3300048089 Bacteria 5948
594 Ga0495614_0031441 3300048089 Bacteria 2284
595 Ga0496100_0165235 3300048903 Unclassified 1589
596 Ga0496101_0020052 3300048904 Bacteria 4572
597 Ga0496101_0258191 3300048904 Bacteria 1358
598 Ga0496102_0440351 3300048905 Unclassified 1223
599 Ga0496102_0573227 3300048905 Bacteria 1051
600 Ga0496104_0087986 3300048907 Bacteria 2967
601 Ga0496104_0183316 3300048907 Unclassified 2004
602 Ga0496106_0032389 3300048909 Bacteria 3897
603 Ga0496109_0049331 3300048912 Bacteria 3832
604 Ga0496109_0056901 3300048912 Bacteria 3568
605 Ga0496109_0107934 3300048912 Bacteria 2587
606 Ga0496110_0020659 3300048913 Bacteria 5562
607 Ga0496110_0090527 3300048913 Plasmid 2735
608 Ga0496111_0006924 3300048914 Bacteria 7399
609 Ga0496112_0115957 3300048915 Bacteria 2649
610 Ga0496113_0522338 3300048916 Bacteria 953
611 Ga0496114_0280052 3300048917 Unclassified 1470
612 Ga0496114_0340839 3300048917 Bacteria 1325
613 Ga0496114_0361649 3300048917 Bacteria 1284
614 Ga0495682_0018792 3300049460 Bacteria 2603
615 Ga0501032_0017247 3300049569 Bacteria 5071
616 Ga0501033_0035714 3300049570 Bacteria 3726
617 Ga0501036_0007866 3300049572 Bacteria 8719
618 Ga0501036_0065758 3300049572 Bacteria 3068
619 Ga0501038_0003668 3300049574 Bacteria 14310
620 Ga0501038_0084562 3300049574 Bacteria 2669
621 Ga0501038_0106006 3300049574 Bacteria 2334
622 Ga0501039_0001562 3300049575 Bacteria 16845
623 Ga0501039_0047098 3300049575 Bacteria 3332
624 Ga0501040_0015383 3300049576 Bacteria 5059
625 Ga0501040_0163812 3300049576 Bacteria 1572
626 Ga0501041_0001011 3300049577 Bacteria 15387
627 Ga0501041_0057151 3300049577 Bacteria 2385
628 Ga0501041_0395401 3300049577 Bacteria 875
629 Ga0501042_0039819 3300049578 Bacteria 3341
630 Ga0501042_0053848 3300049578 Bacteria 2870
631 Ga0501042_0060067 3300049578 Bacteria 2715
632 Ga0501046_0004984 3300049580 Bacteria 11920
633 Ga0501046_0254960 3300049580 Bacteria 1290
634 Ga0501047_0374780 3300049581 Bacteria 1258
635 Ga0501048_0011295 3300049582 Bacteria 6658
636 Ga0501048_0035915 3300049582 Bacteria 3565
637 Ga0501048_0044988 3300049582 Bacteria 3154
638 Ga0501068_0008951 3300049584 Bacteria 5587
639 Ga0501068_0162776 3300049584 Bacteria 1406
640 Ga0501068_0169579 3300049584 Bacteria 1377
641 Ga0501070_0132021 3300049586 Bacteria 2063
642 Ga0501070_0282961 3300049586 Bacteria 1353
643 Ga0501071_0035377 3300049587 Bacteria 3557
644 Ga0501071_0067054 3300049587 Bacteria 2609
645 Ga0501071_0122995 3300049587 Bacteria 1924
646 Ga0501072_0005478 3300049588 Bacteria 9661
647 Ga0501072_0069343 3300049588 Bacteria 2784
648 Ga0501072_0072042 3300049588 Bacteria 2730
649 Ga0501073_0181413 3300049589 Bacteria 1457
650 Ga0501074_0005048 3300049590 Bacteria 9468
651 Ga0501075_0005668 3300049591 Bacteria 8547
652 Ga0501075_0039930 3300049591 Bacteria 3513
653 Ga0501075_0073734 3300049591 Bacteria 2581
654 Ga0501075_0143419 3300049591 Bacteria 1820
655 Ga0501076_0001436 3300049592 Bacteria 16003
656 Ga0501076_0002047 3300049592 Bacteria 13817
657 Ga0501076_0013487 3300049592 Bacteria 6128
658 Ga0501077_0004033 3300049593 Bacteria 8864
659 Ga0501077_0012140 3300049593 Bacteria 5392
660 Ga0501077_0040797 3300049593 Bacteria 2955
661 Ga0501077_0153038 3300049593 Bacteria 1464
662 Ga0501077_0173872 3300049593 Bacteria 1368
663 Ga0501079_0002347 3300049741 Bacteria 13733
664 Ga0501079_0004425 3300049741 Bacteria 10405
665 Ga0501079_0143904 3300049741 Bacteria 1857
666 Ga0501080_0012507 3300049742 Bacteria 7784
667 Ga0501080_0042958 3300049742 Bacteria 4208
668 Ga0501080_0173528 3300049742 Bacteria 1987
669 Ga0501081_0001544 3300049743 Bacteria 14163
670 Ga0501081_0084564 3300049743 Bacteria 2225
671 Ga0501081_0090190 3300049743 Bacteria 2154
672 Ga0501081_0141157 3300049743 Bacteria 1726
673 Ga0501083_0301049 3300049744 Bacteria 1043
674 Ga0501035_0169346 3300049822 Bacteria 1888
675 Ga0501044_0119867 3300049823 Bacteria 2633
676 Ga0501045_0000154 3300049824 Bacteria 36954
677 Ga0501045_0004902 3300049824 Bacteria 9271
678 Ga0501045_0086739 3300049824 Bacteria 2310
679 nmdc:mga05p37_209379_c1 3300050507 Bacteria 2358
680 nmdc:mga09592_52191_c1 3300050508 Bacteria 3451
681 nmdc:mga08y16_103252_c1 3300050511 Bacteria 2968
682 nmdc:mga08y16_140699_c1 3300050511 Bacteria 2509
683 nmdc:mga08y16_333271_c1 3300050511 Bacteria 1561
684 nmdc:mga08y16_48667_c1 3300050511 Bacteria 4436
685 nmdc:mga08y16_599371_c1 3300050511 Unclassified 1111
686 nmdc:mga0rr50_280761_c1 3300050513 Bacteria 1390
687 nmdc:mga0rr50_482022_c1 3300050513 Bacteria 1053
688 nmdc:mga08x19_132957_c1 3300050514 Bacteria 1675
689 nmdc:mga0a205_90523_c1 3300050515 Bacteria 2957
690 Ga0495595_0063276 3300053084 Bacteria 1737
691 Ga0495595_0127589 3300053084 Bacteria 1242
692 Ga0495619_0158128 3300053085 Bacteria 1564
693 Ga0501084_0003310 3300054114 Bacteria 13033
694 Ga0501084_0139082 3300054114 Bacteria 2044
695 Ga0501084_0267924 3300054114 Bacteria 1442
696 Ga0501082_0003385 3300060353 Bacteria 13915
697 Ga0501082_0004068 3300060353 Bacteria 12758
698 Ga0501082_0067389 3300060353 Bacteria 3082
699 Ga0501082_0203547 3300060353 Bacteria 1722
700 Ga0530510_0001503 3300061734 Bacteria 15668
701 Ga0530510_0005497 3300061734 Bacteria 8774
702 Ga0530510_0050887 3300061734 Bacteria 2992
703 2514044280 2513237165 Bacteria 6771773
704 Ga0068864_100431036
705 JGI24738J21930_10043217
706 JGI24035J26624_1008640
707 JGI24742J22300_10008629
708 JGI25407J50210_10029203
709 JGI25405J52794_10035860
710 Ga0065704_10087861
711 Ga0065712_10116381
712 Ga0065712_10142599
713 Ga0065715_10019639
714 Ga0065715_10026691
715 Ga0065715_10225238
716 Ga0065707_10039324
717 Ga0065707_10188819
718 Ga0070676_10000975
719 Ga0070676_10002135
720 Ga0070676_10015485
721 Ga0070676_10107765
722 Ga0070676_10261016
723 Ga0070683_100667172
724 Ga0070690_100034061
725 Ga0070670_100027612
726 Ga0070670_100031399
727 Ga0070670_100083408
728 Ga0070670_100237511
729 Ga0070670_100257941
730 Ga0070677_10167417
731 Ga0068869_100002711
732 Ga0068869_100019735
733 Ga0068869_100040177
734 Ga0068869_100191623
735 Ga0070666_10020055
736 Ga0070666_10195165
737 Ga0070666_10257775
738 Ga0070666_10482808
739 Ga0070680_100040135
740 Ga0070682_100399014
741 Ga0068868_100002552
742 Ga0068868_100086231
743 Ga0068868_100146893
744 Ga0070660_100018644
745 Ga0070660_100155457
746 Ga0070689_100022204
747 Ga0070687_100042360
748 Ga0070687_100320757
749 Ga0070661_100224948
750 Ga0070661_100315081
751 Ga0070692_10089133
752 Ga0070668_100002222
753 Ga0070668_100010370
754 Ga0070668_100011053
755 Ga0070668_100087413
756 Ga0070668_100121944
757 Ga0070668_100126229
758 Ga0070668_100688720
759 Ga0070669_100005048
760 Ga0070669_100013760
761 Ga0070669_100067353
762 Ga0070669_100150198
763 Ga0070669_100247848
764 Ga0070669_100281736
765 Ga0070669_100604555
766 Ga0070675_100016143
767 Ga0070675_100036588
768 Ga0070675_100051583
769 Ga0070675_100055790
770 Ga0070675_100073196
771 Ga0070675_100448251
772 Ga0070671_100002986
773 Ga0070671_100012292
774 Ga0070671_100018971
775 Ga0070671_100034631
776 Ga0070671_100246776
777 Ga0070674_100006351
778 Ga0070674_100051453
779 Ga0070674_100288953
780 Ga0070673_100002879
781 Ga0070673_100005830
782 Ga0070673_100010665
783 Ga0070673_100219831
784 Ga0070673_100227417
785 Ga0070673_100236390
786 Ga0070688_100027163
787 Ga0070688_100042356
788 Ga0070659_100043040
789 Ga0070659_100111933
790 Ga0070659_100415367
791 Ga0070667_100017218
792 Ga0070667_100076142
793 Ga0070667_100229068
794 Ga0070667_100293055
795 Ga0070713_100000018
796 Ga0070701_10091095
797 Ga0070701_10292118
798 Ga0070711_100320779
799 Ga0070705_100168032
800 Ga0070700_100126568
801 Ga0070700_100500860
802 Ga0070663_100022683
803 Ga0070663_100076103
804 Ga0070663_100580147
805 Ga0070678_100001518
806 Ga0070678_100002689
807 Ga0070678_100055739
808 Ga0070678_100131031
809 Ga0070678_100280963
810 Ga0070662_100054607
811 Ga0070662_100134135
812 Ga0070681_10094972
813 Ga0068867_100013870
814 Ga0068867_100037800
815 Ga0068867_100141730
816 Ga0068867_100209875
817 Ga0068867_100342843
818 Ga0070685_10136877
819 Ga0074259_11477881
820 Ga0070699_100559106
821 Ga0070679_100079495
822 Ga0070697_100087493
823 Ga0068853_100036464
824 Ga0068853_100090407
825 Ga0068853_100307208
826 Ga0068853_100601940
827 Ga0070672_100006506
828 Ga0070672_100022100
829 Ga0070672_100095404
830 Ga0070672_100136190
831 Ga0070672_100366739
832 Ga0070672_100499500
833 Ga0070686_100030309
834 Ga0070696_100116469
835 Ga0070693_100191818
836 Ga0070693_100297853
837 Ga0070693_100483640
838 Ga0070665_100001417
839 Ga0070665_100014910
840 Ga0070665_100225991
841 Ga0070665_100280959
842 Ga0070665_100454627
843 Ga0070704_100492571
844 Ga0068855_100064485
845 Ga0070664_100102937
846 Ga0070664_100361809
847 Ga0070664_100759923
848 Ga0068857_100249612
849 Ga0068854_100458871
850 Ga0068856_100599482
851 Ga0068852_100012670
852 Ga0068852_100355067
853 Ga0068852_100358077
854 Ga0068859_100016391
855 Ga0068859_100044040
856 Ga0068859_100100447
857 Ga0068864_100017853
858 Ga0068864_100030585
859 Ga0068864_100150710
860 Ga0068864_100376484
861 Ga0068864_100542015
862 Ga0068864_100598330
863 Ga0068864_100606345
864 Ga0068861_100005831
865 Ga0068861_100199995
866 Ga0068861_100574215
867 Ga0068851_10044527
868 Ga0068851_10075807
869 Ga0068870_10004919
870 Ga0068870_10201316
871 Ga0068863_100017336
872 Ga0068863_100036668
873 Ga0068863_100127013
874 Ga0068858_100005578
875 Ga0068858_100201293
876 Ga0068858_100257607
877 Ga0068860_100008471
878 Ga0068860_100028522
879 Ga0068860_100159936
880 Ga0068860_100185902
881 Ga0068860_100473929
882 Ga0068860_100764127
883 Ga0068862_100088908
884 Ga0068862_100101616
885 Ga0068862_100136406
886 Ga0068862_100225050
887 Ga0068862_100640728
888 Ga0081455_10003769
889 Ga0081455_10008430
890 Ga0081538_10027160
891 Ga0081540_1004836
892 Ga0070716_100203905
893 Ga0070712_100058113
894 Ga0097621_100004591
895 Ga0097621_100005686
896 Ga0097621_100021827
897 Ga0097621_100125352
898 Ga0068871_100018980
899 Ga0068871_100027638
900 Ga0068871_100047131
901 Ga0068871_100211176
902 Ga0075428_100005766
903 Ga0075428_100214532
904 Ga0075431_100130661
905 Ga0075431_100403694
906 Ga0068865_100061479
907 Ga0068865_100070366
908 Ga0068865_100096536
909 Ga0075436_100059708
910 Ga0097620_100016393
911 Ga0097620_100044039
912 Ga0097620_100100445
913 Ga0099826_10000011
914 Ga0075435_100135692
915 Ga0075435_100642144
916 Ga0105240_10228926
917 Ga0111539_10024009
918 Ga0111539_10061824
919 Ga0111539_10163168
920 Ga0111539_10203616
921 Ga0105245_10042107
922 Ga0105243_10287383
923 Ga0105243_10353242
924 Ga0105242_10045598
925 Ga0105242_10117411
926 Ga0105242_10638421
927 Ga0105248_10011610
928 Ga0105248_10074951
929 Ga0105248_10077339
930 Ga0105248_10129661
931 Ga0105248_10241137
932 Ga0105248_10423687
933 Ga0105238_10503437
934 Ga0105249_10010855
935 Ga0105249_10047654
936 Ga0105249_10387764
937 Ga0105249_10496866
938 Ga0105239_10213147
939 Ga0105246_10048981
940 Ga0157339_1004740
941 Ga0157324_1005326
942 Ga0157342_1006533
943 Ga0157371_10240643
944 Ga0157374_10006699
945 Ga0157374_10056525
946 Ga0157374_10067409
947 Ga0157374_10513789
948 Ga0157378_10001136
949 Ga0157378_10080279
950 Ga0157378_10127484
951 Ga0157378_10245924
952 Ga0157378_10699282
953 Ga0163162_10022806
954 Ga0163162_10120791
955 Ga0163162_10123285
956 Ga0163162_10299488
957 Ga0163162_10313634
958 Ga0157372_10723937
959 Ga0157375_10002818
960 Ga0157375_10006021
961 Ga0157375_10056082
962 Ga0157375_10108045
963 Ga0157375_10116983
964 Ga0157375_10269978
965 Ga0163163_10038175
966 Ga0163163_10117872
967 Ga0163163_10248358
968 Ga0163163_10666477
969 Ga0157380_10071861
970 Ga0157380_10134290
971 Ga0157380_10200556
972 Ga0157380_10477153
973 Ga0157377_10108401
974 Ga0157377_10134513
975 Ga0157379_10025158
976 Ga0157379_10304046
977 Ga0157376_10008496
978 Ga0157376_10014256
979 Ga0163161_10013285
980 Ga0163161_10085555
981 Ga0163161_10149521
982 Ga0163161_10271783
983 Ga0207673_1006080
984 Ga0209051_1029342
985 Ga0207697_10005090
986 Ga0207697_10013373
987 Ga0207697_10159257
988 Ga0207682_10000061
989 Ga0207682_10004222
990 Ga0207682_10009958
991 Ga0207642_10170822
992 Ga0207688_10001314
993 Ga0207688_10043967
994 Ga0207688_10213613
995 Ga0207688_10260564
996 Ga0207680_10029278
997 Ga0207680_10202578
998 Ga0207645_10000234
999 Ga0207645_10002609
1000 Ga0207645_10030208
1001 Ga0207645_10037290
1002 Ga0207645_10137311
1003 Ga0207645_10255506
1004 Ga0207643_10005370
1005 Ga0207643_10012233
1006 Ga0207643_10052599
1007 Ga0207705_10424956
1008 Ga0207707_10022220
1009 Ga0207693_10049822
1010 Ga0207693_10256561
1011 Ga0207663_10520219
1012 Ga0207662_10016289
1013 Ga0207657_10007938
1014 Ga0207657_10239394
1015 Ga0207649_10024431
1016 Ga0207649_10083345
1017 Ga0207652_10201176
1018 Ga0207681_10004560
1019 Ga0207681_10051923
1020 Ga0207681_10290849
1021 Ga0207650_10006259
1022 Ga0207650_10024331
1023 Ga0207650_10046952
1024 Ga0207650_10067052
1025 Ga0207650_10077477
1026 Ga0207650_10317758
1027 Ga0207659_10034083
1028 Ga0207659_10059568
1029 Ga0207659_10080350
1030 Ga0207659_10086742
1031 Ga0207659_10120434
1032 Ga0207659_10123788
1033 Ga0207659_10306330
1034 Ga0207700_10000862
1035 Ga0207644_10007716
1036 Ga0207644_10015490
1037 Ga0207644_10042000
1038 Ga0207644_10069592
1039 Ga0207644_10074971
1040 Ga0207644_10253376
1041 Ga0207644_10586802
1042 Ga0207690_10022801
1043 Ga0207690_10305912
1044 Ga0207706_10033212
1045 Ga0207706_10087653
1046 Ga0207686_10064092
1047 Ga0207686_10563627
1048 Ga0207709_10073234
1049 Ga0207670_10302780
1050 Ga0207669_10036734
1051 Ga0207669_10037769
1052 Ga0207669_10054999
1053 Ga0207669_10080048
1054 Ga0207669_10135473
1055 Ga0207669_10605359
1056 Ga0207704_10195765
1057 Ga0207665_10048354
1058 Ga0207691_10000016
1059 Ga0207691_10005386
1060 Ga0207691_10074906
1061 Ga0207691_10079035
1062 Ga0207691_10089774
1063 Ga0207691_10117048
1064 Ga0207691_10527872
1065 Ga0207711_10007632
1066 Ga0207711_10043718
1067 Ga0207711_10127478
1068 Ga0207711_10323022
1069 Ga0207689_10007085
1070 Ga0207689_10015321
1071 Ga0207689_10026630
1072 Ga0207689_10200933
1073 Ga0207679_10103693
1074 Ga0207679_10171847
1075 Ga0207679_10501389
1076 Ga0207667_10185112
1077 Ga0207651_10024243
1078 Ga0207651_10243105
1079 Ga0207651_10339860
1080 Ga0207651_10546328
1081 Ga0207651_10598378
1082 Ga0207712_10022453
1083 Ga0207712_10182933
1084 Ga0207668_10020325
1085 Ga0207668_10050195
1086 Ga0207668_10097432
1087 Ga0207668_10331202
1088 Ga0207668_10551987
1089 Ga0207668_10851268
1090 Ga0207640_10108187
1091 Ga0207640_10291085
1092 Ga0207658_10016699
1093 Ga0207658_10017583
1094 Ga0207658_10022908
1095 Ga0207658_10557277
1096 Ga0207677_10056021
1097 Ga0207677_10133420
1098 Ga0207677_10239529
1099 Ga0207677_10375519
1100 Ga0207677_10630263
1101 Ga0207703_10021506
1102 Ga0207703_10370026
1103 Ga0207639_10197305
1104 Ga0207639_10298850
1105 Ga0207678_10007404
1106 Ga0207678_10034583
1107 Ga0207678_10091879
1108 Ga0207708_10012811
1109 Ga0207708_10016794
1110 Ga0207708_10190293
1111 Ga0207702_10564244
1112 Ga0207641_10003489
1113 Ga0207641_10044586
1114 Ga0207641_10089960
1115 Ga0207641_10179650
1116 Ga0207641_10187796
1117 Ga0207648_10033233
1118 Ga0207648_10051515
1119 Ga0207648_10069438
1120 Ga0207648_10091606
1121 Ga0207648_10116554
1122 Ga0207648_10169286
1123 Ga0207648_10488305
1124 Ga0207676_10015358
1125 Ga0207676_10023667
1126 Ga0207676_10170707
1127 Ga0207676_10243618
1128 Ga0207676_10255828
1129 Ga0207676_10314229
1130 Ga0207674_10019905
1131 Ga0207675_100060037
1132 Ga0207675_100061354
1133 Ga0207675_100066038
1134 Ga0207675_100192666
1135 Ga0207675_100306012
1136 Ga0207683_10000322
1137 Ga0207683_10006756
1138 Ga0207683_10058022
1139 Ga0207683_10132700
1140 Ga0207683_10152859
1141 Ga0207683_10164412
1142 Ga0207683_10272690
1143 Ga0207683_10786749
1144 Ga0207698_10213857
1145 Ga0207698_10228506
1146 Ga0209982_1008653
1147 Ga0209282_1000056
1148 Ga0209971_1026362
1149 Ga0207428_10101655
1150 Ga0207428_10118878
1151 Ga0207428_10413939
1152 Ga0268266_10064492
1153 Ga0268266_10081516
1154 Ga0268266_10157144
1155 Ga0268266_10339311
1156 Ga0268266_10339583
1157 Ga0268266_10366071
1158 Ga0268265_10030333
1159 Ga0268265_10079412
1160 Ga0268265_10365877
1161 Ga0268265_10401558
1162 Ga0268264_10030758
1163 Ga0268264_10040596
1164 Ga0268264_10244646
1165 Ga0268264_10307204
1166 Ga0307508_10049670
1167 Ga0373929_0074480
1168 Ga0373939_0024886
1169 Ga0373941_0008236
1170 Ga0373943_0245874
1171 Ga0373946_0078116
1172 Ga0373962_0029902
1173 Ga0373924_0036913
1174 Ga0373931_0048360
1175 Ga0373935_0172764
1176 Ga0373927_0005043
1177 Ga0373927_0196729
1178 Ga0373933_0165711
1179 Ga0373947_0055220
1180 Ga0373937_0355578
1181 Ga0373925_0286122
1182 Ga0453684_0192503
1183 Ga0451576_0258727
1184 Ga0495592_0025118
1185 Ga0495592_0066966
1186 Ga0495603_0003585
1187 Ga0495603_0027702
1188 Ga0495591_002203
1189 Ga0495629_0002374
1190 Ga0495629_0026054
1191 Ga0495629_0037990
1192 Ga0495651_0047485
1193 Ga0495651_0307364
1194 Ga0495653_0017749
1195 Ga0495653_0050313
1196 Ga0495650_0067770
1197 Ga0495580_0005271
1198 Ga0495580_0009900
1199 Ga0495580_0029862
1200 Ga0495582_0004382
1201 Ga0495582_0020899
1202 Ga0495582_0051171
1203 Ga0495639_0023404
1204 Ga0495662_0097599
1205 Ga0495664_0002625
1206 Ga0495664_0054036
1207 Ga0495664_0063360
1208 Ga0495585_0306138
1209 Ga0495594_0017844
1210 Ga0495594_0121304
1211 Ga0495596_0001062
1212 Ga0495608_0031416
1213 Ga0495618_0001602
1214 Ga0495618_0002795
1215 Ga0495628_0017779
1216 Ga0495630_0011705
1217 Ga0495630_0044500
1218 Ga0495648_0009776
1219 Ga0495648_0030165
1220 Ga0495666_0000355
1221 Ga0495666_0001099
1222 Ga0495666_0023107
1223 Ga0495666_0170146
1224 Ga0495642_0011911
1225 Ga0495652_0014099
1226 Ga0495654_0001636
1227 Ga0495654_0070469
1228 Ga0495665_0002812
1229 Ga0495665_0005020
1230 Ga0495665_0007474
1231 Ga0495640_0014286
1232 Ga0495640_0254187
1233 Ga0495586_0002569
1234 Ga0495586_0032736
1235 Ga0495586_0133480
1236 Ga0495586_0237700
1237 Ga0495587_0003720
1238 Ga0495587_0004798
1239 Ga0495587_0164152
1240 Ga0495621_0044246
1241 Ga0495621_0165802
1242 Ga0495645_0000787
1243 Ga0495645_0012219
1244 Ga0495645_0289836
1245 Ga0495667_0068066
1246 Ga0495656_0095350
1247 Ga0495634_0001762
1248 Ga0495634_0073755
1249 Ga0495634_0178613
1250 Ga0495634_0293443
1251 Ga0495611_0073101
1252 Ga0495635_0004438
1253 Ga0495635_0007339
1254 Ga0495661_0005958
1255 Ga0495661_0036656
1256 Ga0495588_0032079
1257 Ga0495588_0206559
1258 Ga0495599_0001568
1259 Ga0495599_0065943
1260 Ga0495599_0115480
1261 Ga0495623_0013341
1262 Ga0495646_0002710
1263 Ga0495646_0013730
1264 Ga0495647_0077363
1265 Ga0495669_0070630
1266 Ga0495669_0164057
1267 Ga0495613_0007791
1268 Ga0495613_0018119
1269 Ga0495613_0210825
1270 Ga0495624_0008165
1271 Ga0495624_0038909
1272 Ga0495624_0334631
1273 Ga0495589_0003652
1274 Ga0495589_0164701
1275 Ga0495600_0032705
1276 Ga0495600_0187882
1277 Ga0495600_0209076
1278 Ga0495581_0018324
1279 Ga0495581_0118021
1280 Ga0495581_0183659
1281 Ga0495604_0002942
1282 Ga0495604_0009426
1283 Ga0495604_0318194
1284 Ga0495676_0001071
1285 Ga0495676_0039784
1286 Ga0495683_0003201
1287 Ga0495675_0011606
1288 Ga0495675_0020720
1289 Ga0495679_000779
1290 Ga0495679_002600
1291 Ga0495673_0007278
1292 Ga0495684_0050780
1293 Ga0495684_0055359
1294 Ga0495593_0002822
1295 Ga0495602_0009355
1296 Ga0495614_0005059
1297 Ga0495614_0031441
1298 Ga0496100_0165235
1299 Ga0496101_0020052
1300 Ga0496101_0258191
1301 Ga0496102_0440351
1302 Ga0496102_0573227
1303 Ga0496104_0087986
1304 Ga0496104_0183316
1305 Ga0496106_0032389
1306 Ga0496109_0049331
1307 Ga0496109_0056901
1308 Ga0496109_0107934
1309 Ga0496110_0020659
1310 Ga0496110_0090527
1311 Ga0496111_0006924
1312 Ga0496112_0115957
1313 Ga0496113_0522338
1314 Ga0496114_0280052
1315 Ga0496114_0340839
1316 Ga0496114_0361649
1317 Ga0495682_0018792
1318 Ga0501032_0017247
1319 Ga0501033_0035714
1320 Ga0501036_0007866
1321 Ga0501036_0065758
1322 Ga0501038_0003668
1323 Ga0501038_0084562
1324 Ga0501038_0106006
1325 Ga0501039_0001562
1326 Ga0501039_0047098
1327 Ga0501040_0015383
1328 Ga0501040_0163812
1329 Ga0501041_0001011
1330 Ga0501041_0057151
1331 Ga0501041_0395401
1332 Ga0501042_0039819
1333 Ga0501042_0053848
1334 Ga0501042_0060067
1335 Ga0501046_0004984
1336 Ga0501046_0254960
1337 Ga0501047_0374780
1338 Ga0501048_0011295
1339 Ga0501048_0035915
1340 Ga0501048_0044988
1341 Ga0501068_0008951
1342 Ga0501068_0162776
1343 Ga0501068_0169579
1344 Ga0501070_0132021
1345 Ga0501070_0282961
1346 Ga0501071_0035377
1347 Ga0501071_0067054
1348 Ga0501071_0122995
1349 Ga0501072_0005478
1350 Ga0501072_0069343
1351 Ga0501072_0072042
1352 Ga0501073_0181413
1353 Ga0501074_0005048
1354 Ga0501075_0005668
1355 Ga0501075_0039930
1356 Ga0501075_0073734
1357 Ga0501075_0143419
1358 Ga0501076_0001436
1359 Ga0501076_0002047
1360 Ga0501076_0013487
1361 Ga0501077_0004033
1362 Ga0501077_0012140
1363 Ga0501077_0040797
1364 Ga0501077_0153038
1365 Ga0501077_0173872
1366 Ga0501079_0002347
1367 Ga0501079_0004425
1368 Ga0501079_0143904
1369 Ga0501080_0012507
1370 Ga0501080_0042958
1371 Ga0501080_0173528
1372 Ga0501081_0001544
1373 Ga0501081_0084564
1374 Ga0501081_0090190
1375 Ga0501081_0141157
1376 Ga0501083_0301049
1377 Ga0501035_0169346
1378 Ga0501044_0119867
1379 Ga0501045_0000154
1380 Ga0501045_0004902
1381 Ga0501045_0086739
1382 nmdc:mga05p37_209379_c1
1383 nmdc:mga09592_52191_c1
1384 nmdc:mga08y16_103252_c1
1385 nmdc:mga08y16_140699_c1
1386 nmdc:mga08y16_333271_c1
1387 nmdc:mga08y16_48667_c1
1388 nmdc:mga08y16_599371_c1
1389 nmdc:mga0rr50_280761_c1
1390 nmdc:mga0rr50_482022_c1
1391 nmdc:mga08x19_132957_c1
1392 nmdc:mga0a205_90523_c1
1393 Ga0495595_0063276
1394 Ga0495595_0127589
1395 Ga0495619_0158128
1396 Ga0501084_0003310
1397 Ga0501084_0139082
1398 Ga0501084_0267924
1399 Ga0501082_0003385
1400 Ga0501082_0004068
1401 Ga0501082_0067389
1402 Ga0501082_0203547
1403 Ga0530510_0001503
1404 Ga0530510_0005497
1405 Ga0530510_0050887
1406 2514044280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09865

DUF2092

Predicted periplasmic protein (DUF2092)

66

277

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g4y-assembly1.cif.gz_A structure of znrf3 ecd bound to peptide mk1-3.6.10 0.7719 59 85
8ew0-assembly1.cif.gz_E cryo-em structure of glutamate dehydrogenase frozen at various temperature 0.7421 61 90
8ew0-assembly1.cif.gz_B cryo-em structure of glutamate dehydrogenase frozen at various temperature 0.7297 61 90
8ew0-assembly1.cif.gz_F cryo-em structure of glutamate dehydrogenase frozen at various temperature 0.7255 61 90
1nr1-assembly1.cif.gz_F crystal structure of the r463a mutant of human glutamate dehydrogenase 0.7125 61 90
ID Description Score Start End Superfamily
af_F1R4Q5_31_521_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7832 179 214 3.40.720.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7755 42 248 2.50.20.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7463 42 248 2.50.20.10
af_Q8LSQ2_65_122_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6824 61 88 2.40.50.40
af_Q4DFP6_3_162_3.30.1460.50 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.6801 59 99 3.30.1460.50
ID Description Score Start End GO Terms
AF-K4Q2Y9-F1-model_v4 Probable periplasmic protein (Putative periplasmic protein) 0.9635 48 255
AF-K4Q2Y9-F1-model_v4 Probable periplasmic protein (Putative periplasmic protein) 0.9546 48 255
AF-A0A0Q7UEE3-F1-model_v4 DUF2092 domain-containing protein 0.9439 37 254
AF-A0A1I4SH43-F1-model_v4 DUF2092 domain-containing protein 0.9387 48 254
AF-A0A7V7TVV5-F1-model_v4 DUF2092 domain-containing protein 0.937 36 255

Map