F476203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 250 | 702 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10000154|Ga0070709_1000015418 |
| Length | 341 |
| Sequence | MAQNPAATDPGAGGHAAASGGAEPRHGLRLLLMWIPLSAAAILIIWFVWYPHLPPGRMSDAASGQQFDIAVLAVTAAPVVIGVLLYMIYAIVVWRARPGDEGDGPPIHGHTKVQAWWIIITSLVVLWAFAFGTYQLAQPGGAGGGQGPSPIWPLHGAQTTAWSPSSNDMLQVQVIGQQWAFTYRFPQFGGMESTMLELPNNMPVEFHVTSLDVIHSFWAYQLGVKADANPQVDNIAYVKPHQLGSFVVRCNELCGFWHAAMFNYGRVVTPTAFQGWARSLQLKELRAGVLAALPPYALTYDPTVIPQLGRDIVKVAGITGANGYYYPGPQAGTPHGDPVSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 78 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 | Metagenome | Unclassified |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 133 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 153 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.98 |
| Rhizosphere | 90.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10219132 | 3300005327 | Unclassified | 1609 |
| 2 | Ga0070683_100383221 | 3300005329 | Bacteria | 1340 |
| 3 | Ga0070682_100054068 | 3300005337 | Bacteria | 2518 |
| 4 | Ga0068868_100140033 | 3300005338 | Bacteria | 1985 |
| 5 | Ga0068868_100185278 | 3300005338 | Bacteria | 1729 |
| 6 | Ga0068868_100275250 | 3300005338 | Unclassified | 1423 |
| 7 | Ga0070687_100163035 | 3300005343 | Bacteria | 1319 |
| 8 | Ga0070671_100060210 | 3300005355 | Bacteria | 3161 |
| 9 | Ga0070673_100208795 | 3300005364 | Unclassified | 1685 |
| 10 | Ga0070709_10000154 | 3300005434 | Bacteria | 45206 |
| 11 | Ga0070709_10001842 | 3300005434 | Bacteria | 11499 |
| 12 | Ga0070709_10015096 | 3300005434 | Bacteria | 4388 |
| 13 | Ga0070709_10039750 | 3300005434 | Bacteria | 2888 |
| 14 | Ga0070709_10204086 | 3300005434 | Bacteria | 1401 |
| 15 | Ga0070714_100000250 | 3300005435 | Bacteria | 41973 |
| 16 | Ga0070714_100006056 | 3300005435 | Bacteria | 9285 |
| 17 | Ga0070714_100008242 | 3300005435 | Bacteria | 8124 |
| 18 | Ga0070714_100029642 | 3300005435 | Bacteria | 4549 |
| 19 | Ga0070714_100034292 | 3300005435 | Bacteria | 4250 |
| 20 | Ga0070714_100079839 | 3300005435 | Bacteria | 2845 |
| 21 | Ga0070714_100084343 | 3300005435 | Bacteria | 2772 |
| 22 | Ga0070714_100142812 | 3300005435 | Bacteria | 2150 |
| 23 | Ga0070714_100155112 | 3300005435 | Unclassified | 2066 |
| 24 | Ga0070713_100000392 | 3300005436 | Bacteria | 28109 |
| 25 | Ga0070713_100006439 | 3300005436 | Bacteria | 8143 |
| 26 | Ga0070713_100033666 | 3300005436 | Bacteria | 4107 |
| 27 | Ga0070713_100036237 | 3300005436 | Bacteria | 3980 |
| 28 | Ga0070713_100046325 | 3300005436 | Bacteria | 3567 |
| 29 | Ga0070713_100094123 | 3300005436 | Bacteria | 2582 |
| 30 | Ga0070713_100129657 | 3300005436 | Unclassified | 2222 |
| 31 | Ga0070713_100174758 | 3300005436 | Bacteria | 1926 |
| 32 | Ga0070710_10001998 | 3300005437 | Bacteria | 9666 |
| 33 | Ga0070710_10002857 | 3300005437 | Bacteria | 8228 |
| 34 | Ga0070710_10022953 | 3300005437 | Bacteria | 3272 |
| 35 | Ga0070711_100004404 | 3300005439 | Bacteria | 8309 |
| 36 | Ga0070711_100017584 | 3300005439 | Bacteria | 4555 |
| 37 | Ga0070711_100047566 | 3300005439 | Bacteria | 2929 |
| 38 | Ga0070711_100099795 | 3300005439 | Bacteria | 2110 |
| 39 | Ga0070711_100108650 | 3300005439 | Bacteria | 2032 |
| 40 | Ga0070705_100052232 | 3300005440 | Bacteria | 2387 |
| 41 | Ga0070700_100037831 | 3300005441 | Bacteria | 2937 |
| 42 | Ga0070708_100006382 | 3300005445 | Bacteria | 9391 |
| 43 | Ga0070708_100464717 | 3300005445 | Bacteria | 1194 |
| 44 | Ga0070681_10362988 | 3300005458 | Bacteria | 1359 |
| 45 | Ga0070685_10076248 | 3300005466 | Unclassified | 1999 |
| 46 | Ga0070706_100013788 | 3300005467 | Bacteria | 7475 |
| 47 | Ga0070706_100024074 | 3300005467 | Bacteria | 5606 |
| 48 | Ga0070706_100041618 | 3300005467 | Bacteria | 4242 |
| 49 | Ga0070706_100082273 | 3300005467 | Bacteria | 2982 |
| 50 | Ga0070706_100117356 | 3300005467 | Bacteria | 2479 |
| 51 | Ga0070706_100178783 | 3300005467 | Unclassified | 1981 |
| 52 | Ga0070706_100197160 | 3300005467 | Bacteria | 1881 |
| 53 | Ga0070707_100002470 | 3300005468 | Bacteria | 17623 |
| 54 | Ga0070707_100007193 | 3300005468 | Bacteria | 10320 |
| 55 | Ga0070707_100029449 | 3300005468 | Bacteria | 5227 |
| 56 | Ga0070707_100060607 | 3300005468 | Bacteria | 3629 |
| 57 | Ga0070698_100000052 | 3300005471 | Bacteria | 82128 |
| 58 | Ga0070698_100001531 | 3300005471 | Bacteria | 25679 |
| 59 | Ga0070698_100003355 | 3300005471 | Bacteria | 17623 |
| 60 | Ga0070698_100062705 | 3300005471 | Bacteria | 3750 |
| 61 | Ga0070698_100073638 | 3300005471 | Bacteria | 3421 |
| 62 | Ga0070698_100079619 | 3300005471 | Bacteria | 3273 |
| 63 | Ga0070698_100080388 | 3300005471 | Bacteria | 3254 |
| 64 | Ga0070698_100245607 | 3300005471 | Bacteria | 1723 |
| 65 | Ga0070698_100392409 | 3300005471 | Bacteria | 1321 |
| 66 | Ga0070699_100000680 | 3300005518 | Bacteria | 31757 |
| 67 | Ga0070679_100017200 | 3300005530 | Bacteria | 6995 |
| 68 | Ga0070679_100490584 | 3300005530 | Bacteria | 1173 |
| 69 | Ga0070684_100211824 | 3300005535 | Bacteria | 1766 |
| 70 | Ga0068853_100021702 | 3300005539 | Bacteria | 5357 |
| 71 | Ga0070686_100327818 | 3300005544 | Bacteria | 1143 |
| 72 | Ga0070693_100049804 | 3300005547 | Bacteria | 2391 |
| 73 | Ga0070665_100351019 | 3300005548 | Bacteria | 1480 |
| 74 | Ga0068855_100282024 | 3300005563 | Unclassified | 1844 |
| 75 | Ga0068855_100341577 | 3300005563 | Unclassified | 1651 |
| 76 | Ga0068857_100060034 | 3300005577 | Bacteria | 3378 |
| 77 | Ga0068857_100163977 | 3300005577 | Bacteria | 2017 |
| 78 | Ga0068854_100037719 | 3300005578 | Bacteria | 3394 |
| 79 | Ga0068856_100002953 | 3300005614 | Bacteria | 17432 |
| 80 | Ga0068856_100024199 | 3300005614 | Bacteria | 5908 |
| 81 | Ga0068856_100071590 | 3300005614 | Bacteria | 3432 |
| 82 | Ga0068856_100233339 | 3300005614 | Bacteria | 1855 |
| 83 | Ga0070702_100006338 | 3300005615 | Bacteria | 5594 |
| 84 | Ga0068859_100161621 | 3300005617 | Unclassified | 2318 |
| 85 | Ga0068859_100502730 | 3300005617 | Bacteria | 1307 |
| 86 | Ga0068864_100052245 | 3300005618 | Bacteria | 3522 |
| 87 | Ga0068861_100187713 | 3300005719 | Bacteria | 1725 |
| 88 | Ga0068870_10020961 | 3300005840 | Bacteria | 3190 |
| 89 | Ga0068863_100074456 | 3300005841 | Bacteria | 3212 |
| 90 | Ga0068863_100322229 | 3300005841 | Bacteria | 1501 |
| 91 | Ga0068858_100108159 | 3300005842 | Bacteria | 2596 |
| 92 | Ga0068858_100404975 | 3300005842 | Bacteria | 1311 |
| 93 | Ga0068860_100040221 | 3300005843 | Bacteria | 4470 |
| 94 | Ga0070717_10000872 | 3300006028 | Bacteria | 19951 |
| 95 | Ga0070717_10003603 | 3300006028 | Bacteria | 11108 |
| 96 | Ga0070717_10004576 | 3300006028 | Bacteria | 10014 |
| 97 | Ga0070717_10006492 | 3300006028 | Bacteria | 8609 |
| 98 | Ga0070717_10021020 | 3300006028 | Bacteria | 5142 |
| 99 | Ga0070717_10024868 | 3300006028 | Bacteria | 4758 |
| 100 | Ga0070717_10047421 | 3300006028 | Bacteria | 3520 |
| 101 | Ga0070717_10107040 | 3300006028 | Bacteria | 2381 |
| 102 | Ga0070717_10137478 | 3300006028 | Unclassified | 2105 |
| 103 | Ga0070717_10209736 | 3300006028 | Bacteria | 1709 |
| 104 | Ga0070715_10005103 | 3300006163 | Bacteria | 4357 |
| 105 | Ga0070715_10010248 | 3300006163 | Bacteria | 3335 |
| 106 | Ga0070715_10013460 | 3300006163 | Bacteria | 3006 |
| 107 | Ga0070716_100000326 | 3300006173 | Bacteria | 19254 |
| 108 | Ga0070716_100009787 | 3300006173 | Bacteria | 4791 |
| 109 | Ga0070716_100017430 | 3300006173 | Bacteria | 3723 |
| 110 | Ga0070716_100040838 | 3300006173 | Unclassified | 2582 |
| 111 | Ga0070712_100001194 | 3300006175 | Bacteria | 15695 |
| 112 | Ga0070712_100099026 | 3300006175 | Bacteria | 2151 |
| 113 | Ga0070712_100157010 | 3300006175 | Bacteria | 1753 |
| 114 | Ga0070712_100186137 | 3300006175 | Unclassified | 1621 |
| 115 | Ga0070712_100319642 | 3300006175 | Unclassified | 1262 |
| 116 | Ga0070712_100390879 | 3300006175 | Bacteria | 1147 |
| 117 | Ga0097621_100015595 | 3300006237 | Bacteria | 5724 |
| 118 | Ga0068871_100139639 | 3300006358 | Bacteria | 2060 |
| 119 | Ga0068871_100150648 | 3300006358 | Bacteria | 1983 |
| 120 | Ga0068871_100180451 | 3300006358 | Bacteria | 1814 |
| 121 | Ga0075428_100051308 | 3300006844 | Bacteria | 4524 |
| 122 | Ga0075433_10002240 | 3300006852 | Bacteria | 14680 |
| 123 | Ga0075433_10055501 | 3300006852 | Bacteria | 3458 |
| 124 | Ga0075434_100059863 | 3300006871 | Bacteria | 3787 |
| 125 | Ga0075434_100080133 | 3300006871 | Unclassified | 3261 |
| 126 | Ga0075434_100238577 | 3300006871 | Unclassified | 1838 |
| 127 | Ga0075429_100319387 | 3300006880 | Unclassified | 1359 |
| 128 | Ga0075436_100050415 | 3300006914 | Bacteria | 2872 |
| 129 | Ga0097620_100161632 | 3300006931 | Unclassified | 2318 |
| 130 | Ga0097620_100502733 | 3300006931 | Bacteria | 1307 |
| 131 | Ga0105240_10004674 | 3300009093 | Bacteria | 20698 |
| 132 | Ga0105240_10132544 | 3300009093 | Unclassified | 2987 |
| 133 | Ga0105240_10139607 | 3300009093 | Bacteria | 2898 |
| 134 | Ga0105245_10131097 | 3300009098 | Bacteria | 2351 |
| 135 | Ga0105245_10500529 | 3300009098 | Bacteria | 1231 |
| 136 | Ga0105247_10027574 | 3300009101 | Bacteria | 3433 |
| 137 | Ga0105247_10237233 | 3300009101 | Bacteria | 1241 |
| 138 | Ga0114129_10003946 | 3300009147 | Bacteria | 20939 |
| 139 | Ga0114129_10343872 | 3300009147 | Unclassified | 1978 |
| 140 | Ga0105243_10321718 | 3300009148 | Bacteria | 1410 |
| 141 | Ga0105242_10081715 | 3300009176 | Bacteria | 2703 |
| 142 | Ga0105248_10477006 | 3300009177 | Bacteria | 1406 |
| 143 | Ga0105237_10079901 | 3300009545 | Bacteria | 3260 |
| 144 | Ga0105237_10478340 | 3300009545 | Bacteria | 1252 |
| 145 | Ga0105238_10062516 | 3300009551 | Bacteria | 3724 |
| 146 | Ga0105238_10499540 | 3300009551 | Bacteria | 1217 |
| 147 | Ga0105239_10038464 | 3300010375 | Bacteria | 5243 |
| 148 | Ga0105246_10027214 | 3300011119 | Bacteria | 3744 |
| 149 | Ga0157373_10038638 | 3300013100 | Bacteria | 3420 |
| 150 | Ga0157371_10164054 | 3300013102 | Bacteria | 1587 |
| 151 | Ga0157369_10050496 | 3300013105 | Unclassified | 4504 |
| 152 | Ga0157369_10066884 | 3300013105 | Bacteria | 3866 |
| 153 | Ga0157374_10122690 | 3300013296 | Bacteria | 2509 |
| 154 | Ga0157378_10152203 | 3300013297 | Bacteria | 2156 |
| 155 | Ga0163162_10133087 | 3300013306 | Bacteria | 2596 |
| 156 | Ga0157372_10089926 | 3300013307 | Bacteria | 3489 |
| 157 | Ga0157375_10068029 | 3300013308 | Bacteria | 3561 |
| 158 | Ga0157375_10408137 | 3300013308 | Bacteria | 1525 |
| 159 | Ga0163163_10014804 | 3300014325 | Bacteria | 7180 |
| 160 | Ga0163163_10270409 | 3300014325 | Unclassified | 1751 |
| 161 | Ga0157377_10065297 | 3300014745 | Bacteria | 2090 |
| 162 | Ga0157379_10437337 | 3300014968 | Bacteria | 1206 |
| 163 | Ga0206351_10712940 | 3300020077 | Unclassified | 2254 |
| 164 | Ga0206354_10140575 | 3300020081 | Bacteria | 1734 |
| 165 | Ga0206354_10185635 | 3300020081 | Archaea | 1303 |
| 166 | Ga0206353_10226583 | 3300020082 | Unclassified | 2094 |
| 167 | Ga0213875_10009737 | 3300021388 | Bacteria | 4850 |
| 168 | Ga0213875_10014031 | 3300021388 | Bacteria | 3919 |
| 169 | Ga0224712_10009118 | 3300022467 | Unclassified | 2975 |
| 170 | Ga0224712_10021828 | 3300022467 | Unclassified | 2197 |
| 171 | Ga0224712_10059808 | 3300022467 | Archaea | 1514 |
| 172 | Ga0207692_10000150 | 3300025898 | Bacteria | 21932 |
| 173 | Ga0207692_10001454 | 3300025898 | Bacteria | 8861 |
| 174 | Ga0207692_10016652 | 3300025898 | Bacteria | 3261 |
| 175 | Ga0207692_10073866 | 3300025898 | Bacteria | 1805 |
| 176 | Ga0207692_10203048 | 3300025898 | Unclassified | 1166 |
| 177 | Ga0207688_10005389 | 3300025901 | Bacteria | 6952 |
| 178 | Ga0207688_10009340 | 3300025901 | Bacteria | 5346 |
| 179 | Ga0207685_10022255 | 3300025905 | Unclassified | 2139 |
| 180 | Ga0207699_10000205 | 3300025906 | Bacteria | 35487 |
| 181 | Ga0207699_10001649 | 3300025906 | Bacteria | 10575 |
| 182 | Ga0207699_10006888 | 3300025906 | Bacteria | 5528 |
| 183 | Ga0207699_10066224 | 3300025906 | Bacteria | 2192 |
| 184 | Ga0207699_10132172 | 3300025906 | Bacteria | 1629 |
| 185 | Ga0207643_10014378 | 3300025908 | Bacteria | 4298 |
| 186 | Ga0207643_10016674 | 3300025908 | Bacteria | 4007 |
| 187 | Ga0207705_10294298 | 3300025909 | Unclassified | 1244 |
| 188 | Ga0207684_10001231 | 3300025910 | Bacteria | 28443 |
| 189 | Ga0207684_10003550 | 3300025910 | Bacteria | 15192 |
| 190 | Ga0207684_10047080 | 3300025910 | Bacteria | 3658 |
| 191 | Ga0207684_10065876 | 3300025910 | Bacteria | 3076 |
| 192 | Ga0207684_10148743 | 3300025910 | Bacteria | 2015 |
| 193 | Ga0207654_10103334 | 3300025911 | Bacteria | 1759 |
| 194 | Ga0207654_10190410 | 3300025911 | Bacteria | 1344 |
| 195 | Ga0207707_10123833 | 3300025912 | Unclassified | 2261 |
| 196 | Ga0207707_10206896 | 3300025912 | Bacteria | 1710 |
| 197 | Ga0207695_10002407 | 3300025913 | Bacteria | 27694 |
| 198 | Ga0207671_10009587 | 3300025914 | Bacteria | 8070 |
| 199 | Ga0207693_10000355 | 3300025915 | Bacteria | 42002 |
| 200 | Ga0207693_10001823 | 3300025915 | Bacteria | 18689 |
| 201 | Ga0207693_10003373 | 3300025915 | Bacteria | 13639 |
| 202 | Ga0207693_10013139 | 3300025915 | Bacteria | 6679 |
| 203 | Ga0207693_10015224 | 3300025915 | Bacteria | 6173 |
| 204 | Ga0207693_10033669 | 3300025915 | Bacteria | 4042 |
| 205 | Ga0207693_10273891 | 3300025915 | Bacteria | 1323 |
| 206 | Ga0207693_10426998 | 3300025915 | Bacteria | 1036 |
| 207 | Ga0207693_10453916 | 3300025915 | Bacteria | 1001 |
| 208 | Ga0207663_10018192 | 3300025916 | Bacteria | 3932 |
| 209 | Ga0207663_10024199 | 3300025916 | Bacteria | 3495 |
| 210 | Ga0207663_10024217 | 3300025916 | Bacteria | 3494 |
| 211 | Ga0207663_10067652 | 3300025916 | Bacteria | 2291 |
| 212 | Ga0207663_10107367 | 3300025916 | Bacteria | 1888 |
| 213 | Ga0207663_10397783 | 3300025916 | Bacteria | 1053 |
| 214 | Ga0207657_10001310 | 3300025919 | Bacteria | 26403 |
| 215 | Ga0207649_10067066 | 3300025920 | Unclassified | 2277 |
| 216 | Ga0207646_10000410 | 3300025922 | Bacteria | 57510 |
| 217 | Ga0207646_10005738 | 3300025922 | Bacteria | 13010 |
| 218 | Ga0207646_10029887 | 3300025922 | Bacteria | 4946 |
| 219 | Ga0207646_10039734 | 3300025922 | Bacteria | 4233 |
| 220 | Ga0207646_10210101 | 3300025922 | Unclassified | 1758 |
| 221 | Ga0207694_10055655 | 3300025924 | Bacteria | 3071 |
| 222 | Ga0207687_10000248 | 3300025927 | Bacteria | 36726 |
| 223 | Ga0207700_10006240 | 3300025928 | Bacteria | 7188 |
| 224 | Ga0207700_10007761 | 3300025928 | Bacteria | 6593 |
| 225 | Ga0207700_10008631 | 3300025928 | Bacteria | 6326 |
| 226 | Ga0207700_10009627 | 3300025928 | Bacteria | 6049 |
| 227 | Ga0207700_10031540 | 3300025928 | Bacteria | 3766 |
| 228 | Ga0207700_10034111 | 3300025928 | Bacteria | 3650 |
| 229 | Ga0207700_10080243 | 3300025928 | Unclassified | 2544 |
| 230 | Ga0207700_10143566 | 3300025928 | Unclassified | 1964 |
| 231 | Ga0207700_10350729 | 3300025928 | Bacteria | 1285 |
| 232 | Ga0207664_10001022 | 3300025929 | Bacteria | 18759 |
| 233 | Ga0207664_10001579 | 3300025929 | Bacteria | 14967 |
| 234 | Ga0207664_10002889 | 3300025929 | Bacteria | 11433 |
| 235 | Ga0207664_10003303 | 3300025929 | Bacteria | 10729 |
| 236 | Ga0207664_10003313 | 3300025929 | Bacteria | 10713 |
| 237 | Ga0207664_10016279 | 3300025929 | Bacteria | 5422 |
| 238 | Ga0207664_10017269 | 3300025929 | Bacteria | 5286 |
| 239 | Ga0207664_10021472 | 3300025929 | Bacteria | 4802 |
| 240 | Ga0207664_10051601 | 3300025929 | Bacteria | 3249 |
| 241 | Ga0207664_10145961 | 3300025929 | Unclassified | 2006 |
| 242 | Ga0207664_10481950 | 3300025929 | Bacteria | 1110 |
| 243 | Ga0207644_10128498 | 3300025931 | Bacteria | 1937 |
| 244 | Ga0207690_10009338 | 3300025932 | Bacteria | 5826 |
| 245 | Ga0207706_10008680 | 3300025933 | Bacteria | 9360 |
| 246 | Ga0207670_10040413 | 3300025936 | Bacteria | 3061 |
| 247 | Ga0207704_10021420 | 3300025938 | Bacteria | 3443 |
| 248 | Ga0207665_10000480 | 3300025939 | Bacteria | 27050 |
| 249 | Ga0207665_10000820 | 3300025939 | Bacteria | 21046 |
| 250 | Ga0207665_10004211 | 3300025939 | Bacteria | 9575 |
| 251 | Ga0207665_10015042 | 3300025939 | Bacteria | 5081 |
| 252 | Ga0207665_10078040 | 3300025939 | Bacteria | 2274 |
| 253 | Ga0207711_10196810 | 3300025941 | Unclassified | 1838 |
| 254 | Ga0207689_10012065 | 3300025942 | Bacteria | 7403 |
| 255 | Ga0207689_10143764 | 3300025942 | Bacteria | 1965 |
| 256 | Ga0207667_10059573 | 3300025949 | Bacteria | 3998 |
| 257 | Ga0207640_10185389 | 3300025981 | Bacteria | 1564 |
| 258 | Ga0207677_10073746 | 3300026023 | Bacteria | 2418 |
| 259 | Ga0207677_10185444 | 3300026023 | Bacteria | 1640 |
| 260 | Ga0207703_10069611 | 3300026035 | Bacteria | 2902 |
| 261 | Ga0207678_10002951 | 3300026067 | Bacteria | 15407 |
| 262 | Ga0207678_10026431 | 3300026067 | Bacteria | 5063 |
| 263 | Ga0207708_10029372 | 3300026075 | Bacteria | 4167 |
| 264 | Ga0207702_10005745 | 3300026078 | Bacteria | 10805 |
| 265 | Ga0207702_10425031 | 3300026078 | Bacteria | 1285 |
| 266 | Ga0207641_10057581 | 3300026088 | Bacteria | 3305 |
| 267 | Ga0207641_10096417 | 3300026088 | Unclassified | 2598 |
| 268 | Ga0207641_10214251 | 3300026088 | Bacteria | 1783 |
| 269 | Ga0207641_10288278 | 3300026088 | Bacteria | 1547 |
| 270 | Ga0207648_10072108 | 3300026089 | Bacteria | 3010 |
| 271 | Ga0207676_10037130 | 3300026095 | Bacteria | 3711 |
| 272 | Ga0207674_10008764 | 3300026116 | Bacteria | 11646 |
| 273 | Ga0207674_10037897 | 3300026116 | Bacteria | 5009 |
| 274 | Ga0207674_10120370 | 3300026116 | Bacteria | 2593 |
| 275 | Ga0207675_100008580 | 3300026118 | Bacteria | 9613 |
| 276 | Ga0207683_10006285 | 3300026121 | Bacteria | 10180 |
| 277 | Ga0207698_10017520 | 3300026142 | Bacteria | 4862 |
| 278 | Ga0207698_10026148 | 3300026142 | Bacteria | 4125 |
| 279 | Ga0207428_10011845 | 3300027907 | Bacteria | 7683 |
| 280 | Ga0224573_1002200 | 3300028019 | Bacteria | 1488 |
| 281 | Ga0268266_10096904 | 3300028379 | Bacteria | 2594 |
| 282 | Ga0268266_10712342 | 3300028379 | Bacteria | 968 |
| 283 | Ga0265337_1001444 | 3300028556 | Bacteria | 11683 |
| 284 | Ga0265326_10000206 | 3300028558 | Bacteria | 29334 |
| 285 | Ga0265319_1001776 | 3300028563 | Bacteria | 12354 |
| 286 | Ga0265318_10000927 | 3300028577 | Bacteria | 18982 |
| 287 | Ga0265322_10009353 | 3300028654 | Bacteria | 2844 |
| 288 | Ga0265336_10000049 | 3300028666 | Bacteria | 120719 |
| 289 | Ga0265336_10022334 | 3300028666 | Bacteria | 2014 |
| 290 | Ga0265338_10000046 | 3300028800 | Bacteria | 223068 |
| 291 | Ga0265338_10011760 | 3300028800 | Bacteria | 10064 |
| 292 | Ga0265338_10020419 | 3300028800 | Bacteria | 6966 |
| 293 | Ga0265338_10023545 | 3300028800 | Bacteria | 6328 |
| 294 | Ga0265338_10143514 | 3300028800 | Bacteria | 1866 |
| 295 | Ga0265324_10001396 | 3300029957 | Bacteria | 13944 |
| 296 | Ga0265325_10028097 | 3300031241 | Bacteria | 3035 |
| 297 | Ga0265340_10000003 | 3300031247 | Bacteria | 320583 |
| 298 | Ga0265340_10029548 | 3300031247 | Bacteria | 2752 |
| 299 | Ga0265339_10099968 | 3300031249 | Unclassified | 1511 |
| 300 | Ga0265327_10007884 | 3300031251 | Bacteria | 8072 |
| 301 | Ga0265316_10191254 | 3300031344 | Bacteria | 1520 |
| 302 | Ga0265316_10274304 | 3300031344 | Bacteria | 1234 |
| 303 | Ga0265314_10042959 | 3300031711 | Bacteria | 3219 |
| 304 | Ga0373948_0010383 | 3300034817 | Bacteria | 1625 |
| 305 | Ga0373926_0001318 | 3300035083 | Bacteria | 7492 |
| 306 | Ga0373928_0041706 | 3300035084 | Bacteria | 1056 |
| 307 | Ga0373934_0000291 | 3300035086 | Bacteria | 17907 |
| 308 | Ga0373934_0007668 | 3300035086 | Bacteria | 4009 |
| 309 | Ga0373934_0012865 | 3300035086 | Bacteria | 3162 |
| 310 | Ga0373934_0048968 | 3300035086 | Bacteria | 1673 |
| 311 | Ga0373934_0053390 | 3300035086 | Unclassified | 1603 |
| 312 | Ga0373940_0017042 | 3300035088 | Bacteria | 1808 |
| 313 | Ga0373944_0000911 | 3300035089 | Bacteria | 7299 |
| 314 | Ga0373944_0003180 | 3300035089 | Bacteria | 4226 |
| 315 | Ga0373944_0020527 | 3300035089 | Bacteria | 1904 |
| 316 | Ga0373952_0013920 | 3300035092 | Unclassified | 1603 |
| 317 | Ga0373923_0019629 | 3300035111 | Bacteria | 2619 |
| 318 | Ga0373923_0021064 | 3300035111 | Bacteria | 2540 |
| 319 | Ga0373932_0051135 | 3300035112 | Bacteria | 1227 |
| 320 | Ga0373936_0000278 | 3300035113 | Bacteria | 17059 |
| 321 | Ga0373936_0009357 | 3300035113 | Bacteria | 3693 |
| 322 | Ga0373936_0040784 | 3300035113 | Unclassified | 1861 |
| 323 | Ga0373936_0063976 | 3300035113 | Unclassified | 1506 |
| 324 | Ga0373945_0005152 | 3300035116 | Bacteria | 4175 |
| 325 | Ga0373945_0069969 | 3300035116 | Bacteria | 1326 |
| 326 | Ga0373953_0001302 | 3300035117 | Bacteria | 7142 |
| 327 | Ga0373953_0002922 | 3300035117 | Bacteria | 5221 |
| 328 | Ga0373954_0013242 | 3300035118 | Bacteria | 3674 |
| 329 | Ga0373954_0015957 | 3300035118 | Bacteria | 3359 |
| 330 | Ga0373954_0038183 | 3300035118 | Bacteria | 2233 |
| 331 | Ga0373954_0039507 | 3300035118 | Bacteria | 2197 |
| 332 | Ga0373956_0011541 | 3300035119 | Bacteria | 3644 |
| 333 | Ga0373956_0018153 | 3300035119 | Bacteria | 2975 |
| 334 | Ga0373956_0108425 | 3300035119 | Unclassified | 1291 |
| 335 | Ga0373957_0048340 | 3300035120 | Bacteria | 1621 |
| 336 | Ga0373957_0048751 | 3300035120 | Bacteria | 1615 |
| 337 | Ga0373957_0073857 | 3300035120 | Bacteria | 1338 |
| 338 | Ga0373943_0000119 | 3300035170 | Bacteria | 29368 |
| 339 | Ga0373943_0005908 | 3300035170 | Bacteria | 5493 |
| 340 | Ga0373943_0226833 | 3300035170 | Unclassified | 1042 |
| 341 | Ga0373946_0006354 | 3300035171 | Bacteria | 4284 |
| 342 | Ga0373946_0016025 | 3300035171 | Unclassified | 2850 |
| 343 | Ga0373955_0000058 | 3300035172 | Bacteria | 43267 |
| 344 | Ga0373955_0125610 | 3300035172 | Unclassified | 1494 |
| 345 | Ga0373942_0031515 | 3300035207 | Unclassified | 1402 |
| 346 | Ga0373961_0007010 | 3300035241 | Bacteria | 2714 |
| 347 | Ga0373961_0013273 | 3300035241 | Bacteria | 2075 |
| 348 | Ga0373924_0000761 | 3300035410 | Bacteria | 10013 |
| 349 | Ga0373924_0004232 | 3300035410 | Bacteria | 5000 |
| 350 | Ga0373924_0016732 | 3300035410 | Bacteria | 2803 |
| 351 | Ga0373935_0005380 | 3300035692 | Bacteria | 7546 |
| 352 | Ga0373935_0005652 | 3300035692 | Bacteria | 7379 |
| 353 | Ga0373935_0007190 | 3300035692 | Bacteria | 6649 |
| 354 | Ga0373935_0024881 | 3300035692 | Bacteria | 3688 |
| 355 | Ga0373935_0031617 | 3300035692 | Bacteria | 3286 |
| 356 | Ga0373935_0083509 | 3300035692 | Unclassified | 2079 |
| 357 | Ga0373935_0166036 | 3300035692 | Bacteria | 1507 |
| 358 | Ga0373935_0176487 | 3300035692 | Bacteria | 1464 |
| 359 | Ga0373927_0000726 | 3300035695 | Bacteria | 25216 |
| 360 | Ga0373927_0014004 | 3300035695 | Bacteria | 5316 |
| 361 | Ga0373927_0091246 | 3300035695 | Bacteria | 1978 |
| 362 | Ga0373933_0000046 | 3300035724 | Bacteria | 76647 |
| 363 | Ga0373933_0000803 | 3300035724 | Bacteria | 19135 |
| 364 | Ga0373933_0010382 | 3300035724 | Bacteria | 5104 |
| 365 | Ga0373933_0106653 | 3300035724 | Bacteria | 1743 |
| 366 | Ga0373933_0115167 | 3300035724 | Bacteria | 1680 |
| 367 | Ga0373947_0000012 | 3300035725 | Bacteria | 155188 |
| 368 | Ga0373947_0000141 | 3300035725 | Bacteria | 37478 |
| 369 | Ga0373947_0029522 | 3300035725 | Bacteria | 3218 |
| 370 | Ga0373947_0072879 | 3300035725 | Unclassified | 2109 |
| 371 | Ga0373947_0135651 | 3300035725 | Bacteria | 1574 |
| 372 | Ga0373937_0000115 | 3300036401 | Bacteria | 76660 |
| 373 | Ga0373937_0000938 | 3300036401 | Bacteria | 24762 |
| 374 | Ga0373937_0147397 | 3300036401 | Bacteria | 2203 |
| 375 | Ga0373937_0154880 | 3300036401 | Bacteria | 2147 |
| 376 | Ga0373937_0365120 | 3300036401 | Unclassified | 1368 |
| 377 | Ga0373925_0001150 | 3300037068 | Bacteria | 23461 |
| 378 | Ga0373925_0008253 | 3300037068 | Bacteria | 7578 |
| 379 | Ga0373925_0022033 | 3300037068 | Bacteria | 4643 |
| 380 | Ga0373925_0035686 | 3300037068 | Bacteria | 3669 |
| 381 | Ga0373925_0162935 | 3300037068 | Unclassified | 1757 |
| 382 | Ga0373925_0167820 | 3300037068 | Bacteria | 1731 |
| 383 | Ga0373925_0245085 | 3300037068 | Bacteria | 1436 |
| 384 | Ga0373925_0427215 | 3300037068 | Unclassified | 1083 |
| 385 | Ga0436364_0074139 | 3300037853 | Bacteria | 2660 |
| 386 | Ga0436364_0747915 | 3300037853 | Bacteria | 4850 |
| 387 | Ga0436364_1050209 | 3300037853 | Bacteria | 3723 |
| 388 | Ga0436365_0875851 | 3300039437 | Unclassified | 1898 |
| 389 | Ga0436365_0960103 | 3300039437 | Unclassified | 1123 |
| 390 | Ga0436363_0403894 | 3300039450 | Bacteria | 7451 |
| 391 | Ga0436363_1128802 | 3300039450 | Unclassified | 2002 |
| 392 | Ga0466969_0101367 | 3300044656 | Unclassified | 1355 |
| 393 | Ga0466965_0073279 | 3300044683 | Bacteria | 1724 |
| 394 | Ga0466966_0008290 | 3300044684 | Bacteria | 6890 |
| 395 | Ga0466966_0101489 | 3300044684 | Unclassified | 1779 |
| 396 | Ga0466961_0100821 | 3300044693 | Bacteria | 1819 |
| 397 | Ga0466963_0002750 | 3300044694 | Bacteria | 9924 |
| 398 | Ga0466963_0031275 | 3300044694 | Bacteria | 3440 |
| 399 | Ga0466963_0062727 | 3300044694 | Bacteria | 2486 |
| 400 | Ga0466963_0140694 | 3300044694 | Bacteria | 1672 |
| 401 | Ga0466971_0015789 | 3300044719 | Bacteria | 3326 |
| 402 | Ga0466970_0018115 | 3300044765 | Unclassified | 3644 |
| 403 | Ga0466957_0003271 | 3300044842 | Bacteria | 8876 |
| 404 | Ga0466957_0036171 | 3300044842 | Unclassified | 2967 |
| 405 | Ga0466957_0125755 | 3300044842 | Bacteria | 1638 |
| 406 | Ga0466959_0019955 | 3300045049 | Bacteria | 4934 |
| 407 | Ga0466958_0001555 | 3300045836 | Bacteria | 10996 |
| 408 | Ga0466958_0023162 | 3300045836 | Bacteria | 3642 |
| 409 | Ga0466958_0067961 | 3300045836 | Bacteria | 2178 |
| 410 | Ga0466958_0200843 | 3300045836 | Bacteria | 1269 |
| 411 | Ga0466967_0093491 | 3300045976 | Bacteria | 2736 |
| 412 | Ga0495592_0001162 | 3300046454 | Bacteria | 18268 |
| 413 | Ga0495592_0006368 | 3300046454 | Bacteria | 8792 |
| 414 | Ga0495592_0046403 | 3300046454 | Bacteria | 3238 |
| 415 | Ga0495592_0071279 | 3300046454 | Unclassified | 2529 |
| 416 | Ga0495629_0001762 | 3300046459 | Bacteria | 16967 |
| 417 | Ga0495629_0048520 | 3300046459 | Unclassified | 2976 |
| 418 | Ga0495629_0081492 | 3300046459 | Bacteria | 2258 |
| 419 | Ga0495641_0005823 | 3300046461 | Bacteria | 8169 |
| 420 | Ga0495641_0008836 | 3300046461 | Bacteria | 6069 |
| 421 | Ga0495651_0000067 | 3300046462 | Bacteria | 76665 |
| 422 | Ga0495651_0003224 | 3300046462 | Bacteria | 12528 |
| 423 | Ga0495651_0012113 | 3300046462 | Bacteria | 6635 |
| 424 | Ga0495651_0018552 | 3300046462 | Bacteria | 5389 |
| 425 | Ga0495651_0021955 | 3300046462 | Bacteria | 4964 |
| 426 | Ga0495651_0041016 | 3300046462 | Bacteria | 3596 |
| 427 | Ga0495651_0046174 | 3300046462 | Bacteria | 3371 |
| 428 | Ga0495651_0051187 | 3300046462 | Bacteria | 3186 |
| 429 | Ga0495651_0065007 | 3300046462 | Bacteria | 2786 |
| 430 | Ga0495651_0392270 | 3300046462 | Bacteria | 908 |
| 431 | Ga0495653_0000420 | 3300046463 | Bacteria | 33951 |
| 432 | Ga0495653_0014591 | 3300046463 | Bacteria | 6412 |
| 433 | Ga0495653_0028153 | 3300046463 | Bacteria | 4495 |
| 434 | Ga0495653_0046642 | 3300046463 | Bacteria | 3354 |
| 435 | Ga0495653_0054717 | 3300046463 | Bacteria | 3048 |
| 436 | Ga0495653_0075746 | 3300046463 | Bacteria | 2503 |
| 437 | Ga0495653_0112915 | 3300046463 | Bacteria | 1949 |
| 438 | Ga0495653_0120745 | 3300046463 | Bacteria | 1868 |
| 439 | Ga0495653_0124461 | 3300046463 | Unclassified | 1832 |
| 440 | Ga0495580_0027053 | 3300046472 | Bacteria | 4176 |
| 441 | Ga0495580_0067210 | 3300046472 | Bacteria | 2508 |
| 442 | Ga0495582_0003438 | 3300046473 | Bacteria | 8924 |
| 443 | Ga0495582_0007311 | 3300046473 | Bacteria | 6119 |
| 444 | Ga0495639_0007273 | 3300046475 | Bacteria | 4753 |
| 445 | Ga0495639_0052878 | 3300046475 | Unclassified | 1849 |
| 446 | Ga0495639_0219565 | 3300046475 | Unclassified | 934 |
| 447 | Ga0495662_0021422 | 3300046476 | Bacteria | 3124 |
| 448 | Ga0495662_0110149 | 3300046476 | Bacteria | 1349 |
| 449 | Ga0495664_0009529 | 3300046477 | Bacteria | 5437 |
| 450 | Ga0495664_0017914 | 3300046477 | Bacteria | 4051 |
| 451 | Ga0495664_0018583 | 3300046477 | Bacteria | 3986 |
| 452 | Ga0495664_0024151 | 3300046477 | Bacteria | 3530 |
| 453 | Ga0495664_0043352 | 3300046477 | Bacteria | 2665 |
| 454 | Ga0495664_0050238 | 3300046477 | Bacteria | 2476 |
| 455 | Ga0495664_0057993 | 3300046477 | Bacteria | 2303 |
| 456 | Ga0495664_0077523 | 3300046477 | Unclassified | 1990 |
| 457 | Ga0495664_0083498 | 3300046477 | Bacteria | 1916 |
| 458 | Ga0495594_0034273 | 3300046499 | Unclassified | 2761 |
| 459 | Ga0495594_0041845 | 3300046499 | Bacteria | 2508 |
| 460 | Ga0495608_0000095 | 3300046511 | Bacteria | 64067 |
| 461 | Ga0495608_0013938 | 3300046511 | Bacteria | 5579 |
| 462 | Ga0495608_0033082 | 3300046511 | Bacteria | 3496 |
| 463 | Ga0495608_0093154 | 3300046511 | Bacteria | 1946 |
| 464 | Ga0495608_0130911 | 3300046511 | Unclassified | 1605 |
| 465 | Ga0495608_0162264 | 3300046511 | Bacteria | 1420 |
| 466 | Ga0495618_0005430 | 3300046514 | Bacteria | 7770 |
| 467 | Ga0495618_0012085 | 3300046514 | Bacteria | 5240 |
| 468 | Ga0495618_0030072 | 3300046514 | Bacteria | 3390 |
| 469 | Ga0495628_0000226 | 3300046516 | Bacteria | 49494 |
| 470 | Ga0495628_0045515 | 3300046516 | Bacteria | 3488 |
| 471 | Ga0495628_0046686 | 3300046516 | Bacteria | 3439 |
| 472 | Ga0495628_0096190 | 3300046516 | Bacteria | 2288 |
| 473 | Ga0495628_0136949 | 3300046516 | Bacteria | 1870 |
| 474 | Ga0495628_0142528 | 3300046516 | Bacteria | 1828 |
| 475 | Ga0495630_0000621 | 3300046517 | Bacteria | 25689 |
| 476 | Ga0495630_0033879 | 3300046517 | Bacteria | 3809 |
| 477 | Ga0495630_0062550 | 3300046517 | Bacteria | 2796 |
| 478 | Ga0495630_0174759 | 3300046517 | Unclassified | 1637 |
| 479 | Ga0495630_0270236 | 3300046517 | Unclassified | 1299 |
| 480 | Ga0495666_0008890 | 3300046526 | Bacteria | 5030 |
| 481 | Ga0495666_0016050 | 3300046526 | Bacteria | 3729 |
| 482 | Ga0495666_0027944 | 3300046526 | Bacteria | 2776 |
| 483 | Ga0495652_0000337 | 3300046529 | Bacteria | 55658 |
| 484 | Ga0495652_0004687 | 3300046529 | Bacteria | 13039 |
| 485 | Ga0495652_0020965 | 3300046529 | Bacteria | 5808 |
| 486 | Ga0495652_0035183 | 3300046529 | Bacteria | 4360 |
| 487 | Ga0495652_0035986 | 3300046529 | Bacteria | 4306 |
| 488 | Ga0495652_0067958 | 3300046529 | Bacteria | 2986 |
| 489 | Ga0495665_0001232 | 3300046531 | Bacteria | 13656 |
| 490 | Ga0495665_0010206 | 3300046531 | Bacteria | 5088 |
| 491 | Ga0495665_0028072 | 3300046531 | Bacteria | 3020 |
| 492 | Ga0495640_0012221 | 3300046533 | Bacteria | 6571 |
| 493 | Ga0495640_0023445 | 3300046533 | Bacteria | 4495 |
| 494 | Ga0495640_0023734 | 3300046533 | Bacteria | 4462 |
| 495 | Ga0495640_0059482 | 3300046533 | Bacteria | 2602 |
| 496 | Ga0495640_0067957 | 3300046533 | Unclassified | 2399 |
| 497 | Ga0495640_0158204 | 3300046533 | Bacteria | 1453 |
| 498 | Ga0495586_0011987 | 3300046535 | Bacteria | 4606 |
| 499 | Ga0495586_0015203 | 3300046535 | Bacteria | 4095 |
| 500 | Ga0495586_0026236 | 3300046535 | Unclassified | 3117 |
| 501 | Ga0495587_0000078 | 3300046536 | Bacteria | 76639 |
| 502 | Ga0495587_0007741 | 3300046536 | Bacteria | 6945 |
| 503 | Ga0495587_0016156 | 3300046536 | Bacteria | 4646 |
| 504 | Ga0495587_0046128 | 3300046536 | Unclassified | 2587 |
| 505 | Ga0495587_0096263 | 3300046536 | Bacteria | 1707 |
| 506 | Ga0495645_0001175 | 3300046543 | Bacteria | 17832 |
| 507 | Ga0495645_0008366 | 3300046543 | Bacteria | 7223 |
| 508 | Ga0495645_0023605 | 3300046543 | Bacteria | 4455 |
| 509 | Ga0495645_0027262 | 3300046543 | Bacteria | 4149 |
| 510 | Ga0495645_0031499 | 3300046543 | Bacteria | 3865 |
| 511 | Ga0495645_0064832 | 3300046543 | Bacteria | 2643 |
| 512 | Ga0495645_0098956 | 3300046543 | Unclassified | 2075 |
| 513 | Ga0495645_0122063 | 3300046543 | Unclassified | 1833 |
| 514 | Ga0495645_0177544 | 3300046543 | Bacteria | 1461 |
| 515 | Ga0495645_0182305 | 3300046543 | Bacteria | 1437 |
| 516 | Ga0495622_0139275 | 3300046557 | Unclassified | 1102 |
| 517 | Ga0495667_0000775 | 3300046559 | Bacteria | 20504 |
| 518 | Ga0495667_0001084 | 3300046559 | Bacteria | 17655 |
| 519 | Ga0495667_0018223 | 3300046559 | Bacteria | 4743 |
| 520 | Ga0495667_0018435 | 3300046559 | Bacteria | 4714 |
| 521 | Ga0495667_0046268 | 3300046559 | Bacteria | 2877 |
| 522 | Ga0495667_0063621 | 3300046559 | Bacteria | 2414 |
| 523 | Ga0495667_0081206 | 3300046559 | Unclassified | 2107 |
| 524 | Ga0495667_0096810 | 3300046559 | Unclassified | 1910 |
| 525 | Ga0495667_0194654 | 3300046559 | Bacteria | 1298 |
| 526 | Ga0495634_0030110 | 3300046642 | Bacteria | 3751 |
| 527 | Ga0495634_0032839 | 3300046642 | Unclassified | 3566 |
| 528 | Ga0495634_0172706 | 3300046642 | Bacteria | 1357 |
| 529 | Ga0495635_0003168 | 3300046663 | Bacteria | 11331 |
| 530 | Ga0495635_0047735 | 3300046663 | Bacteria | 2952 |
| 531 | Ga0495635_0069113 | 3300046663 | Unclassified | 2421 |
| 532 | Ga0495635_0117189 | 3300046663 | Bacteria | 1817 |
| 533 | Ga0495635_0136712 | 3300046663 | Bacteria | 1670 |
| 534 | Ga0495657_0000013 | 3300046675 | Bacteria | 195590 |
| 535 | Ga0495657_0000098 | 3300046675 | Bacteria | 76618 |
| 536 | Ga0495657_0007061 | 3300046675 | Bacteria | 8713 |
| 537 | Ga0495657_0027700 | 3300046675 | Bacteria | 3995 |
| 538 | Ga0495657_0029918 | 3300046675 | Unclassified | 3817 |
| 539 | Ga0495657_0032131 | 3300046675 | Bacteria | 3665 |
| 540 | Ga0495657_0046510 | 3300046675 | Bacteria | 2937 |
| 541 | Ga0495657_0063864 | 3300046675 | Bacteria | 2427 |
| 542 | Ga0495657_0147536 | 3300046675 | Bacteria | 1462 |
| 543 | Ga0495657_0176432 | 3300046675 | Bacteria | 1313 |
| 544 | Ga0495599_0000447 | 3300046678 | Bacteria | 23493 |
| 545 | Ga0495599_0036480 | 3300046678 | Bacteria | 3088 |
| 546 | Ga0495599_0043012 | 3300046678 | Bacteria | 2835 |
| 547 | Ga0495599_0062950 | 3300046678 | Bacteria | 2317 |
| 548 | Ga0495623_0000845 | 3300046679 | Bacteria | 20709 |
| 549 | Ga0495623_0008762 | 3300046679 | Bacteria | 6567 |
| 550 | Ga0495623_0037632 | 3300046679 | Bacteria | 3095 |
| 551 | Ga0495623_0047139 | 3300046679 | Unclassified | 2735 |
| 552 | Ga0495623_0090881 | 3300046679 | Bacteria | 1874 |
| 553 | Ga0495646_0011512 | 3300046680 | Bacteria | 5617 |
| 554 | Ga0495658_0004740 | 3300046683 | Bacteria | 6678 |
| 555 | Ga0495658_0005794 | 3300046683 | Bacteria | 6064 |
| 556 | Ga0495613_0019933 | 3300046689 | Bacteria | 4998 |
| 557 | Ga0495613_0020505 | 3300046689 | Bacteria | 4927 |
| 558 | Ga0495613_0102122 | 3300046689 | Bacteria | 2070 |
| 559 | Ga0495624_0010866 | 3300046690 | Bacteria | 6275 |
| 560 | Ga0495624_0031339 | 3300046690 | Bacteria | 3458 |
| 561 | Ga0495624_0044841 | 3300046690 | Bacteria | 2818 |
| 562 | Ga0495624_0236274 | 3300046690 | Bacteria | 1106 |
| 563 | Ga0495600_0008555 | 3300046809 | Bacteria | 6293 |
| 564 | Ga0495600_0020510 | 3300046809 | Bacteria | 4226 |
| 565 | Ga0495600_0024574 | 3300046809 | Bacteria | 3880 |
| 566 | Ga0495600_0040568 | 3300046809 | Bacteria | 3032 |
| 567 | Ga0495600_0106827 | 3300046809 | Unclassified | 1823 |
| 568 | Ga0495600_0121285 | 3300046809 | Bacteria | 1700 |
| 569 | Ga0495581_0004305 | 3300047315 | Bacteria | 8216 |
| 570 | Ga0495581_0008580 | 3300047315 | Bacteria | 5920 |
| 571 | Ga0495581_0035489 | 3300047315 | Bacteria | 2885 |
| 572 | Ga0495604_0000142 | 3300047317 | Bacteria | 61620 |
| 573 | Ga0495604_0009707 | 3300047317 | Bacteria | 7612 |
| 574 | Ga0495604_0028691 | 3300047317 | Bacteria | 4427 |
| 575 | Ga0495604_0081466 | 3300047317 | Bacteria | 2423 |
| 576 | Ga0495604_0151330 | 3300047317 | Bacteria | 1648 |
| 577 | Ga0495674_0003177 | 3300047319 | Bacteria | 15954 |
| 578 | Ga0495674_0004597 | 3300047319 | Bacteria | 13275 |
| 579 | Ga0495674_0014117 | 3300047319 | Bacteria | 7482 |
| 580 | Ga0495674_0021622 | 3300047319 | Bacteria | 5946 |
| 581 | Ga0495674_0076958 | 3300047319 | Bacteria | 2869 |
| 582 | Ga0495674_0086460 | 3300047319 | Bacteria | 2684 |
| 583 | Ga0495674_0096528 | 3300047319 | Bacteria | 2519 |
| 584 | Ga0495674_0134740 | 3300047319 | Bacteria | 2079 |
| 585 | Ga0495674_0262515 | 3300047319 | Bacteria | 1419 |
| 586 | Ga0495674_0270437 | 3300047319 | Bacteria | 1394 |
| 587 | Ga0495674_0342196 | 3300047319 | Bacteria | 1215 |
| 588 | Ga0495676_0048961 | 3300047321 | Bacteria | 3402 |
| 589 | Ga0495676_0049931 | 3300047321 | Bacteria | 3359 |
| 590 | Ga0495680_0000111 | 3300047322 | Bacteria | 76638 |
| 591 | Ga0495680_0007755 | 3300047322 | Bacteria | 9805 |
| 592 | Ga0495680_0018841 | 3300047322 | Bacteria | 5849 |
| 593 | Ga0495680_0019979 | 3300047322 | Bacteria | 5645 |
| 594 | Ga0495680_0031589 | 3300047322 | Bacteria | 4306 |
| 595 | Ga0495680_0040005 | 3300047322 | Bacteria | 3736 |
| 596 | Ga0495680_0047990 | 3300047322 | Bacteria | 3355 |
| 597 | Ga0495680_0139256 | 3300047322 | Bacteria | 1776 |
| 598 | Ga0495675_0000910 | 3300047444 | Bacteria | 18025 |
| 599 | Ga0495675_0010201 | 3300047444 | Bacteria | 5861 |
| 600 | Ga0495684_0013810 | 3300047471 | Bacteria | 6213 |
| 601 | Ga0495684_0015171 | 3300047471 | Bacteria | 5932 |
| 602 | Ga0495684_0045672 | 3300047471 | Bacteria | 3352 |
| 603 | Ga0495684_0058386 | 3300047471 | Bacteria | 2939 |
| 604 | Ga0495684_0122860 | 3300047471 | Bacteria | 1954 |
| 605 | Ga0495684_0237335 | 3300047471 | Unclassified | 1331 |
| 606 | Ga0495684_0286234 | 3300047471 | Unclassified | 1187 |
| 607 | Ga0495593_0001196 | 3300047673 | Bacteria | 15186 |
| 608 | Ga0495593_0006283 | 3300047673 | Bacteria | 6972 |
| 609 | Ga0495593_0017301 | 3300047673 | Bacteria | 4057 |
| 610 | Ga0495593_0043698 | 3300047673 | Unclassified | 2399 |
| 611 | Ga0495602_0000686 | 3300048088 | Bacteria | 31781 |
| 612 | Ga0495602_0023040 | 3300048088 | Bacteria | 6078 |
| 613 | Ga0495602_0044846 | 3300048088 | Bacteria | 4006 |
| 614 | Ga0495602_0289347 | 3300048088 | Unclassified | 1203 |
| 615 | Ga0495614_0013523 | 3300048089 | Bacteria | 3578 |
| 616 | Ga0496100_0001988 | 3300048903 | Bacteria | 10239 |
| 617 | Ga0496100_0004323 | 3300048903 | Bacteria | 7522 |
| 618 | Ga0496100_0017830 | 3300048903 | Bacteria | 4199 |
| 619 | Ga0496101_0011391 | 3300048904 | Bacteria | 5900 |
| 620 | Ga0496101_0132225 | 3300048904 | Unclassified | 1895 |
| 621 | Ga0496102_0002403 | 3300048905 | Bacteria | 15981 |
| 622 | Ga0496102_0038077 | 3300048905 | Bacteria | 4339 |
| 623 | Ga0496102_0098354 | 3300048905 | Bacteria | 2715 |
| 624 | Ga0496102_0428916 | 3300048905 | Bacteria | 1241 |
| 625 | Ga0496102_0465930 | 3300048905 | Bacteria | 1184 |
| 626 | Ga0496104_0005141 | 3300048907 | Bacteria | 11428 |
| 627 | Ga0496104_0032944 | 3300048907 | Bacteria | 4824 |
| 628 | Ga0496104_0102413 | 3300048907 | Bacteria | 2742 |
| 629 | Ga0496104_0146772 | 3300048907 | Bacteria | 2265 |
| 630 | Ga0496104_0515094 | 3300048907 | Unclassified | 1107 |
| 631 | Ga0496105_0003238 | 3300048908 | Bacteria | 11999 |
| 632 | Ga0496105_0008601 | 3300048908 | Bacteria | 7933 |
| 633 | Ga0496105_0040489 | 3300048908 | Bacteria | 3842 |
| 634 | Ga0496105_0054981 | 3300048908 | Bacteria | 3287 |
| 635 | Ga0496105_0058772 | 3300048908 | Bacteria | 3173 |
| 636 | Ga0496106_0063244 | 3300048909 | Unclassified | 2812 |
| 637 | Ga0496106_0070230 | 3300048909 | Bacteria | 2675 |
| 638 | Ga0496106_0119109 | 3300048909 | Bacteria | 2062 |
| 639 | Ga0496107_0026118 | 3300048910 | Bacteria | 4139 |
| 640 | Ga0496107_0066095 | 3300048910 | Bacteria | 2621 |
| 641 | Ga0496107_0166484 | 3300048910 | Bacteria | 1634 |
| 642 | Ga0496108_0005350 | 3300048911 | Bacteria | 10375 |
| 643 | Ga0496108_0009716 | 3300048911 | Bacteria | 7798 |
| 644 | Ga0496108_0013921 | 3300048911 | Bacteria | 6560 |
| 645 | Ga0496108_0154782 | 3300048911 | Bacteria | 1979 |
| 646 | Ga0496108_0367669 | 3300048911 | Bacteria | 1255 |
| 647 | Ga0496109_0003103 | 3300048912 | Bacteria | 13857 |
| 648 | Ga0496109_0016593 | 3300048912 | Bacteria | 6439 |
| 649 | Ga0496109_0041887 | 3300048912 | Bacteria | 4148 |
| 650 | Ga0496109_0214400 | 3300048912 | Unclassified | 1810 |
| 651 | Ga0496110_0001275 | 3300048913 | Bacteria | 18024 |
| 652 | Ga0496110_0059620 | 3300048913 | Unclassified | 3365 |
| 653 | Ga0496110_0127275 | 3300048913 | Bacteria | 2298 |
| 654 | Ga0496111_0004308 | 3300048914 | Bacteria | 8974 |
| 655 | Ga0496111_0010036 | 3300048914 | Bacteria | 6337 |
| 656 | Ga0496111_0012249 | 3300048914 | Bacteria | 5801 |
| 657 | Ga0496112_0001872 | 3300048915 | Bacteria | 16588 |
| 658 | Ga0496112_0012492 | 3300048915 | Bacteria | 7804 |
| 659 | Ga0496112_0016478 | 3300048915 | Bacteria | 6925 |
| 660 | Ga0496112_0075838 | 3300048915 | Bacteria | 3325 |
| 661 | Ga0496112_0468566 | 3300048915 | Bacteria | 1197 |
| 662 | Ga0496113_0008348 | 3300048916 | Bacteria | 6745 |
| 663 | Ga0496113_0020882 | 3300048916 | Bacteria | 4612 |
| 664 | Ga0496113_0086892 | 3300048916 | Bacteria | 2403 |
| 665 | Ga0496114_0048452 | 3300048917 | Bacteria | 3534 |
| 666 | Ga0496114_0060445 | 3300048917 | Bacteria | 3167 |
| 667 | Ga0496114_0127014 | 3300048917 | Unclassified | 2199 |
| 668 | Ga0496114_0247939 | 3300048917 | Bacteria | 1567 |
| 669 | Ga0496115_0009144 | 3300048918 | Bacteria | 7355 |
| 670 | Ga0496115_0035600 | 3300048918 | Bacteria | 3939 |
| 671 | Ga0496115_0037058 | 3300048918 | Bacteria | 3863 |
| 672 | Ga0501042_0044201 | 3300049578 | Bacteria | 3173 |
| 673 | Ga0501067_0092711 | 3300049583 | Bacteria | 1677 |
| 674 | Ga0501069_0025864 | 3300049585 | Bacteria | 3211 |
| 675 | nmdc:mga05p37_8967_c1 | 3300050507 | Bacteria | 11832 |
| 676 | nmdc:mga0n895_10653_c1 | 3300050512 | Bacteria | 8140 |
| 677 | nmdc:mga0n895_5399_c1 | 3300050512 | Bacteria | 10672 |
| 678 | nmdc:mga0rr50_103041_c1 | 3300050513 | Unclassified | 2246 |
| 679 | nmdc:mga0rr50_176677_c1 | 3300050513 | Bacteria | 1743 |
| 680 | nmdc:mga0rr50_74415_c1 | 3300050513 | Unclassified | 2600 |
| 681 | nmdc:mga08x19_54970_c1 | 3300050514 | Unclassified | 2564 |
| 682 | nmdc:mga08x19_5528_c1 | 3300050514 | Bacteria | 7473 |
| 683 | nmdc:mga0a205_197506_c1 | 3300050515 | Unclassified | 1903 |
| 684 | Ga0495601_0005503 | 3300053077 | Bacteria | 7386 |
| 685 | Ga0495601_0039898 | 3300053077 | Bacteria | 2940 |
| 686 | Ga0495601_0048020 | 3300053077 | Bacteria | 2688 |
| 687 | Ga0495601_0056733 | 3300053077 | Bacteria | 2480 |
| 688 | Ga0495601_0064978 | 3300053077 | Unclassified | 2321 |
| 689 | Ga0495601_0084883 | 3300053077 | Bacteria | 2034 |
| 690 | Ga0495612_0000219 | 3300053078 | Bacteria | 24266 |
| 691 | Ga0495612_0008818 | 3300053078 | Bacteria | 4087 |
| 692 | Ga0495612_0019936 | 3300053078 | Bacteria | 2687 |
| 693 | Ga0495612_0034361 | 3300053078 | Bacteria | 2053 |
| 694 | Ga0495612_0128783 | 3300053078 | Bacteria | 1092 |
| 695 | Ga0495595_0003727 | 3300053084 | Bacteria | 6059 |
| 696 | Ga0495595_0010621 | 3300053084 | Bacteria | 3831 |
| 697 | Ga0495595_0032540 | 3300053084 | Bacteria | 2349 |
| 698 | Ga0495595_0056146 | 3300053084 | Bacteria | 1834 |
| 699 | Ga0495619_0007442 | 3300053085 | Bacteria | 6935 |
| 700 | Ga0495619_0009673 | 3300053085 | Bacteria | 6080 |
| 701 | Ga0495619_0108689 | 3300053085 | Bacteria | 1893 |
| 702 | Ga0466962_0015331 | 3300061719 | Bacteria | 3696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035089 | Ga0373944_0020527 | Ga0373944_0020527_21_845 | 214 |
| 2 | 3300053084 | Ga0495595_0056146 | Ga0495595_0056146_970_1794 | 214 |
| 3 | 3300035172 | Ga0373955_0125610 | Ga0373955_0125610_13_816 | 216 |
| 4 | 3300036401 | Ga0373937_0365120 | Ga0373937_0365120_12_815 | 216 |
| 5 | 3300046543 | Ga0495645_0001175 | Ga0495645_0001175_3904_4689 | 224 |
| 6 | 3300035120 | Ga0373957_0048751 | Ga0373957_0048751_98_910 | 225 |
| 7 | 3300028379 | Ga0268266_10712342 | Ga0268266_107123421 | 227 |
| 8 | 3300035170 | Ga0373943_0226833 | Ga0373943_0226833_223_1023 | 228 |
| 9 | 3300047471 | Ga0495684_0237335 | Ga0495684_0237335_484_1284 | 228 |
| 10 | 3300035089 | Ga0373944_0000911 | Ga0373944_0000911_1480_2313 | 229 |
| 11 | 3300035113 | Ga0373936_0000278 | Ga0373936_0000278_14849_15682 | 229 |
| 12 | 3300035170 | Ga0373943_0000119 | Ga0373943_0000119_952_1785 | 229 |
| 13 | 3300035171 | Ga0373946_0006354 | Ga0373946_0006354_2310_3143 | 229 |
| 14 | 3300035692 | Ga0373935_0007190 | Ga0373935_0007190_4217_5050 | 229 |
| 15 | 3300035695 | Ga0373927_0000726 | Ga0373927_0000726_1424_2257 | 229 |
| 16 | 3300035725 | Ga0373947_0000141 | Ga0373947_0000141_9128_9961 | 229 |
| 17 | 3300037068 | Ga0373925_0001150 | Ga0373925_0001150_3300_4133 | 229 |
| 18 | 3300039450 | Ga0436363_1128802 | Ga0436363_1128802_1129_1962 | 229 |
| 19 | 3300046462 | Ga0495651_0051187 | Ga0495651_0051187_2172_3005 | 229 |
| 20 | 3300046463 | Ga0495653_0014591 | Ga0495653_0014591_3819_4652 | 229 |
| 21 | 3300046476 | Ga0495662_0110149 | Ga0495662_0110149_293_1126 | 229 |
| 22 | 3300046477 | Ga0495664_0009529 | Ga0495664_0009529_1779_2612 | 229 |
| 23 | 3300046514 | Ga0495618_0005430 | Ga0495618_0005430_5159_5992 | 229 |
| 24 | 3300046517 | Ga0495630_0062550 | Ga0495630_0062550_1064_1897 | 229 |
| 25 | 3300046529 | Ga0495652_0020965 | Ga0495652_0020965_3039_3872 | 229 |
| 26 | 3300046533 | Ga0495640_0158204 | Ga0495640_0158204_246_1079 | 229 |
| 27 | 3300046559 | Ga0495667_0046268 | Ga0495667_0046268_1782_2615 | 229 |
| 28 | 3300046642 | Ga0495634_0030110 | Ga0495634_0030110_111_944 | 229 |
| 29 | 3300046663 | Ga0495635_0003168 | Ga0495635_0003168_2189_3022 | 229 |
| 30 | 3300047319 | Ga0495674_0003177 | Ga0495674_0003177_9291_10124 | 229 |
| 31 | 3300047322 | Ga0495680_0019979 | Ga0495680_0019979_1909_2742 | 229 |
| 32 | 3300047471 | Ga0495684_0286234 | Ga0495684_0286234_13_846 | 229 |
| 33 | 3300006028 | Ga0070717_10003603 | Ga0070717_1000360311 | 230 |
| 34 | 3300025929 | Ga0207664_10003303 | Ga0207664_100033032 | 234 |
| 35 | 3300048909 | Ga0496106_0119109 | Ga0496106_0119109_17_835 | 234 |
| 36 | 3300025898 | Ga0207692_10203048 | Ga0207692_102030482 | 236 |
| 37 | 3300046477 | Ga0495664_0050238 | Ga0495664_0050238_929_1786 | 236 |
| 38 | 3300046543 | Ga0495645_0064832 | Ga0495645_0064832_747_1604 | 236 |
| 39 | 3300047319 | Ga0495674_0096528 | Ga0495674_0096528_403_1260 | 236 |
| 40 | 3300053077 | Ga0495601_0084883 | Ga0495601_0084883_964_1821 | 236 |
| 41 | 3300025915 | Ga0207693_10033669 | Ga0207693_100336692 | 237 |
| 42 | 3300035111 | Ga0373923_0019629 | Ga0373923_0019629_1329_2186 | 237 |
| 43 | 3300035120 | Ga0373957_0073857 | Ga0373957_0073857_318_1175 | 237 |
| 44 | 3300035724 | Ga0373933_0115167 | Ga0373933_0115167_377_1234 | 237 |
| 45 | 3300035725 | Ga0373947_0029522 | Ga0373947_0029522_1237_2094 | 237 |
| 46 | 3300037068 | Ga0373925_0245085 | Ga0373925_0245085_575_1426 | 237 |
| 47 | 3300046459 | Ga0495629_0081492 | Ga0495629_0081492_1125_1982 | 237 |
| 48 | 3300046463 | Ga0495653_0112915 | Ga0495653_0112915_868_1725 | 237 |
| 49 | 3300046472 | Ga0495580_0067210 | Ga0495580_0067210_314_1171 | 237 |
| 50 | 3300046475 | Ga0495639_0219565 | Ga0495639_0219565_35_886 | 237 |
| 51 | 3300046499 | Ga0495594_0041845 | Ga0495594_0041845_519_1376 | 237 |
| 52 | 3300046526 | Ga0495666_0027944 | Ga0495666_0027944_811_1668 | 237 |
| 53 | 3300046533 | Ga0495640_0023734 | Ga0495640_0023734_734_1591 | 237 |
| 54 | 3300046559 | Ga0495667_0063621 | Ga0495667_0063621_434_1291 | 237 |
| 55 | 3300046642 | Ga0495634_0172706 | Ga0495634_0172706_67_924 | 237 |
| 56 | 3300046663 | Ga0495635_0117189 | Ga0495635_0117189_67_924 | 237 |
| 57 | 3300046675 | Ga0495657_0007061 | Ga0495657_0007061_1404_2261 | 237 |
| 58 | 3300046689 | Ga0495613_0102122 | Ga0495613_0102122_434_1294 | 237 |
| 59 | 3300047319 | Ga0495674_0086460 | Ga0495674_0086460_1176_2033 | 237 |
| 60 | 3300047673 | Ga0495593_0006283 | Ga0495593_0006283_1110_1967 | 237 |
| 61 | 3300048089 | Ga0495614_0013523 | Ga0495614_0013523_106_963 | 237 |
| 62 | 3300005337 | Ga0070682_100054068 | Ga0070682_1000540682 | 238 |
| 63 | 3300005435 | Ga0070714_100008242 | Ga0070714_1000082428 | 238 |
| 64 | 3300005435 | Ga0070714_100079839 | Ga0070714_1000798393 | 238 |
| 65 | 3300005530 | Ga0070679_100490584 | Ga0070679_1004905842 | 238 |
| 66 | 3300005547 | Ga0070693_100049804 | Ga0070693_1000498042 | 238 |
| 67 | 3300005548 | Ga0070665_100351019 | Ga0070665_1003510191 | 238 |
| 68 | 3300005614 | Ga0068856_100002953 | Ga0068856_10000295312 | 238 |
| 69 | 3300005842 | Ga0068858_100108159 | Ga0068858_1001081592 | 238 |
| 70 | 3300006028 | Ga0070717_10006492 | Ga0070717_100064924 | 238 |
| 71 | 3300006028 | Ga0070717_10021020 | Ga0070717_100210202 | 238 |
| 72 | 3300009101 | Ga0105247_10027574 | Ga0105247_100275743 | 238 |
| 73 | 3300009148 | Ga0105243_10321718 | Ga0105243_103217182 | 238 |
| 74 | 3300013297 | Ga0157378_10152203 | Ga0157378_101522032 | 238 |
| 75 | 3300013306 | Ga0163162_10133087 | Ga0163162_101330872 | 238 |
| 76 | 3300025916 | Ga0207663_10397783 | Ga0207663_103977832 | 238 |
| 77 | 3300025929 | Ga0207664_10003313 | Ga0207664_1000331311 | 238 |
| 78 | 3300025929 | Ga0207664_10051601 | Ga0207664_100516012 | 238 |
| 79 | 3300025931 | Ga0207644_10128498 | Ga0207644_101284982 | 238 |
| 80 | 3300026035 | Ga0207703_10069611 | Ga0207703_100696112 | 238 |
| 81 | 3300026078 | Ga0207702_10005745 | Ga0207702_100057452 | 238 |
| 82 | 3300028379 | Ga0268266_10096904 | Ga0268266_100969042 | 238 |
| 83 | 3300035113 | Ga0373936_0040784 | Ga0373936_0040784_708_1568 | 238 |
| 84 | 3300035695 | Ga0373927_0091246 | Ga0373927_0091246_115_975 | 238 |
| 85 | 3300044656 | Ga0466969_0101367 | Ga0466969_0101367_480_1322 | 238 |
| 86 | 3300044683 | Ga0466965_0073279 | Ga0466965_0073279_575_1417 | 238 |
| 87 | 3300044684 | Ga0466966_0101489 | Ga0466966_0101489_586_1428 | 238 |
| 88 | 3300044693 | Ga0466961_0100821 | Ga0466961_0100821_815_1657 | 238 |
| 89 | 3300044694 | Ga0466963_0002750 | Ga0466963_0002750_5661_6503 | 238 |
| 90 | 3300044694 | Ga0466963_0031275 | Ga0466963_0031275_408_1244 | 238 |
| 91 | 3300044719 | Ga0466971_0015789 | Ga0466971_0015789_1467_2309 | 238 |
| 92 | 3300044765 | Ga0466970_0018115 | Ga0466970_0018115_2578_3420 | 238 |
| 93 | 3300044842 | Ga0466957_0003271 | Ga0466957_0003271_4705_5547 | 238 |
| 94 | 3300044842 | Ga0466957_0036171 | Ga0466957_0036171_2053_2892 | 238 |
| 95 | 3300044842 | Ga0466957_0125755 | Ga0466957_0125755_569_1405 | 238 |
| 96 | 3300045049 | Ga0466959_0019955 | Ga0466959_0019955_1092_1934 | 238 |
| 97 | 3300045836 | Ga0466958_0001555 | Ga0466958_0001555_7951_8793 | 238 |
| 98 | 3300045836 | Ga0466958_0023162 | Ga0466958_0023162_526_1362 | 238 |
| 99 | 3300045976 | Ga0466967_0093491 | Ga0466967_0093491_461_1303 | 238 |
| 100 | 3300046463 | Ga0495653_0000420 | Ga0495653_0000420_27700_28527 | 238 |
| 101 | 3300046477 | Ga0495664_0043352 | Ga0495664_0043352_1509_2369 | 238 |
| 102 | 3300046535 | Ga0495586_0015203 | Ga0495586_0015203_1730_2587 | 238 |
| 103 | 3300046690 | Ga0495624_0236274 | Ga0495624_0236274_168_1028 | 238 |
| 104 | 3300047319 | Ga0495674_0014117 | Ga0495674_0014117_5890_6750 | 238 |
| 105 | 3300048905 | Ga0496102_0465930 | Ga0496102_0465930_293_1150 | 238 |
| 106 | 3300048917 | Ga0496114_0060445 | Ga0496114_0060445_283_1140 | 238 |
| 107 | 3300053077 | Ga0495601_0048020 | Ga0495601_0048020_645_1505 | 238 |
| 108 | 3300053078 | Ga0495612_0034361 | Ga0495612_0034361_998_1855 | 238 |
| 109 | 3300061719 | Ga0466962_0015331 | Ga0466962_0015331_171_1010 | 238 |
| 110 | 3300005338 | Ga0068868_100140033 | Ga0068868_1001400332 | 239 |
| 111 | 3300005578 | Ga0068854_100037719 | Ga0068854_1000377193 | 239 |
| 112 | 3300005615 | Ga0070702_100006338 | Ga0070702_1000063382 | 239 |
| 113 | 3300005618 | Ga0068864_100052245 | Ga0068864_1000522454 | 239 |
| 114 | 3300005843 | Ga0068860_100040221 | Ga0068860_1000402215 | 239 |
| 115 | 3300006175 | Ga0070712_100157010 | Ga0070712_1001570102 | 239 |
| 116 | 3300009093 | Ga0105240_10139607 | Ga0105240_101396074 | 239 |
| 117 | 3300009098 | Ga0105245_10131097 | Ga0105245_101310973 | 239 |
| 118 | 3300009177 | Ga0105248_10477006 | Ga0105248_104770062 | 239 |
| 119 | 3300009551 | Ga0105238_10062516 | Ga0105238_100625162 | 239 |
| 120 | 3300010375 | Ga0105239_10038464 | Ga0105239_100384644 | 239 |
| 121 | 3300011119 | Ga0105246_10027214 | Ga0105246_100272142 | 239 |
| 122 | 3300013307 | Ga0157372_10089926 | Ga0157372_100899262 | 239 |
| 123 | 3300013308 | Ga0157375_10068029 | Ga0157375_100680293 | 239 |
| 124 | 3300014325 | Ga0163163_10014804 | Ga0163163_100148047 | 239 |
| 125 | 3300014745 | Ga0157377_10065297 | Ga0157377_100652972 | 239 |
| 126 | 3300025901 | Ga0207688_10005389 | Ga0207688_100053892 | 239 |
| 127 | 3300025908 | Ga0207643_10016674 | Ga0207643_100166742 | 239 |
| 128 | 3300025911 | Ga0207654_10103334 | Ga0207654_101033342 | 239 |
| 129 | 3300025914 | Ga0207671_10009587 | Ga0207671_100095877 | 239 |
| 130 | 3300025915 | Ga0207693_10013139 | Ga0207693_100131397 | 239 |
| 131 | 3300025924 | Ga0207694_10055655 | Ga0207694_100556552 | 239 |
| 132 | 3300025927 | Ga0207687_10000248 | Ga0207687_100002482 | 239 |
| 133 | 3300025932 | Ga0207690_10009338 | Ga0207690_100093383 | 239 |
| 134 | 3300025938 | Ga0207704_10021420 | Ga0207704_100214202 | 239 |
| 135 | 3300025942 | Ga0207689_10143764 | Ga0207689_101437642 | 239 |
| 136 | 3300025949 | Ga0207667_10059573 | Ga0207667_100595733 | 239 |
| 137 | 3300025981 | Ga0207640_10185389 | Ga0207640_101853892 | 239 |
| 138 | 3300026023 | Ga0207677_10073746 | Ga0207677_100737462 | 239 |
| 139 | 3300026095 | Ga0207676_10037130 | Ga0207676_100371304 | 239 |
| 140 | 3300026142 | Ga0207698_10017520 | Ga0207698_100175205 | 239 |
| 141 | 3300046517 | Ga0495630_0000621 | Ga0495630_0000621_15225_16088 | 239 |
| 142 | 3300046536 | Ga0495587_0096263 | Ga0495587_0096263_198_1058 | 239 |
| 143 | 3300046675 | Ga0495657_0000013 | Ga0495657_0000013_129514_130377 | 239 |
| 144 | 3300046679 | Ga0495623_0090881 | Ga0495623_0090881_322_1182 | 239 |
| 145 | 3300047317 | Ga0495604_0151330 | Ga0495604_0151330_508_1368 | 239 |
| 146 | 3300048903 | Ga0496100_0001988 | Ga0496100_0001988_7476_8336 | 239 |
| 147 | 3300048903 | Ga0496100_0004323 | Ga0496100_0004323_4928_5776 | 239 |
| 148 | 3300048904 | Ga0496101_0011391 | Ga0496101_0011391_890_1750 | 239 |
| 149 | 3300048904 | Ga0496101_0132225 | Ga0496101_0132225_57_905 | 239 |
| 150 | 3300048905 | Ga0496102_0002403 | Ga0496102_0002403_3988_4848 | 239 |
| 151 | 3300048905 | Ga0496102_0038077 | Ga0496102_0038077_834_1682 | 239 |
| 152 | 3300048907 | Ga0496104_0032944 | Ga0496104_0032944_2903_3763 | 239 |
| 153 | 3300048907 | Ga0496104_0515094 | Ga0496104_0515094_176_1024 | 239 |
| 154 | 3300048908 | Ga0496105_0040489 | Ga0496105_0040489_2301_3161 | 239 |
| 155 | 3300048908 | Ga0496105_0054981 | Ga0496105_0054981_1520_2368 | 239 |
| 156 | 3300048909 | Ga0496106_0063244 | Ga0496106_0063244_1847_2695 | 239 |
| 157 | 3300048910 | Ga0496107_0066095 | Ga0496107_0066095_1518_2378 | 239 |
| 158 | 3300048910 | Ga0496107_0166484 | Ga0496107_0166484_426_1274 | 239 |
| 159 | 3300048911 | Ga0496108_0005350 | Ga0496108_0005350_5110_5958 | 239 |
| 160 | 3300048911 | Ga0496108_0013921 | Ga0496108_0013921_3392_4252 | 239 |
| 161 | 3300048912 | Ga0496109_0003103 | Ga0496109_0003103_8012_8860 | 239 |
| 162 | 3300048912 | Ga0496109_0016593 | Ga0496109_0016593_1441_2301 | 239 |
| 163 | 3300048913 | Ga0496110_0001275 | Ga0496110_0001275_1266_2126 | 239 |
| 164 | 3300048913 | Ga0496110_0059620 | Ga0496110_0059620_60_908 | 239 |
| 165 | 3300048914 | Ga0496111_0004308 | Ga0496111_0004308_3467_4327 | 239 |
| 166 | 3300048914 | Ga0496111_0010036 | Ga0496111_0010036_1171_2019 | 239 |
| 167 | 3300048915 | Ga0496112_0016478 | Ga0496112_0016478_4418_5266 | 239 |
| 168 | 3300048915 | Ga0496112_0075838 | Ga0496112_0075838_885_1745 | 239 |
| 169 | 3300048916 | Ga0496113_0020882 | Ga0496113_0020882_896_1756 | 239 |
| 170 | 3300048916 | Ga0496113_0086892 | Ga0496113_0086892_894_1742 | 239 |
| 171 | 3300048918 | Ga0496115_0009144 | Ga0496115_0009144_5916_6776 | 239 |
| 172 | 3300053078 | Ga0495612_0000219 | Ga0495612_0000219_17522_18385 | 239 |
| 173 | 3300025928 | Ga0207700_10350729 | Ga0207700_103507292 | 240 |
| 174 | 3300049583 | Ga0501067_0092711 | Ga0501067_0092711_112_969 | 240 |
| 175 | 3300049585 | Ga0501069_0025864 | Ga0501069_0025864_1659_2516 | 240 |
| 176 | 3300025906 | Ga0207699_10132172 | Ga0207699_101321722 | 241 |
| 177 | 3300048915 | Ga0496112_0001872 | Ga0496112_0001872_1155_2009 | 241 |
| 178 | 3300028556 | Ga0265337_1001444 | Ga0265337_100144412 | 242 |
| 179 | 3300028558 | Ga0265326_10000206 | Ga0265326_1000020610 | 242 |
| 180 | 3300028563 | Ga0265319_1001776 | Ga0265319_100177610 | 242 |
| 181 | 3300028577 | Ga0265318_10000927 | Ga0265318_100009272 | 242 |
| 182 | 3300028654 | Ga0265322_10009353 | Ga0265322_100093533 | 242 |
| 183 | 3300028666 | Ga0265336_10000049 | Ga0265336_1000004941 | 242 |
| 184 | 3300028800 | Ga0265338_10000046 | Ga0265338_10000046136 | 242 |
| 185 | 3300029957 | Ga0265324_10001396 | Ga0265324_1000139612 | 242 |
| 186 | 3300031247 | Ga0265340_10000003 | Ga0265340_1000000341 | 242 |
| 187 | 3300031249 | Ga0265339_10099968 | Ga0265339_100999682 | 242 |
| 188 | 3300031344 | Ga0265316_10191254 | Ga0265316_101912542 | 242 |
| 189 | 3300044684 | Ga0466966_0008290 | Ga0466966_0008290_2293_3156 | 242 |
| 190 | 3300045836 | Ga0466958_0067961 | Ga0466958_0067961_239_1096 | 242 |
| 191 | 3300045836 | Ga0466958_0200843 | Ga0466958_0200843_55_918 | 242 |
| 192 | 3300046462 | Ga0495651_0392270 | Ga0495651_0392270_35_895 | 242 |
| 193 | 3300046516 | Ga0495628_0096190 | Ga0495628_0096190_1231_2091 | 242 |
| 194 | 3300053077 | Ga0495601_0005503 | Ga0495601_0005503_3662_4513 | 242 |
| 195 | 3300009093 | Ga0105240_10004674 | Ga0105240_100046747 | 243 |
| 196 | 3300025913 | Ga0207695_10002407 | Ga0207695_100024077 | 243 |
| 197 | 3300031711 | Ga0265314_10042959 | Ga0265314_100429592 | 248 |
| 198 | 3300028800 | Ga0265338_10143514 | Ga0265338_101435142 | 251 |
| 199 | 3300031241 | Ga0265325_10028097 | Ga0265325_100280972 | 251 |
| 200 | 3300031247 | Ga0265340_10029548 | Ga0265340_100295483 | 251 |
| 201 | 3300031344 | Ga0265316_10274304 | Ga0265316_102743042 | 251 |
| 202 | 3300037068 | Ga0373925_0008253 | Ga0373925_0008253_4304_5320 | 254 |
| 203 | 3300025928 | Ga0207700_10143566 | Ga0207700_101435662 | 255 |
| 204 | 3300035086 | Ga0373934_0007668 | Ga0373934_0007668_556_1518 | 256 |
| 205 | 3300035118 | Ga0373954_0038183 | Ga0373954_0038183_718_1680 | 256 |
| 206 | 3300035119 | Ga0373956_0018153 | Ga0373956_0018153_1872_2834 | 256 |
| 207 | 3300035119 | Ga0373956_0108425 | Ga0373956_0108425_325_1266 | 256 |
| 208 | 3300035410 | Ga0373924_0016732 | Ga0373924_0016732_18_980 | 256 |
| 209 | 3300035692 | Ga0373935_0176487 | Ga0373935_0176487_88_1050 | 256 |
| 210 | 3300035724 | Ga0373933_0000803 | Ga0373933_0000803_4442_5404 | 256 |
| 211 | 3300036401 | Ga0373937_0000938 | Ga0373937_0000938_677_1639 | 256 |
| 212 | 3300046454 | Ga0495592_0046403 | Ga0495592_0046403_446_1408 | 256 |
| 213 | 3300046462 | Ga0495651_0021955 | Ga0495651_0021955_2015_2977 | 256 |
| 214 | 3300046462 | Ga0495651_0046174 | Ga0495651_0046174_1199_2140 | 256 |
| 215 | 3300046463 | Ga0495653_0124461 | Ga0495653_0124461_88_1050 | 256 |
| 216 | 3300046477 | Ga0495664_0083498 | Ga0495664_0083498_317_1279 | 256 |
| 217 | 3300046511 | Ga0495608_0033082 | Ga0495608_0033082_637_1599 | 256 |
| 218 | 3300046516 | Ga0495628_0045515 | Ga0495628_0045515_993_1955 | 256 |
| 219 | 3300046517 | Ga0495630_0174759 | Ga0495630_0174759_211_1152 | 256 |
| 220 | 3300046526 | Ga0495666_0016050 | Ga0495666_0016050_2281_3243 | 256 |
| 221 | 3300046529 | Ga0495652_0067958 | Ga0495652_0067958_1239_2180 | 256 |
| 222 | 3300046533 | Ga0495640_0067957 | Ga0495640_0067957_677_1639 | 256 |
| 223 | 3300046536 | Ga0495587_0016156 | Ga0495587_0016156_1842_2783 | 256 |
| 224 | 3300046536 | Ga0495587_0046128 | Ga0495587_0046128_841_1803 | 256 |
| 225 | 3300046543 | Ga0495645_0098956 | Ga0495645_0098956_754_1716 | 256 |
| 226 | 3300046675 | Ga0495657_0046510 | Ga0495657_0046510_1885_2826 | 256 |
| 227 | 3300046675 | Ga0495657_0147536 | Ga0495657_0147536_103_1065 | 256 |
| 228 | 3300046678 | Ga0495599_0043012 | Ga0495599_0043012_1012_1953 | 256 |
| 229 | 3300046679 | Ga0495623_0047139 | Ga0495623_0047139_1271_2212 | 256 |
| 230 | 3300046809 | Ga0495600_0024574 | Ga0495600_0024574_2011_2952 | 256 |
| 231 | 3300046809 | Ga0495600_0106827 | Ga0495600_0106827_619_1581 | 256 |
| 232 | 3300047315 | Ga0495581_0035489 | Ga0495581_0035489_1851_2813 | 256 |
| 233 | 3300047319 | Ga0495674_0262515 | Ga0495674_0262515_376_1338 | 256 |
| 234 | 3300047673 | Ga0495593_0043698 | Ga0495593_0043698_761_1723 | 256 |
| 235 | 3300048088 | Ga0495602_0044846 | Ga0495602_0044846_1680_2642 | 256 |
| 236 | 3300049578 | Ga0501042_0044201 | Ga0501042_0044201_1825_2742 | 256 |
| 237 | 3300053077 | Ga0495601_0056733 | Ga0495601_0056733_1122_2084 | 256 |
| 238 | 3300005338 | Ga0068868_100275250 | Ga0068868_1002752502 | 258 |
| 239 | 3300005563 | Ga0068855_100341577 | Ga0068855_1003415772 | 258 |
| 240 | 3300005617 | Ga0068859_100502730 | Ga0068859_1005027302 | 258 |
| 241 | 3300006237 | Ga0097621_100015595 | Ga0097621_1000155953 | 258 |
| 242 | 3300006358 | Ga0068871_100139639 | Ga0068871_1001396392 | 258 |
| 243 | 3300006844 | Ga0075428_100051308 | Ga0075428_1000513082 | 258 |
| 244 | 3300006852 | Ga0075433_10002240 | Ga0075433_1000224010 | 258 |
| 245 | 3300006880 | Ga0075429_100319387 | Ga0075429_1003193872 | 258 |
| 246 | 3300006914 | Ga0075436_100050415 | Ga0075436_1000504153 | 258 |
| 247 | 3300006931 | Ga0097620_100502733 | Ga0097620_1005027332 | 258 |
| 248 | 3300009101 | Ga0105247_10237233 | Ga0105247_102372331 | 258 |
| 249 | 3300009147 | Ga0114129_10003946 | Ga0114129_1000394611 | 258 |
| 250 | 3300013308 | Ga0157375_10408137 | Ga0157375_104081372 | 258 |
| 251 | 3300014968 | Ga0157379_10437337 | Ga0157379_104373372 | 258 |
| 252 | 3300025911 | Ga0207654_10190410 | Ga0207654_101904102 | 258 |
| 253 | 3300025915 | Ga0207693_10003373 | Ga0207693_100033737 | 258 |
| 254 | 3300025916 | Ga0207663_10018192 | Ga0207663_100181923 | 258 |
| 255 | 3300025929 | Ga0207664_10021472 | Ga0207664_100214722 | 258 |
| 256 | 3300026088 | Ga0207641_10096417 | Ga0207641_100964172 | 258 |
| 257 | 3300027907 | Ga0207428_10011845 | Ga0207428_100118457 | 258 |
| 258 | 3300031251 | Ga0265327_10007884 | Ga0265327_100078844 | 258 |
| 259 | 3300034817 | Ga0373948_0010383 | Ga0373948_0010383_369_1331 | 258 |
| 260 | 3300035084 | Ga0373928_0041706 | Ga0373928_0041706_71_1033 | 258 |
| 261 | 3300035088 | Ga0373940_0017042 | Ga0373940_0017042_716_1678 | 258 |
| 262 | 3300035207 | Ga0373942_0031515 | Ga0373942_0031515_398_1360 | 258 |
| 263 | 3300035241 | Ga0373961_0007010 | Ga0373961_0007010_1178_2140 | 258 |
| 264 | 3300046543 | Ga0495645_0122063 | Ga0495645_0122063_791_1753 | 258 |
| 265 | 3300047471 | Ga0495684_0045672 | Ga0495684_0045672_1838_2779 | 258 |
| 266 | 3300048908 | Ga0496105_0058772 | Ga0496105_0058772_1521_2483 | 258 |
| 267 | 3300048909 | Ga0496106_0070230 | Ga0496106_0070230_1075_2037 | 258 |
| 268 | 3300048910 | Ga0496107_0026118 | Ga0496107_0026118_1100_2062 | 258 |
| 269 | 3300048911 | Ga0496108_0154782 | Ga0496108_0154782_502_1464 | 258 |
| 270 | 3300048917 | Ga0496114_0048452 | Ga0496114_0048452_71_1033 | 258 |
| 271 | 3300048918 | Ga0496115_0037058 | Ga0496115_0037058_2111_3073 | 258 |
| 272 | 3300050507 | nmdc:mga05p37_8967_c1 | nmdc:mga05p37_8967_c1_7099_8064 | 258 |
| 273 | 3300050512 | nmdc:mga0n895_5399_c1 | nmdc:mga0n895_5399_c1_5911_6876 | 258 |
| 274 | 3300050513 | nmdc:mga0rr50_103041_c1 | nmdc:mga0rr50_103041_c1_527_1492 | 258 |
| 275 | 3300050513 | nmdc:mga0rr50_176677_c1 | nmdc:mga0rr50_176677_c1_511_1473 | 258 |
| 276 | 3300050514 | nmdc:mga08x19_5528_c1 | nmdc:mga08x19_5528_c1_3879_4844 | 258 |
| 277 | 3300050515 | nmdc:mga0a205_197506_c1 | nmdc:mga0a205_197506_c1_184_1149 | 258 |
| 278 | 3300037068 | Ga0373925_0427215 | Ga0373925_0427215_164_1060 | 259 |
| 279 | 3300005535 | Ga0070684_100211824 | Ga0070684_1002118242 | 260 |
| 280 | 3300005577 | Ga0068857_100060034 | Ga0068857_1000600343 | 260 |
| 281 | 3300022467 | Ga0224712_10009118 | Ga0224712_100091182 | 260 |
| 282 | 3300026116 | Ga0207674_10120370 | Ga0207674_101203702 | 260 |
| 283 | 3300035086 | Ga0373934_0000291 | Ga0373934_0000291_1092_2054 | 260 |
| 284 | 3300035117 | Ga0373953_0001302 | Ga0373953_0001302_1061_2023 | 260 |
| 285 | 3300035118 | Ga0373954_0013242 | Ga0373954_0013242_217_1179 | 260 |
| 286 | 3300035172 | Ga0373955_0000058 | Ga0373955_0000058_26357_27319 | 260 |
| 287 | 3300035410 | Ga0373924_0000761 | Ga0373924_0000761_1076_2038 | 260 |
| 288 | 3300035724 | Ga0373933_0000046 | Ga0373933_0000046_59737_60699 | 260 |
| 289 | 3300036401 | Ga0373937_0000115 | Ga0373937_0000115_59757_60719 | 260 |
| 290 | 3300046454 | Ga0495592_0001162 | Ga0495592_0001162_15942_16904 | 260 |
| 291 | 3300046462 | Ga0495651_0000067 | Ga0495651_0000067_59755_60717 | 260 |
| 292 | 3300046463 | Ga0495653_0054717 | Ga0495653_0054717_1608_2570 | 260 |
| 293 | 3300046511 | Ga0495608_0000095 | Ga0495608_0000095_24792_25754 | 260 |
| 294 | 3300046516 | Ga0495628_0000226 | Ga0495628_0000226_15949_16911 | 260 |
| 295 | 3300046529 | Ga0495652_0000337 | Ga0495652_0000337_38758_39720 | 260 |
| 296 | 3300046536 | Ga0495587_0000078 | Ga0495587_0000078_59757_60719 | 260 |
| 297 | 3300046559 | Ga0495667_0000775 | Ga0495667_0000775_15949_16911 | 260 |
| 298 | 3300046675 | Ga0495657_0000098 | Ga0495657_0000098_15930_16892 | 260 |
| 299 | 3300046678 | Ga0495599_0000447 | Ga0495599_0000447_6583_7545 | 260 |
| 300 | 3300046679 | Ga0495623_0000845 | Ga0495623_0000845_15939_16901 | 260 |
| 301 | 3300046809 | Ga0495600_0040568 | Ga0495600_0040568_1674_2636 | 260 |
| 302 | 3300047317 | Ga0495604_0000142 | Ga0495604_0000142_59750_60712 | 260 |
| 303 | 3300047322 | Ga0495680_0000111 | Ga0495680_0000111_15949_16911 | 260 |
| 304 | 3300047444 | Ga0495675_0000910 | Ga0495675_0000910_1115_2077 | 260 |
| 305 | 3300048088 | Ga0495602_0000686 | Ga0495602_0000686_29976_30938 | 260 |
| 306 | 3300053084 | Ga0495595_0032540 | Ga0495595_0032540_1232_2194 | 260 |
| 307 | 3300005434 | Ga0070709_10039750 | Ga0070709_100397503 | 261 |
| 308 | 3300025929 | Ga0207664_10002889 | Ga0207664_100028892 | 261 |
| 309 | 3300005329 | Ga0070683_100383221 | Ga0070683_1003832212 | 263 |
| 310 | 3300005435 | Ga0070714_100155112 | Ga0070714_1001551122 | 263 |
| 311 | 3300005436 | Ga0070713_100174758 | Ga0070713_1001747582 | 263 |
| 312 | 3300026088 | Ga0207641_10288278 | Ga0207641_102882782 | 263 |
| 313 | 3300035116 | Ga0373945_0069969 | Ga0373945_0069969_73_1056 | 263 |
| 314 | 3300035118 | Ga0373954_0039507 | Ga0373954_0039507_199_1182 | 263 |
| 315 | 3300036401 | Ga0373937_0154880 | Ga0373937_0154880_893_1876 | 263 |
| 316 | 3300046462 | Ga0495651_0065007 | Ga0495651_0065007_649_1632 | 263 |
| 317 | 3300046511 | Ga0495608_0162264 | Ga0495608_0162264_273_1256 | 263 |
| 318 | 3300046516 | Ga0495628_0142528 | Ga0495628_0142528_456_1439 | 263 |
| 319 | 3300046531 | Ga0495665_0028072 | Ga0495665_0028072_694_1677 | 263 |
| 320 | 3300046533 | Ga0495640_0059482 | Ga0495640_0059482_15_998 | 263 |
| 321 | 3300046543 | Ga0495645_0177544 | Ga0495645_0177544_71_1054 | 263 |
| 322 | 3300046663 | Ga0495635_0136712 | Ga0495635_0136712_408_1391 | 263 |
| 323 | 3300046675 | Ga0495657_0176432 | Ga0495657_0176432_99_1082 | 263 |
| 324 | 3300046678 | Ga0495599_0062950 | Ga0495599_0062950_857_1840 | 263 |
| 325 | 3300046809 | Ga0495600_0121285 | Ga0495600_0121285_69_1052 | 263 |
| 326 | 3300047322 | Ga0495680_0047990 | Ga0495680_0047990_1673_2656 | 263 |
| 327 | 3300048088 | Ga0495602_0289347 | Ga0495602_0289347_138_1121 | 263 |
| 328 | 3300048911 | Ga0496108_0009716 | Ga0496108_0009716_1582_2499 | 263 |
| 329 | 3300053078 | Ga0495612_0128783 | Ga0495612_0128783_80_1063 | 263 |
| 330 | 3300005614 | Ga0068856_100233339 | Ga0068856_1002333392 | 264 |
| 331 | 3300020081 | Ga0206354_10140575 | Ga0206354_101405752 | 264 |
| 332 | 3300026116 | Ga0207674_10037897 | Ga0207674_100378972 | 264 |
| 333 | 3300035725 | Ga0373947_0135651 | Ga0373947_0135651_21_1004 | 264 |
| 334 | 3300005439 | Ga0070711_100108650 | Ga0070711_1001086502 | 265 |
| 335 | 3300006358 | Ga0068871_100180451 | Ga0068871_1001804512 | 265 |
| 336 | 3300009098 | Ga0105245_10500529 | Ga0105245_105005292 | 265 |
| 337 | 3300009545 | Ga0105237_10079901 | Ga0105237_100799012 | 265 |
| 338 | 3300009551 | Ga0105238_10499540 | Ga0105238_104995402 | 265 |
| 339 | 3300021388 | Ga0213875_10009737 | Ga0213875_100097374 | 265 |
| 340 | 3300037853 | Ga0436364_0747915 | Ga0436364_0747915_847_1785 | 265 |
| 341 | 3300048907 | Ga0496104_0146772 | Ga0496104_0146772_68_1006 | 265 |
| 342 | 3300048912 | Ga0496109_0041887 | Ga0496109_0041887_2617_3555 | 265 |
| 343 | 3300048917 | Ga0496114_0247939 | Ga0496114_0247939_66_1004 | 265 |
| 344 | 3300005439 | Ga0070711_100099795 | Ga0070711_1000997952 | 267 |
| 345 | 3300005466 | Ga0070685_10076248 | Ga0070685_100762481 | 267 |
| 346 | 3300005467 | Ga0070706_100178783 | Ga0070706_1001787832 | 267 |
| 347 | 3300005468 | Ga0070707_100060607 | Ga0070707_1000606074 | 267 |
| 348 | 3300005471 | Ga0070698_100392409 | Ga0070698_1003924091 | 267 |
| 349 | 3300005577 | Ga0068857_100163977 | Ga0068857_1001639772 | 267 |
| 350 | 3300005841 | Ga0068863_100322229 | Ga0068863_1003222292 | 267 |
| 351 | 3300006028 | Ga0070717_10137478 | Ga0070717_101374782 | 267 |
| 352 | 3300006871 | Ga0075434_100238577 | Ga0075434_1002385772 | 267 |
| 353 | 3300013100 | Ga0157373_10038638 | Ga0157373_100386382 | 267 |
| 354 | 3300025901 | Ga0207688_10009340 | Ga0207688_100093403 | 267 |
| 355 | 3300025910 | Ga0207684_10065876 | Ga0207684_100658763 | 267 |
| 356 | 3300025916 | Ga0207663_10107367 | Ga0207663_101073672 | 267 |
| 357 | 3300025922 | Ga0207646_10210101 | Ga0207646_102101011 | 267 |
| 358 | 3300026116 | Ga0207674_10008764 | Ga0207674_100087647 | 267 |
| 359 | 3300026118 | Ga0207675_100008580 | Ga0207675_1000085803 | 267 |
| 360 | 3300035083 | Ga0373926_0001318 | Ga0373926_0001318_5136_6113 | 267 |
| 361 | 3300035692 | Ga0373935_0005380 | Ga0373935_0005380_5663_6640 | 267 |
| 362 | 3300035725 | Ga0373947_0000012 | Ga0373947_0000012_104111_105088 | 267 |
| 363 | 3300046517 | Ga0495630_0270236 | Ga0495630_0270236_148_1125 | 267 |
| 364 | 3300046557 | Ga0495622_0139275 | Ga0495622_0139275_90_1088 | 267 |
| 365 | 3300028019 | Ga0224573_1002200 | Ga0224573_10022002 | 268 |
| 366 | 3300035086 | Ga0373934_0048968 | Ga0373934_0048968_671_1654 | 268 |
| 367 | 3300037853 | Ga0436364_0074139 | Ga0436364_0074139_844_1833 | 269 |
| 368 | 3300046477 | Ga0495664_0077523 | Ga0495664_0077523_362_1306 | 269 |
| 369 | 3300046559 | Ga0495667_0096810 | Ga0495667_0096810_775_1785 | 269 |
| 370 | 3300047321 | Ga0495676_0049931 | Ga0495676_0049931_670_1614 | 269 |
| 371 | 3300005355 | Ga0070671_100060210 | Ga0070671_1000602102 | 270 |
| 372 | 3300005364 | Ga0070673_100208795 | Ga0070673_1002087952 | 270 |
| 373 | 3300005440 | Ga0070705_100052232 | Ga0070705_1000522322 | 270 |
| 374 | 3300005441 | Ga0070700_100037831 | Ga0070700_1000378312 | 270 |
| 375 | 3300005467 | Ga0070706_100041618 | Ga0070706_1000416183 | 270 |
| 376 | 3300005471 | Ga0070698_100079619 | Ga0070698_1000796192 | 270 |
| 377 | 3300005530 | Ga0070679_100017200 | Ga0070679_1000172002 | 270 |
| 378 | 3300005539 | Ga0068853_100021702 | Ga0068853_1000217022 | 270 |
| 379 | 3300005544 | Ga0070686_100327818 | Ga0070686_1003278181 | 270 |
| 380 | 3300005563 | Ga0068855_100282024 | Ga0068855_1002820242 | 270 |
| 381 | 3300005719 | Ga0068861_100187713 | Ga0068861_1001877132 | 270 |
| 382 | 3300005840 | Ga0068870_10020961 | Ga0068870_100209612 | 270 |
| 383 | 3300005841 | Ga0068863_100074456 | Ga0068863_1000744562 | 270 |
| 384 | 3300006028 | Ga0070717_10004576 | Ga0070717_100045768 | 270 |
| 385 | 3300009545 | Ga0105237_10478340 | Ga0105237_104783402 | 270 |
| 386 | 3300013102 | Ga0157371_10164054 | Ga0157371_101640542 | 270 |
| 387 | 3300013105 | Ga0157369_10050496 | Ga0157369_100504962 | 270 |
| 388 | 3300014325 | Ga0163163_10270409 | Ga0163163_102704092 | 270 |
| 389 | 3300020077 | Ga0206351_10712940 | Ga0206351_107129402 | 270 |
| 390 | 3300020081 | Ga0206354_10185635 | Ga0206354_101856351 | 270 |
| 391 | 3300020082 | Ga0206353_10226583 | Ga0206353_102265832 | 270 |
| 392 | 3300022467 | Ga0224712_10021828 | Ga0224712_100218282 | 270 |
| 393 | 3300022467 | Ga0224712_10059808 | Ga0224712_100598082 | 270 |
| 394 | 3300025910 | Ga0207684_10001231 | Ga0207684_100012313 | 270 |
| 395 | 3300025912 | Ga0207707_10123833 | Ga0207707_101238333 | 270 |
| 396 | 3300025912 | Ga0207707_10206896 | Ga0207707_102068962 | 270 |
| 397 | 3300025919 | Ga0207657_10001310 | Ga0207657_1000131014 | 270 |
| 398 | 3300025928 | Ga0207700_10031540 | Ga0207700_100315403 | 270 |
| 399 | 3300025941 | Ga0207711_10196810 | Ga0207711_101968102 | 270 |
| 400 | 3300026067 | Ga0207678_10026431 | Ga0207678_100264316 | 270 |
| 401 | 3300026075 | Ga0207708_10029372 | Ga0207708_100293722 | 270 |
| 402 | 3300026088 | Ga0207641_10057581 | Ga0207641_100575812 | 270 |
| 403 | 3300026088 | Ga0207641_10214251 | Ga0207641_102142512 | 270 |
| 404 | 3300026142 | Ga0207698_10026148 | Ga0207698_100261483 | 270 |
| 405 | 3300035086 | Ga0373934_0012865 | Ga0373934_0012865_1656_2663 | 270 |
| 406 | 3300035086 | Ga0373934_0053390 | Ga0373934_0053390_489_1487 | 270 |
| 407 | 3300035089 | Ga0373944_0003180 | Ga0373944_0003180_2737_3744 | 270 |
| 408 | 3300035112 | Ga0373932_0051135 | Ga0373932_0051135_44_1045 | 270 |
| 409 | 3300035113 | Ga0373936_0063976 | Ga0373936_0063976_313_1314 | 270 |
| 410 | 3300035116 | Ga0373945_0005152 | Ga0373945_0005152_480_1487 | 270 |
| 411 | 3300035117 | Ga0373953_0002922 | Ga0373953_0002922_2342_3349 | 270 |
| 412 | 3300035170 | Ga0373943_0005908 | Ga0373943_0005908_1899_2906 | 270 |
| 413 | 3300035171 | Ga0373946_0016025 | Ga0373946_0016025_1648_2655 | 270 |
| 414 | 3300035241 | Ga0373961_0013273 | Ga0373961_0013273_528_1508 | 270 |
| 415 | 3300035692 | Ga0373935_0031617 | Ga0373935_0031617_203_1198 | 270 |
| 416 | 3300035695 | Ga0373927_0014004 | Ga0373927_0014004_2969_3976 | 270 |
| 417 | 3300035724 | Ga0373933_0010382 | Ga0373933_0010382_1663_2670 | 270 |
| 418 | 3300035725 | Ga0373947_0072879 | Ga0373947_0072879_365_1372 | 270 |
| 419 | 3300036401 | Ga0373937_0147397 | Ga0373937_0147397_374_1372 | 270 |
| 420 | 3300037068 | Ga0373925_0035686 | Ga0373925_0035686_1938_2945 | 270 |
| 421 | 3300046454 | Ga0495592_0071279 | Ga0495592_0071279_1327_2334 | 270 |
| 422 | 3300046459 | Ga0495629_0048520 | Ga0495629_0048520_1232_2239 | 270 |
| 423 | 3300046461 | Ga0495641_0008836 | Ga0495641_0008836_3285_4292 | 270 |
| 424 | 3300046462 | Ga0495651_0012113 | Ga0495651_0012113_1808_2815 | 270 |
| 425 | 3300046463 | Ga0495653_0028153 | Ga0495653_0028153_1102_2109 | 270 |
| 426 | 3300046463 | Ga0495653_0075746 | Ga0495653_0075746_959_1999 | 270 |
| 427 | 3300046472 | Ga0495580_0027053 | Ga0495580_0027053_1583_2590 | 270 |
| 428 | 3300046473 | Ga0495582_0007311 | Ga0495582_0007311_4228_5235 | 270 |
| 429 | 3300046475 | Ga0495639_0052878 | Ga0495639_0052878_105_1112 | 270 |
| 430 | 3300046476 | Ga0495662_0021422 | Ga0495662_0021422_1380_2387 | 270 |
| 431 | 3300046477 | Ga0495664_0024151 | Ga0495664_0024151_746_1753 | 270 |
| 432 | 3300046499 | Ga0495594_0034273 | Ga0495594_0034273_1117_2124 | 270 |
| 433 | 3300046511 | Ga0495608_0013938 | Ga0495608_0013938_1479_2486 | 270 |
| 434 | 3300046511 | Ga0495608_0130911 | Ga0495608_0130911_379_1389 | 270 |
| 435 | 3300046514 | Ga0495618_0030072 | Ga0495618_0030072_1133_2140 | 270 |
| 436 | 3300046517 | Ga0495630_0033879 | Ga0495630_0033879_1557_2564 | 270 |
| 437 | 3300046526 | Ga0495666_0008890 | Ga0495666_0008890_1778_2785 | 270 |
| 438 | 3300046529 | Ga0495652_0035986 | Ga0495652_0035986_1379_2386 | 270 |
| 439 | 3300046531 | Ga0495665_0010206 | Ga0495665_0010206_1778_2785 | 270 |
| 440 | 3300046533 | Ga0495640_0023445 | Ga0495640_0023445_2387_3394 | 270 |
| 441 | 3300046535 | Ga0495586_0026236 | Ga0495586_0026236_1386_2393 | 270 |
| 442 | 3300046543 | Ga0495645_0023605 | Ga0495645_0023605_1379_2386 | 270 |
| 443 | 3300046559 | Ga0495667_0018223 | Ga0495667_0018223_2635_3642 | 270 |
| 444 | 3300046559 | Ga0495667_0081206 | Ga0495667_0081206_797_1795 | 270 |
| 445 | 3300046559 | Ga0495667_0194654 | Ga0495667_0194654_323_1285 | 270 |
| 446 | 3300046642 | Ga0495634_0032839 | Ga0495634_0032839_1822_2829 | 270 |
| 447 | 3300046663 | Ga0495635_0069113 | Ga0495635_0069113_782_1789 | 270 |
| 448 | 3300046675 | Ga0495657_0032131 | Ga0495657_0032131_1557_2564 | 270 |
| 449 | 3300046675 | Ga0495657_0063864 | Ga0495657_0063864_886_1896 | 270 |
| 450 | 3300046679 | Ga0495623_0008762 | Ga0495623_0008762_1043_2050 | 270 |
| 451 | 3300046680 | Ga0495646_0011512 | Ga0495646_0011512_4031_5038 | 270 |
| 452 | 3300046683 | Ga0495658_0005794 | Ga0495658_0005794_1271_2278 | 270 |
| 453 | 3300046689 | Ga0495613_0020505 | Ga0495613_0020505_2634_3641 | 270 |
| 454 | 3300046690 | Ga0495624_0010866 | Ga0495624_0010866_1130_2137 | 270 |
| 455 | 3300046809 | Ga0495600_0020510 | Ga0495600_0020510_1663_2670 | 270 |
| 456 | 3300047315 | Ga0495581_0004305 | Ga0495581_0004305_4288_5295 | 270 |
| 457 | 3300047317 | Ga0495604_0028691 | Ga0495604_0028691_1062_2069 | 270 |
| 458 | 3300047319 | Ga0495674_0021622 | Ga0495674_0021622_3650_4657 | 270 |
| 459 | 3300047319 | Ga0495674_0270437 | Ga0495674_0270437_48_1058 | 270 |
| 460 | 3300047321 | Ga0495676_0048961 | Ga0495676_0048961_1294_2301 | 270 |
| 461 | 3300047322 | Ga0495680_0040005 | Ga0495680_0040005_1514_2512 | 270 |
| 462 | 3300047322 | Ga0495680_0139256 | Ga0495680_0139256_537_1547 | 270 |
| 463 | 3300047444 | Ga0495675_0010201 | Ga0495675_0010201_2177_3184 | 270 |
| 464 | 3300047471 | Ga0495684_0015171 | Ga0495684_0015171_3447_4454 | 270 |
| 465 | 3300047471 | Ga0495684_0058386 | Ga0495684_0058386_1419_2429 | 270 |
| 466 | 3300047673 | Ga0495593_0017301 | Ga0495593_0017301_1102_2109 | 270 |
| 467 | 3300048905 | Ga0496102_0428916 | Ga0496102_0428916_108_1109 | 270 |
| 468 | 3300048907 | Ga0496104_0102413 | Ga0496104_0102413_1202_2203 | 270 |
| 469 | 3300048908 | Ga0496105_0008601 | Ga0496105_0008601_2921_3922 | 270 |
| 470 | 3300048911 | Ga0496108_0367669 | Ga0496108_0367669_169_1170 | 270 |
| 471 | 3300048913 | Ga0496110_0127275 | Ga0496110_0127275_997_2019 | 270 |
| 472 | 3300048914 | Ga0496111_0012249 | Ga0496111_0012249_3997_4998 | 270 |
| 473 | 3300053077 | Ga0495601_0064978 | Ga0495601_0064978_196_1203 | 270 |
| 474 | 3300053078 | Ga0495612_0008818 | Ga0495612_0008818_2864_3862 | 270 |
| 475 | 3300053085 | Ga0495619_0007442 | Ga0495619_0007442_2387_3394 | 270 |
| 476 | 3300005338 | Ga0068868_100185278 | Ga0068868_1001852782 | 271 |
| 477 | 3300005614 | Ga0068856_100071590 | Ga0068856_1000715902 | 271 |
| 478 | 3300006871 | Ga0075434_100059863 | Ga0075434_1000598634 | 271 |
| 479 | 3300009147 | Ga0114129_10343872 | Ga0114129_103438722 | 271 |
| 480 | 3300026023 | Ga0207677_10185444 | Ga0207677_101854442 | 271 |
| 481 | 3300026078 | Ga0207702_10425031 | Ga0207702_104250312 | 271 |
| 482 | 3300028666 | Ga0265336_10022334 | Ga0265336_100223342 | 271 |
| 483 | 3300028800 | Ga0265338_10020419 | Ga0265338_100204192 | 271 |
| 484 | 3300039450 | Ga0436363_0403894 | Ga0436363_0403894_1059_2000 | 271 |
| 485 | 3300050513 | nmdc:mga0rr50_74415_c1 | nmdc:mga0rr50_74415_c1_1122_2084 | 271 |
| 486 | 3300005467 | Ga0070706_100117356 | Ga0070706_1001173562 | 272 |
| 487 | 3300005468 | Ga0070707_100007193 | Ga0070707_1000071939 | 272 |
| 488 | 3300005471 | Ga0070698_100000052 | Ga0070698_10000005231 | 272 |
| 489 | 3300005471 | Ga0070698_100001531 | Ga0070698_10000153117 | 272 |
| 490 | 3300005471 | Ga0070698_100062705 | Ga0070698_1000627053 | 272 |
| 491 | 3300005518 | Ga0070699_100000680 | Ga0070699_10000068014 | 272 |
| 492 | 3300006028 | Ga0070717_10107040 | Ga0070717_101070402 | 272 |
| 493 | 3300025908 | Ga0207643_10014378 | Ga0207643_100143783 | 272 |
| 494 | 3300025910 | Ga0207684_10148743 | Ga0207684_101487432 | 272 |
| 495 | 3300025922 | Ga0207646_10005738 | Ga0207646_100057385 | 272 |
| 496 | 3300005434 | Ga0070709_10001842 | Ga0070709_1000184210 | 273 |
| 497 | 3300005434 | Ga0070709_10015096 | Ga0070709_100150963 | 273 |
| 498 | 3300005435 | Ga0070714_100029642 | Ga0070714_1000296422 | 273 |
| 499 | 3300005435 | Ga0070714_100034292 | Ga0070714_1000342924 | 273 |
| 500 | 3300005435 | Ga0070714_100084343 | Ga0070714_1000843432 | 273 |
| 501 | 3300005435 | Ga0070714_100142812 | Ga0070714_1001428122 | 273 |
| 502 | 3300005436 | Ga0070713_100006439 | Ga0070713_1000064398 | 273 |
| 503 | 3300005436 | Ga0070713_100033666 | Ga0070713_1000336664 | 273 |
| 504 | 3300005436 | Ga0070713_100036237 | Ga0070713_1000362373 | 273 |
| 505 | 3300005436 | Ga0070713_100094123 | Ga0070713_1000941233 | 273 |
| 506 | 3300005436 | Ga0070713_100129657 | Ga0070713_1001296572 | 273 |
| 507 | 3300005437 | Ga0070710_10002857 | Ga0070710_100028579 | 273 |
| 508 | 3300005437 | Ga0070710_10022953 | Ga0070710_100229532 | 273 |
| 509 | 3300005439 | Ga0070711_100017584 | Ga0070711_1000175842 | 273 |
| 510 | 3300005439 | Ga0070711_100047566 | Ga0070711_1000475662 | 273 |
| 511 | 3300005445 | Ga0070708_100464717 | Ga0070708_1004647171 | 273 |
| 512 | 3300005458 | Ga0070681_10362988 | Ga0070681_103629882 | 273 |
| 513 | 3300005467 | Ga0070706_100024074 | Ga0070706_1000240745 | 273 |
| 514 | 3300005468 | Ga0070707_100002470 | Ga0070707_10000247011 | 273 |
| 515 | 3300005471 | Ga0070698_100003355 | Ga0070698_10000335511 | 273 |
| 516 | 3300005471 | Ga0070698_100245607 | Ga0070698_1002456072 | 273 |
| 517 | 3300005614 | Ga0068856_100024199 | Ga0068856_1000241994 | 273 |
| 518 | 3300005842 | Ga0068858_100404975 | Ga0068858_1004049752 | 273 |
| 519 | 3300006028 | Ga0070717_10024868 | Ga0070717_100248685 | 273 |
| 520 | 3300006028 | Ga0070717_10047421 | Ga0070717_100474214 | 273 |
| 521 | 3300006028 | Ga0070717_10209736 | Ga0070717_102097362 | 273 |
| 522 | 3300006163 | Ga0070715_10005103 | Ga0070715_100051032 | 273 |
| 523 | 3300006163 | Ga0070715_10013460 | Ga0070715_100134602 | 273 |
| 524 | 3300006173 | Ga0070716_100009787 | Ga0070716_1000097875 | 273 |
| 525 | 3300006173 | Ga0070716_100017430 | Ga0070716_1000174302 | 273 |
| 526 | 3300006173 | Ga0070716_100040838 | Ga0070716_1000408382 | 273 |
| 527 | 3300006175 | Ga0070712_100099026 | Ga0070712_1000990262 | 273 |
| 528 | 3300006852 | Ga0075433_10055501 | Ga0075433_100555012 | 273 |
| 529 | 3300006871 | Ga0075434_100080133 | Ga0075434_1000801333 | 273 |
| 530 | 3300013105 | Ga0157369_10066884 | Ga0157369_100668842 | 273 |
| 531 | 3300013296 | Ga0157374_10122690 | Ga0157374_101226902 | 273 |
| 532 | 3300025898 | Ga0207692_10001454 | Ga0207692_100014542 | 273 |
| 533 | 3300025898 | Ga0207692_10016652 | Ga0207692_100166523 | 273 |
| 534 | 3300025898 | Ga0207692_10073866 | Ga0207692_100738662 | 273 |
| 535 | 3300025905 | Ga0207685_10022255 | Ga0207685_100222552 | 273 |
| 536 | 3300025906 | Ga0207699_10001649 | Ga0207699_100016498 | 273 |
| 537 | 3300025906 | Ga0207699_10006888 | Ga0207699_100068884 | 273 |
| 538 | 3300025910 | Ga0207684_10003550 | Ga0207684_100035506 | 273 |
| 539 | 3300025915 | Ga0207693_10001823 | Ga0207693_1000182317 | 273 |
| 540 | 3300025915 | Ga0207693_10015224 | Ga0207693_100152245 | 273 |
| 541 | 3300025915 | Ga0207693_10273891 | Ga0207693_102738912 | 273 |
| 542 | 3300025915 | Ga0207693_10426998 | Ga0207693_104269981 | 273 |
| 543 | 3300025915 | Ga0207693_10453916 | Ga0207693_104539161 | 273 |
| 544 | 3300025916 | Ga0207663_10024199 | Ga0207663_100241992 | 273 |
| 545 | 3300025916 | Ga0207663_10024217 | Ga0207663_100242172 | 273 |
| 546 | 3300025916 | Ga0207663_10067652 | Ga0207663_100676522 | 273 |
| 547 | 3300025922 | Ga0207646_10000410 | Ga0207646_100004109 | 273 |
| 548 | 3300025922 | Ga0207646_10039734 | Ga0207646_100397343 | 273 |
| 549 | 3300025928 | Ga0207700_10007761 | Ga0207700_100077616 | 273 |
| 550 | 3300025928 | Ga0207700_10008631 | Ga0207700_100086312 | 273 |
| 551 | 3300025928 | Ga0207700_10009627 | Ga0207700_100096275 | 273 |
| 552 | 3300025928 | Ga0207700_10034111 | Ga0207700_100341113 | 273 |
| 553 | 3300025929 | Ga0207664_10016279 | Ga0207664_100162792 | 273 |
| 554 | 3300025929 | Ga0207664_10145961 | Ga0207664_101459612 | 273 |
| 555 | 3300025929 | Ga0207664_10481950 | Ga0207664_104819502 | 273 |
| 556 | 3300025939 | Ga0207665_10000820 | Ga0207665_100008204 | 273 |
| 557 | 3300025939 | Ga0207665_10004211 | Ga0207665_100042118 | 273 |
| 558 | 3300025939 | Ga0207665_10078040 | Ga0207665_100780402 | 273 |
| 559 | 3300028800 | Ga0265338_10011760 | Ga0265338_100117609 | 273 |
| 560 | 3300028800 | Ga0265338_10023545 | Ga0265338_100235456 | 273 |
| 561 | 3300035111 | Ga0373923_0021064 | Ga0373923_0021064_538_1488 | 273 |
| 562 | 3300035113 | Ga0373936_0009357 | Ga0373936_0009357_1602_2552 | 273 |
| 563 | 3300035118 | Ga0373954_0015957 | Ga0373954_0015957_241_1215 | 273 |
| 564 | 3300035119 | Ga0373956_0011541 | Ga0373956_0011541_874_1827 | 273 |
| 565 | 3300035120 | Ga0373957_0048340 | Ga0373957_0048340_456_1409 | 273 |
| 566 | 3300035410 | Ga0373924_0004232 | Ga0373924_0004232_1059_2009 | 273 |
| 567 | 3300035692 | Ga0373935_0005652 | Ga0373935_0005652_2991_3941 | 273 |
| 568 | 3300035692 | Ga0373935_0024881 | Ga0373935_0024881_2260_3213 | 273 |
| 569 | 3300035692 | Ga0373935_0083509 | Ga0373935_0083509_591_1547 | 273 |
| 570 | 3300035692 | Ga0373935_0166036 | Ga0373935_0166036_71_1021 | 273 |
| 571 | 3300037068 | Ga0373925_0022033 | Ga0373925_0022033_2930_3883 | 273 |
| 572 | 3300037068 | Ga0373925_0162935 | Ga0373925_0162935_165_1121 | 273 |
| 573 | 3300037068 | Ga0373925_0167820 | Ga0373925_0167820_18_971 | 273 |
| 574 | 3300044694 | Ga0466963_0140694 | Ga0466963_0140694_583_1539 | 273 |
| 575 | 3300046454 | Ga0495592_0006368 | Ga0495592_0006368_5367_6320 | 273 |
| 576 | 3300046459 | Ga0495629_0001762 | Ga0495629_0001762_7795_8745 | 273 |
| 577 | 3300046461 | Ga0495641_0005823 | Ga0495641_0005823_6072_7022 | 273 |
| 578 | 3300046462 | Ga0495651_0003224 | Ga0495651_0003224_89_1042 | 273 |
| 579 | 3300046462 | Ga0495651_0041016 | Ga0495651_0041016_2242_3192 | 273 |
| 580 | 3300046463 | Ga0495653_0046642 | Ga0495653_0046642_405_1355 | 273 |
| 581 | 3300046473 | Ga0495582_0003438 | Ga0495582_0003438_3022_3972 | 273 |
| 582 | 3300046475 | Ga0495639_0007273 | Ga0495639_0007273_493_1443 | 273 |
| 583 | 3300046477 | Ga0495664_0017914 | Ga0495664_0017914_1175_2125 | 273 |
| 584 | 3300046477 | Ga0495664_0057993 | Ga0495664_0057993_411_1361 | 273 |
| 585 | 3300046514 | Ga0495618_0012085 | Ga0495618_0012085_411_1361 | 273 |
| 586 | 3300046516 | Ga0495628_0046686 | Ga0495628_0046686_244_1197 | 273 |
| 587 | 3300046529 | Ga0495652_0004687 | Ga0495652_0004687_7355_8308 | 273 |
| 588 | 3300046531 | Ga0495665_0001232 | Ga0495665_0001232_7472_8422 | 273 |
| 589 | 3300046533 | Ga0495640_0012221 | Ga0495640_0012221_321_1277 | 273 |
| 590 | 3300046535 | Ga0495586_0011987 | Ga0495586_0011987_2751_3701 | 273 |
| 591 | 3300046536 | Ga0495587_0007741 | Ga0495587_0007741_2011_2964 | 273 |
| 592 | 3300046543 | Ga0495645_0008366 | Ga0495645_0008366_4242_5195 | 273 |
| 593 | 3300046543 | Ga0495645_0027262 | Ga0495645_0027262_2309_3259 | 273 |
| 594 | 3300046543 | Ga0495645_0031499 | Ga0495645_0031499_2419_3375 | 273 |
| 595 | 3300046543 | Ga0495645_0182305 | Ga0495645_0182305_434_1384 | 273 |
| 596 | 3300046559 | Ga0495667_0001084 | Ga0495667_0001084_5493_6446 | 273 |
| 597 | 3300046675 | Ga0495657_0027700 | Ga0495657_0027700_312_1265 | 273 |
| 598 | 3300046679 | Ga0495623_0037632 | Ga0495623_0037632_2074_3027 | 273 |
| 599 | 3300046683 | Ga0495658_0004740 | Ga0495658_0004740_3049_3999 | 273 |
| 600 | 3300046689 | Ga0495613_0019933 | Ga0495613_0019933_3158_4108 | 273 |
| 601 | 3300046690 | Ga0495624_0031339 | Ga0495624_0031339_1653_2603 | 273 |
| 602 | 3300046690 | Ga0495624_0044841 | Ga0495624_0044841_1184_2140 | 273 |
| 603 | 3300046809 | Ga0495600_0008555 | Ga0495600_0008555_5047_6000 | 273 |
| 604 | 3300047315 | Ga0495581_0008580 | Ga0495581_0008580_2030_2980 | 273 |
| 605 | 3300047317 | Ga0495604_0009707 | Ga0495604_0009707_5105_6058 | 273 |
| 606 | 3300047319 | Ga0495674_0004597 | Ga0495674_0004597_7812_8768 | 273 |
| 607 | 3300047319 | Ga0495674_0076958 | Ga0495674_0076958_1413_2363 | 273 |
| 608 | 3300047319 | Ga0495674_0342196 | Ga0495674_0342196_92_1045 | 273 |
| 609 | 3300047322 | Ga0495680_0007755 | Ga0495680_0007755_5343_6296 | 273 |
| 610 | 3300047322 | Ga0495680_0031589 | Ga0495680_0031589_2437_3387 | 273 |
| 611 | 3300047471 | Ga0495684_0013810 | Ga0495684_0013810_5018_5971 | 273 |
| 612 | 3300047673 | Ga0495593_0001196 | Ga0495593_0001196_11074_12024 | 273 |
| 613 | 3300048903 | Ga0496100_0017830 | Ga0496100_0017830_1444_2391 | 273 |
| 614 | 3300048905 | Ga0496102_0098354 | Ga0496102_0098354_1038_1985 | 273 |
| 615 | 3300048907 | Ga0496104_0005141 | Ga0496104_0005141_5176_6123 | 273 |
| 616 | 3300048908 | Ga0496105_0003238 | Ga0496105_0003238_5387_6334 | 273 |
| 617 | 3300048912 | Ga0496109_0214400 | Ga0496109_0214400_90_1037 | 273 |
| 618 | 3300048915 | Ga0496112_0012492 | Ga0496112_0012492_2050_2997 | 273 |
| 619 | 3300048916 | Ga0496113_0008348 | Ga0496113_0008348_2087_3034 | 273 |
| 620 | 3300048917 | Ga0496114_0127014 | Ga0496114_0127014_714_1661 | 273 |
| 621 | 3300048918 | Ga0496115_0035600 | Ga0496115_0035600_1667_2614 | 273 |
| 622 | 3300050512 | nmdc:mga0n895_10653_c1 | nmdc:mga0n895_10653_c1_5453_6400 | 273 |
| 623 | 3300050514 | nmdc:mga08x19_54970_c1 | nmdc:mga08x19_54970_c1_431_1378 | 273 |
| 624 | 3300053077 | Ga0495601_0039898 | Ga0495601_0039898_1549_2505 | 273 |
| 625 | 3300053078 | Ga0495612_0019936 | Ga0495612_0019936_1085_2041 | 273 |
| 626 | 3300053084 | Ga0495595_0003727 | Ga0495595_0003727_2451_3401 | 273 |
| 627 | 3300053084 | Ga0495595_0010621 | Ga0495595_0010621_2518_3471 | 273 |
| 628 | 3300053085 | Ga0495619_0009673 | Ga0495619_0009673_1263_2213 | 273 |
| 629 | 3300005434 | Ga0070709_10000154 | Ga0070709_1000015418 | 274 |
| 630 | 3300005435 | Ga0070714_100006056 | Ga0070714_1000060568 | 274 |
| 631 | 3300005436 | Ga0070713_100000392 | Ga0070713_1000003924 | 274 |
| 632 | 3300005437 | Ga0070710_10001998 | Ga0070710_100019982 | 274 |
| 633 | 3300005439 | Ga0070711_100004404 | Ga0070711_1000044049 | 274 |
| 634 | 3300005445 | Ga0070708_100006382 | Ga0070708_1000063827 | 274 |
| 635 | 3300005467 | Ga0070706_100013788 | Ga0070706_1000137882 | 274 |
| 636 | 3300005467 | Ga0070706_100082273 | Ga0070706_1000822732 | 274 |
| 637 | 3300005467 | Ga0070706_100197160 | Ga0070706_1001971602 | 274 |
| 638 | 3300005468 | Ga0070707_100029449 | Ga0070707_1000294495 | 274 |
| 639 | 3300005471 | Ga0070698_100073638 | Ga0070698_1000736382 | 274 |
| 640 | 3300005471 | Ga0070698_100080388 | Ga0070698_1000803882 | 274 |
| 641 | 3300006028 | Ga0070717_10000872 | Ga0070717_100008728 | 274 |
| 642 | 3300006163 | Ga0070715_10010248 | Ga0070715_100102484 | 274 |
| 643 | 3300006173 | Ga0070716_100000326 | Ga0070716_1000003265 | 274 |
| 644 | 3300006175 | Ga0070712_100001194 | Ga0070712_10000119415 | 274 |
| 645 | 3300006175 | Ga0070712_100319642 | Ga0070712_1003196422 | 274 |
| 646 | 3300006175 | Ga0070712_100390879 | Ga0070712_1003908791 | 274 |
| 647 | 3300025898 | Ga0207692_10000150 | Ga0207692_100001509 | 274 |
| 648 | 3300025906 | Ga0207699_10000205 | Ga0207699_1000020532 | 274 |
| 649 | 3300025910 | Ga0207684_10047080 | Ga0207684_100470802 | 274 |
| 650 | 3300025915 | Ga0207693_10000355 | Ga0207693_1000035515 | 274 |
| 651 | 3300025922 | Ga0207646_10029887 | Ga0207646_100298874 | 274 |
| 652 | 3300025928 | Ga0207700_10006240 | Ga0207700_100062401 | 274 |
| 653 | 3300025929 | Ga0207664_10001022 | Ga0207664_1000102216 | 274 |
| 654 | 3300025939 | Ga0207665_10000480 | Ga0207665_1000048013 | 274 |
| 655 | 3300039437 | Ga0436365_0875851 | Ga0436365_0875851_78_1058 | 274 |
| 656 | 3300005435 | Ga0070714_100000250 | Ga0070714_10000025032 | 275 |
| 657 | 3300005436 | Ga0070713_100046325 | Ga0070713_1000463252 | 275 |
| 658 | 3300005617 | Ga0068859_100161621 | Ga0068859_1001616212 | 275 |
| 659 | 3300006175 | Ga0070712_100186137 | Ga0070712_1001861372 | 275 |
| 660 | 3300006931 | Ga0097620_100161632 | Ga0097620_1001616323 | 275 |
| 661 | 3300009093 | Ga0105240_10132544 | Ga0105240_101325442 | 275 |
| 662 | 3300009176 | Ga0105242_10081715 | Ga0105242_100817152 | 275 |
| 663 | 3300021388 | Ga0213875_10014031 | Ga0213875_100140315 | 275 |
| 664 | 3300025920 | Ga0207649_10067066 | Ga0207649_100670662 | 275 |
| 665 | 3300025928 | Ga0207700_10080243 | Ga0207700_100802432 | 275 |
| 666 | 3300025929 | Ga0207664_10001579 | Ga0207664_100015798 | 275 |
| 667 | 3300025929 | Ga0207664_10017269 | Ga0207664_100172691 | 275 |
| 668 | 3300025933 | Ga0207706_10008680 | Ga0207706_100086802 | 275 |
| 669 | 3300025939 | Ga0207665_10015042 | Ga0207665_100150422 | 275 |
| 670 | 3300025942 | Ga0207689_10012065 | Ga0207689_100120654 | 275 |
| 671 | 3300026121 | Ga0207683_10006285 | Ga0207683_100062855 | 275 |
| 672 | 3300035724 | Ga0373933_0106653 | Ga0373933_0106653_298_1269 | 275 |
| 673 | 3300037853 | Ga0436364_1050209 | Ga0436364_1050209_231_1211 | 275 |
| 674 | 3300046462 | Ga0495651_0018552 | Ga0495651_0018552_1587_2558 | 275 |
| 675 | 3300046463 | Ga0495653_0120745 | Ga0495653_0120745_409_1380 | 275 |
| 676 | 3300046477 | Ga0495664_0018583 | Ga0495664_0018583_2016_2987 | 275 |
| 677 | 3300046511 | Ga0495608_0093154 | Ga0495608_0093154_476_1447 | 275 |
| 678 | 3300046516 | Ga0495628_0136949 | Ga0495628_0136949_328_1299 | 275 |
| 679 | 3300046529 | Ga0495652_0035183 | Ga0495652_0035183_844_1815 | 275 |
| 680 | 3300046559 | Ga0495667_0018435 | Ga0495667_0018435_633_1604 | 275 |
| 681 | 3300046663 | Ga0495635_0047735 | Ga0495635_0047735_1066_2037 | 275 |
| 682 | 3300046675 | Ga0495657_0029918 | Ga0495657_0029918_2126_3097 | 275 |
| 683 | 3300046678 | Ga0495599_0036480 | Ga0495599_0036480_1173_2144 | 275 |
| 684 | 3300047317 | Ga0495604_0081466 | Ga0495604_0081466_882_1853 | 275 |
| 685 | 3300047319 | Ga0495674_0134740 | Ga0495674_0134740_492_1463 | 275 |
| 686 | 3300047322 | Ga0495680_0018841 | Ga0495680_0018841_1446_2417 | 275 |
| 687 | 3300047471 | Ga0495684_0122860 | Ga0495684_0122860_268_1239 | 275 |
| 688 | 3300048088 | Ga0495602_0023040 | Ga0495602_0023040_1586_2557 | 275 |
| 689 | 3300053085 | Ga0495619_0108689 | Ga0495619_0108689_595_1566 | 275 |
| 690 | 3300044694 | Ga0466963_0062727 | Ga0466963_0062727_315_1298 | 277 |
| 691 | 3300048915 | Ga0496112_0468566 | Ga0496112_0468566_107_1090 | 277 |
| 692 | 3300005327 | Ga0070658_10219132 | Ga0070658_102191322 | 278 |
| 693 | 3300005343 | Ga0070687_100163035 | Ga0070687_1001630351 | 278 |
| 694 | 3300005434 | Ga0070709_10204086 | Ga0070709_102040862 | 278 |
| 695 | 3300006358 | Ga0068871_100150648 | Ga0068871_1001506482 | 278 |
| 696 | 3300025906 | Ga0207699_10066224 | Ga0207699_100662241 | 278 |
| 697 | 3300025909 | Ga0207705_10294298 | Ga0207705_102942982 | 278 |
| 698 | 3300025936 | Ga0207670_10040413 | Ga0207670_100404132 | 278 |
| 699 | 3300026067 | Ga0207678_10002951 | Ga0207678_1000295113 | 278 |
| 700 | 3300026089 | Ga0207648_10072108 | Ga0207648_100721082 | 278 |
| 701 | 3300035092 | Ga0373952_0013920 | Ga0373952_0013920_296_1276 | 278 |
| 702 | 3300039437 | Ga0436365_0960103 | Ga0436365_0960103_33_1022 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.9069 | 139 | 213 |
| 2cua-assembly2.cif.gz_B | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9009 | 139 | 213 |
| 2cua-assembly1.cif.gz_A | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9003 | 139 | 211 |
| 6pty-assembly2.cif.gz_B | soluble model of human cua (tt3lh) | 0.897 | 139 | 211 |
| 2fwl-assembly1.cif.gz_B | the cytochrome c552/cua complex from thermus thermophilus | 0.8903 | 140 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hb3B01 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9163 | 138 | 225 | 2.60.40.420 |
| 5wehH02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9142 | 138 | 222 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9032 | 139 | 213 | 2.60.40.420 |
| 4txvD00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8653 | 137 | 227 | 2.60.40.420 |
| 4hcfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.843 | 140 | 212 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534X6Q5-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.938 | 139 | 224 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A1B7W373-F1-model_v4 | Cytochrome C oxidase subunit II | 0.9362 | 135 | 226 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A2R6HYA6-F1-model_v4 | Cytochrome c oxidase subunit II | 0.9327 | 140 | 226 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-E1IGZ6-F1-model_v4 | Cytochrome c oxidase, subunit II | 0.9301 | 139 | 222 |
GO:0004129
GO:0005507 GO:0016020 GO:0020037 GO:0042773 |
| AF-A0A534AHQ0-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.93 | 139 | 229 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar