F476203

General Info

Members Datasets Scaffolds Average Seq Length
702 250 702 290

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000154|Ga0070709_1000015418
Length 341
Sequence MAQNPAATDPGAGGHAAASGGAEPRHGLRLLLMWIPLSAAAILIIWFVWYPHLPPGRMSDAASGQQFDIAVLAVTAAPVVIGVLLYMIYAIVVWRARPGDEGDGPPIHGHTKVQAWWIIITSLVVLWAFAFGTYQLAQPGGAGGGQGPSPIWPLHGAQTTAWSPSSNDMLQVQVIGQQWAFTYRFPQFGGMESTMLELPNNMPVEFHVTSLDVIHSFWAYQLGVKADANPQVDNIAYVKPHQLGSFVVRCNELCGFWHAAMFNYGRVVTPTAFQGWARSLQLKELRAGVLAALPPYALTYDPTVIPQLGRDIVKVAGITGANGYYYPGPQAGTPHGDPVSP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.98
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10219132 3300005327 Unclassified 1609
2 Ga0070683_100383221 3300005329 Bacteria 1340
3 Ga0070682_100054068 3300005337 Bacteria 2518
4 Ga0068868_100140033 3300005338 Bacteria 1985
5 Ga0068868_100185278 3300005338 Bacteria 1729
6 Ga0068868_100275250 3300005338 Unclassified 1423
7 Ga0070687_100163035 3300005343 Bacteria 1319
8 Ga0070671_100060210 3300005355 Bacteria 3161
9 Ga0070673_100208795 3300005364 Unclassified 1685
10 Ga0070709_10000154 3300005434 Bacteria 45206
11 Ga0070709_10001842 3300005434 Bacteria 11499
12 Ga0070709_10015096 3300005434 Bacteria 4388
13 Ga0070709_10039750 3300005434 Bacteria 2888
14 Ga0070709_10204086 3300005434 Bacteria 1401
15 Ga0070714_100000250 3300005435 Bacteria 41973
16 Ga0070714_100006056 3300005435 Bacteria 9285
17 Ga0070714_100008242 3300005435 Bacteria 8124
18 Ga0070714_100029642 3300005435 Bacteria 4549
19 Ga0070714_100034292 3300005435 Bacteria 4250
20 Ga0070714_100079839 3300005435 Bacteria 2845
21 Ga0070714_100084343 3300005435 Bacteria 2772
22 Ga0070714_100142812 3300005435 Bacteria 2150
23 Ga0070714_100155112 3300005435 Unclassified 2066
24 Ga0070713_100000392 3300005436 Bacteria 28109
25 Ga0070713_100006439 3300005436 Bacteria 8143
26 Ga0070713_100033666 3300005436 Bacteria 4107
27 Ga0070713_100036237 3300005436 Bacteria 3980
28 Ga0070713_100046325 3300005436 Bacteria 3567
29 Ga0070713_100094123 3300005436 Bacteria 2582
30 Ga0070713_100129657 3300005436 Unclassified 2222
31 Ga0070713_100174758 3300005436 Bacteria 1926
32 Ga0070710_10001998 3300005437 Bacteria 9666
33 Ga0070710_10002857 3300005437 Bacteria 8228
34 Ga0070710_10022953 3300005437 Bacteria 3272
35 Ga0070711_100004404 3300005439 Bacteria 8309
36 Ga0070711_100017584 3300005439 Bacteria 4555
37 Ga0070711_100047566 3300005439 Bacteria 2929
38 Ga0070711_100099795 3300005439 Bacteria 2110
39 Ga0070711_100108650 3300005439 Bacteria 2032
40 Ga0070705_100052232 3300005440 Bacteria 2387
41 Ga0070700_100037831 3300005441 Bacteria 2937
42 Ga0070708_100006382 3300005445 Bacteria 9391
43 Ga0070708_100464717 3300005445 Bacteria 1194
44 Ga0070681_10362988 3300005458 Bacteria 1359
45 Ga0070685_10076248 3300005466 Unclassified 1999
46 Ga0070706_100013788 3300005467 Bacteria 7475
47 Ga0070706_100024074 3300005467 Bacteria 5606
48 Ga0070706_100041618 3300005467 Bacteria 4242
49 Ga0070706_100082273 3300005467 Bacteria 2982
50 Ga0070706_100117356 3300005467 Bacteria 2479
51 Ga0070706_100178783 3300005467 Unclassified 1981
52 Ga0070706_100197160 3300005467 Bacteria 1881
53 Ga0070707_100002470 3300005468 Bacteria 17623
54 Ga0070707_100007193 3300005468 Bacteria 10320
55 Ga0070707_100029449 3300005468 Bacteria 5227
56 Ga0070707_100060607 3300005468 Bacteria 3629
57 Ga0070698_100000052 3300005471 Bacteria 82128
58 Ga0070698_100001531 3300005471 Bacteria 25679
59 Ga0070698_100003355 3300005471 Bacteria 17623
60 Ga0070698_100062705 3300005471 Bacteria 3750
61 Ga0070698_100073638 3300005471 Bacteria 3421
62 Ga0070698_100079619 3300005471 Bacteria 3273
63 Ga0070698_100080388 3300005471 Bacteria 3254
64 Ga0070698_100245607 3300005471 Bacteria 1723
65 Ga0070698_100392409 3300005471 Bacteria 1321
66 Ga0070699_100000680 3300005518 Bacteria 31757
67 Ga0070679_100017200 3300005530 Bacteria 6995
68 Ga0070679_100490584 3300005530 Bacteria 1173
69 Ga0070684_100211824 3300005535 Bacteria 1766
70 Ga0068853_100021702 3300005539 Bacteria 5357
71 Ga0070686_100327818 3300005544 Bacteria 1143
72 Ga0070693_100049804 3300005547 Bacteria 2391
73 Ga0070665_100351019 3300005548 Bacteria 1480
74 Ga0068855_100282024 3300005563 Unclassified 1844
75 Ga0068855_100341577 3300005563 Unclassified 1651
76 Ga0068857_100060034 3300005577 Bacteria 3378
77 Ga0068857_100163977 3300005577 Bacteria 2017
78 Ga0068854_100037719 3300005578 Bacteria 3394
79 Ga0068856_100002953 3300005614 Bacteria 17432
80 Ga0068856_100024199 3300005614 Bacteria 5908
81 Ga0068856_100071590 3300005614 Bacteria 3432
82 Ga0068856_100233339 3300005614 Bacteria 1855
83 Ga0070702_100006338 3300005615 Bacteria 5594
84 Ga0068859_100161621 3300005617 Unclassified 2318
85 Ga0068859_100502730 3300005617 Bacteria 1307
86 Ga0068864_100052245 3300005618 Bacteria 3522
87 Ga0068861_100187713 3300005719 Bacteria 1725
88 Ga0068870_10020961 3300005840 Bacteria 3190
89 Ga0068863_100074456 3300005841 Bacteria 3212
90 Ga0068863_100322229 3300005841 Bacteria 1501
91 Ga0068858_100108159 3300005842 Bacteria 2596
92 Ga0068858_100404975 3300005842 Bacteria 1311
93 Ga0068860_100040221 3300005843 Bacteria 4470
94 Ga0070717_10000872 3300006028 Bacteria 19951
95 Ga0070717_10003603 3300006028 Bacteria 11108
96 Ga0070717_10004576 3300006028 Bacteria 10014
97 Ga0070717_10006492 3300006028 Bacteria 8609
98 Ga0070717_10021020 3300006028 Bacteria 5142
99 Ga0070717_10024868 3300006028 Bacteria 4758
100 Ga0070717_10047421 3300006028 Bacteria 3520
101 Ga0070717_10107040 3300006028 Bacteria 2381
102 Ga0070717_10137478 3300006028 Unclassified 2105
103 Ga0070717_10209736 3300006028 Bacteria 1709
104 Ga0070715_10005103 3300006163 Bacteria 4357
105 Ga0070715_10010248 3300006163 Bacteria 3335
106 Ga0070715_10013460 3300006163 Bacteria 3006
107 Ga0070716_100000326 3300006173 Bacteria 19254
108 Ga0070716_100009787 3300006173 Bacteria 4791
109 Ga0070716_100017430 3300006173 Bacteria 3723
110 Ga0070716_100040838 3300006173 Unclassified 2582
111 Ga0070712_100001194 3300006175 Bacteria 15695
112 Ga0070712_100099026 3300006175 Bacteria 2151
113 Ga0070712_100157010 3300006175 Bacteria 1753
114 Ga0070712_100186137 3300006175 Unclassified 1621
115 Ga0070712_100319642 3300006175 Unclassified 1262
116 Ga0070712_100390879 3300006175 Bacteria 1147
117 Ga0097621_100015595 3300006237 Bacteria 5724
118 Ga0068871_100139639 3300006358 Bacteria 2060
119 Ga0068871_100150648 3300006358 Bacteria 1983
120 Ga0068871_100180451 3300006358 Bacteria 1814
121 Ga0075428_100051308 3300006844 Bacteria 4524
122 Ga0075433_10002240 3300006852 Bacteria 14680
123 Ga0075433_10055501 3300006852 Bacteria 3458
124 Ga0075434_100059863 3300006871 Bacteria 3787
125 Ga0075434_100080133 3300006871 Unclassified 3261
126 Ga0075434_100238577 3300006871 Unclassified 1838
127 Ga0075429_100319387 3300006880 Unclassified 1359
128 Ga0075436_100050415 3300006914 Bacteria 2872
129 Ga0097620_100161632 3300006931 Unclassified 2318
130 Ga0097620_100502733 3300006931 Bacteria 1307
131 Ga0105240_10004674 3300009093 Bacteria 20698
132 Ga0105240_10132544 3300009093 Unclassified 2987
133 Ga0105240_10139607 3300009093 Bacteria 2898
134 Ga0105245_10131097 3300009098 Bacteria 2351
135 Ga0105245_10500529 3300009098 Bacteria 1231
136 Ga0105247_10027574 3300009101 Bacteria 3433
137 Ga0105247_10237233 3300009101 Bacteria 1241
138 Ga0114129_10003946 3300009147 Bacteria 20939
139 Ga0114129_10343872 3300009147 Unclassified 1978
140 Ga0105243_10321718 3300009148 Bacteria 1410
141 Ga0105242_10081715 3300009176 Bacteria 2703
142 Ga0105248_10477006 3300009177 Bacteria 1406
143 Ga0105237_10079901 3300009545 Bacteria 3260
144 Ga0105237_10478340 3300009545 Bacteria 1252
145 Ga0105238_10062516 3300009551 Bacteria 3724
146 Ga0105238_10499540 3300009551 Bacteria 1217
147 Ga0105239_10038464 3300010375 Bacteria 5243
148 Ga0105246_10027214 3300011119 Bacteria 3744
149 Ga0157373_10038638 3300013100 Bacteria 3420
150 Ga0157371_10164054 3300013102 Bacteria 1587
151 Ga0157369_10050496 3300013105 Unclassified 4504
152 Ga0157369_10066884 3300013105 Bacteria 3866
153 Ga0157374_10122690 3300013296 Bacteria 2509
154 Ga0157378_10152203 3300013297 Bacteria 2156
155 Ga0163162_10133087 3300013306 Bacteria 2596
156 Ga0157372_10089926 3300013307 Bacteria 3489
157 Ga0157375_10068029 3300013308 Bacteria 3561
158 Ga0157375_10408137 3300013308 Bacteria 1525
159 Ga0163163_10014804 3300014325 Bacteria 7180
160 Ga0163163_10270409 3300014325 Unclassified 1751
161 Ga0157377_10065297 3300014745 Bacteria 2090
162 Ga0157379_10437337 3300014968 Bacteria 1206
163 Ga0206351_10712940 3300020077 Unclassified 2254
164 Ga0206354_10140575 3300020081 Bacteria 1734
165 Ga0206354_10185635 3300020081 Archaea 1303
166 Ga0206353_10226583 3300020082 Unclassified 2094
167 Ga0213875_10009737 3300021388 Bacteria 4850
168 Ga0213875_10014031 3300021388 Bacteria 3919
169 Ga0224712_10009118 3300022467 Unclassified 2975
170 Ga0224712_10021828 3300022467 Unclassified 2197
171 Ga0224712_10059808 3300022467 Archaea 1514
172 Ga0207692_10000150 3300025898 Bacteria 21932
173 Ga0207692_10001454 3300025898 Bacteria 8861
174 Ga0207692_10016652 3300025898 Bacteria 3261
175 Ga0207692_10073866 3300025898 Bacteria 1805
176 Ga0207692_10203048 3300025898 Unclassified 1166
177 Ga0207688_10005389 3300025901 Bacteria 6952
178 Ga0207688_10009340 3300025901 Bacteria 5346
179 Ga0207685_10022255 3300025905 Unclassified 2139
180 Ga0207699_10000205 3300025906 Bacteria 35487
181 Ga0207699_10001649 3300025906 Bacteria 10575
182 Ga0207699_10006888 3300025906 Bacteria 5528
183 Ga0207699_10066224 3300025906 Bacteria 2192
184 Ga0207699_10132172 3300025906 Bacteria 1629
185 Ga0207643_10014378 3300025908 Bacteria 4298
186 Ga0207643_10016674 3300025908 Bacteria 4007
187 Ga0207705_10294298 3300025909 Unclassified 1244
188 Ga0207684_10001231 3300025910 Bacteria 28443
189 Ga0207684_10003550 3300025910 Bacteria 15192
190 Ga0207684_10047080 3300025910 Bacteria 3658
191 Ga0207684_10065876 3300025910 Bacteria 3076
192 Ga0207684_10148743 3300025910 Bacteria 2015
193 Ga0207654_10103334 3300025911 Bacteria 1759
194 Ga0207654_10190410 3300025911 Bacteria 1344
195 Ga0207707_10123833 3300025912 Unclassified 2261
196 Ga0207707_10206896 3300025912 Bacteria 1710
197 Ga0207695_10002407 3300025913 Bacteria 27694
198 Ga0207671_10009587 3300025914 Bacteria 8070
199 Ga0207693_10000355 3300025915 Bacteria 42002
200 Ga0207693_10001823 3300025915 Bacteria 18689
201 Ga0207693_10003373 3300025915 Bacteria 13639
202 Ga0207693_10013139 3300025915 Bacteria 6679
203 Ga0207693_10015224 3300025915 Bacteria 6173
204 Ga0207693_10033669 3300025915 Bacteria 4042
205 Ga0207693_10273891 3300025915 Bacteria 1323
206 Ga0207693_10426998 3300025915 Bacteria 1036
207 Ga0207693_10453916 3300025915 Bacteria 1001
208 Ga0207663_10018192 3300025916 Bacteria 3932
209 Ga0207663_10024199 3300025916 Bacteria 3495
210 Ga0207663_10024217 3300025916 Bacteria 3494
211 Ga0207663_10067652 3300025916 Bacteria 2291
212 Ga0207663_10107367 3300025916 Bacteria 1888
213 Ga0207663_10397783 3300025916 Bacteria 1053
214 Ga0207657_10001310 3300025919 Bacteria 26403
215 Ga0207649_10067066 3300025920 Unclassified 2277
216 Ga0207646_10000410 3300025922 Bacteria 57510
217 Ga0207646_10005738 3300025922 Bacteria 13010
218 Ga0207646_10029887 3300025922 Bacteria 4946
219 Ga0207646_10039734 3300025922 Bacteria 4233
220 Ga0207646_10210101 3300025922 Unclassified 1758
221 Ga0207694_10055655 3300025924 Bacteria 3071
222 Ga0207687_10000248 3300025927 Bacteria 36726
223 Ga0207700_10006240 3300025928 Bacteria 7188
224 Ga0207700_10007761 3300025928 Bacteria 6593
225 Ga0207700_10008631 3300025928 Bacteria 6326
226 Ga0207700_10009627 3300025928 Bacteria 6049
227 Ga0207700_10031540 3300025928 Bacteria 3766
228 Ga0207700_10034111 3300025928 Bacteria 3650
229 Ga0207700_10080243 3300025928 Unclassified 2544
230 Ga0207700_10143566 3300025928 Unclassified 1964
231 Ga0207700_10350729 3300025928 Bacteria 1285
232 Ga0207664_10001022 3300025929 Bacteria 18759
233 Ga0207664_10001579 3300025929 Bacteria 14967
234 Ga0207664_10002889 3300025929 Bacteria 11433
235 Ga0207664_10003303 3300025929 Bacteria 10729
236 Ga0207664_10003313 3300025929 Bacteria 10713
237 Ga0207664_10016279 3300025929 Bacteria 5422
238 Ga0207664_10017269 3300025929 Bacteria 5286
239 Ga0207664_10021472 3300025929 Bacteria 4802
240 Ga0207664_10051601 3300025929 Bacteria 3249
241 Ga0207664_10145961 3300025929 Unclassified 2006
242 Ga0207664_10481950 3300025929 Bacteria 1110
243 Ga0207644_10128498 3300025931 Bacteria 1937
244 Ga0207690_10009338 3300025932 Bacteria 5826
245 Ga0207706_10008680 3300025933 Bacteria 9360
246 Ga0207670_10040413 3300025936 Bacteria 3061
247 Ga0207704_10021420 3300025938 Bacteria 3443
248 Ga0207665_10000480 3300025939 Bacteria 27050
249 Ga0207665_10000820 3300025939 Bacteria 21046
250 Ga0207665_10004211 3300025939 Bacteria 9575
251 Ga0207665_10015042 3300025939 Bacteria 5081
252 Ga0207665_10078040 3300025939 Bacteria 2274
253 Ga0207711_10196810 3300025941 Unclassified 1838
254 Ga0207689_10012065 3300025942 Bacteria 7403
255 Ga0207689_10143764 3300025942 Bacteria 1965
256 Ga0207667_10059573 3300025949 Bacteria 3998
257 Ga0207640_10185389 3300025981 Bacteria 1564
258 Ga0207677_10073746 3300026023 Bacteria 2418
259 Ga0207677_10185444 3300026023 Bacteria 1640
260 Ga0207703_10069611 3300026035 Bacteria 2902
261 Ga0207678_10002951 3300026067 Bacteria 15407
262 Ga0207678_10026431 3300026067 Bacteria 5063
263 Ga0207708_10029372 3300026075 Bacteria 4167
264 Ga0207702_10005745 3300026078 Bacteria 10805
265 Ga0207702_10425031 3300026078 Bacteria 1285
266 Ga0207641_10057581 3300026088 Bacteria 3305
267 Ga0207641_10096417 3300026088 Unclassified 2598
268 Ga0207641_10214251 3300026088 Bacteria 1783
269 Ga0207641_10288278 3300026088 Bacteria 1547
270 Ga0207648_10072108 3300026089 Bacteria 3010
271 Ga0207676_10037130 3300026095 Bacteria 3711
272 Ga0207674_10008764 3300026116 Bacteria 11646
273 Ga0207674_10037897 3300026116 Bacteria 5009
274 Ga0207674_10120370 3300026116 Bacteria 2593
275 Ga0207675_100008580 3300026118 Bacteria 9613
276 Ga0207683_10006285 3300026121 Bacteria 10180
277 Ga0207698_10017520 3300026142 Bacteria 4862
278 Ga0207698_10026148 3300026142 Bacteria 4125
279 Ga0207428_10011845 3300027907 Bacteria 7683
280 Ga0224573_1002200 3300028019 Bacteria 1488
281 Ga0268266_10096904 3300028379 Bacteria 2594
282 Ga0268266_10712342 3300028379 Bacteria 968
283 Ga0265337_1001444 3300028556 Bacteria 11683
284 Ga0265326_10000206 3300028558 Bacteria 29334
285 Ga0265319_1001776 3300028563 Bacteria 12354
286 Ga0265318_10000927 3300028577 Bacteria 18982
287 Ga0265322_10009353 3300028654 Bacteria 2844
288 Ga0265336_10000049 3300028666 Bacteria 120719
289 Ga0265336_10022334 3300028666 Bacteria 2014
290 Ga0265338_10000046 3300028800 Bacteria 223068
291 Ga0265338_10011760 3300028800 Bacteria 10064
292 Ga0265338_10020419 3300028800 Bacteria 6966
293 Ga0265338_10023545 3300028800 Bacteria 6328
294 Ga0265338_10143514 3300028800 Bacteria 1866
295 Ga0265324_10001396 3300029957 Bacteria 13944
296 Ga0265325_10028097 3300031241 Bacteria 3035
297 Ga0265340_10000003 3300031247 Bacteria 320583
298 Ga0265340_10029548 3300031247 Bacteria 2752
299 Ga0265339_10099968 3300031249 Unclassified 1511
300 Ga0265327_10007884 3300031251 Bacteria 8072
301 Ga0265316_10191254 3300031344 Bacteria 1520
302 Ga0265316_10274304 3300031344 Bacteria 1234
303 Ga0265314_10042959 3300031711 Bacteria 3219
304 Ga0373948_0010383 3300034817 Bacteria 1625
305 Ga0373926_0001318 3300035083 Bacteria 7492
306 Ga0373928_0041706 3300035084 Bacteria 1056
307 Ga0373934_0000291 3300035086 Bacteria 17907
308 Ga0373934_0007668 3300035086 Bacteria 4009
309 Ga0373934_0012865 3300035086 Bacteria 3162
310 Ga0373934_0048968 3300035086 Bacteria 1673
311 Ga0373934_0053390 3300035086 Unclassified 1603
312 Ga0373940_0017042 3300035088 Bacteria 1808
313 Ga0373944_0000911 3300035089 Bacteria 7299
314 Ga0373944_0003180 3300035089 Bacteria 4226
315 Ga0373944_0020527 3300035089 Bacteria 1904
316 Ga0373952_0013920 3300035092 Unclassified 1603
317 Ga0373923_0019629 3300035111 Bacteria 2619
318 Ga0373923_0021064 3300035111 Bacteria 2540
319 Ga0373932_0051135 3300035112 Bacteria 1227
320 Ga0373936_0000278 3300035113 Bacteria 17059
321 Ga0373936_0009357 3300035113 Bacteria 3693
322 Ga0373936_0040784 3300035113 Unclassified 1861
323 Ga0373936_0063976 3300035113 Unclassified 1506
324 Ga0373945_0005152 3300035116 Bacteria 4175
325 Ga0373945_0069969 3300035116 Bacteria 1326
326 Ga0373953_0001302 3300035117 Bacteria 7142
327 Ga0373953_0002922 3300035117 Bacteria 5221
328 Ga0373954_0013242 3300035118 Bacteria 3674
329 Ga0373954_0015957 3300035118 Bacteria 3359
330 Ga0373954_0038183 3300035118 Bacteria 2233
331 Ga0373954_0039507 3300035118 Bacteria 2197
332 Ga0373956_0011541 3300035119 Bacteria 3644
333 Ga0373956_0018153 3300035119 Bacteria 2975
334 Ga0373956_0108425 3300035119 Unclassified 1291
335 Ga0373957_0048340 3300035120 Bacteria 1621
336 Ga0373957_0048751 3300035120 Bacteria 1615
337 Ga0373957_0073857 3300035120 Bacteria 1338
338 Ga0373943_0000119 3300035170 Bacteria 29368
339 Ga0373943_0005908 3300035170 Bacteria 5493
340 Ga0373943_0226833 3300035170 Unclassified 1042
341 Ga0373946_0006354 3300035171 Bacteria 4284
342 Ga0373946_0016025 3300035171 Unclassified 2850
343 Ga0373955_0000058 3300035172 Bacteria 43267
344 Ga0373955_0125610 3300035172 Unclassified 1494
345 Ga0373942_0031515 3300035207 Unclassified 1402
346 Ga0373961_0007010 3300035241 Bacteria 2714
347 Ga0373961_0013273 3300035241 Bacteria 2075
348 Ga0373924_0000761 3300035410 Bacteria 10013
349 Ga0373924_0004232 3300035410 Bacteria 5000
350 Ga0373924_0016732 3300035410 Bacteria 2803
351 Ga0373935_0005380 3300035692 Bacteria 7546
352 Ga0373935_0005652 3300035692 Bacteria 7379
353 Ga0373935_0007190 3300035692 Bacteria 6649
354 Ga0373935_0024881 3300035692 Bacteria 3688
355 Ga0373935_0031617 3300035692 Bacteria 3286
356 Ga0373935_0083509 3300035692 Unclassified 2079
357 Ga0373935_0166036 3300035692 Bacteria 1507
358 Ga0373935_0176487 3300035692 Bacteria 1464
359 Ga0373927_0000726 3300035695 Bacteria 25216
360 Ga0373927_0014004 3300035695 Bacteria 5316
361 Ga0373927_0091246 3300035695 Bacteria 1978
362 Ga0373933_0000046 3300035724 Bacteria 76647
363 Ga0373933_0000803 3300035724 Bacteria 19135
364 Ga0373933_0010382 3300035724 Bacteria 5104
365 Ga0373933_0106653 3300035724 Bacteria 1743
366 Ga0373933_0115167 3300035724 Bacteria 1680
367 Ga0373947_0000012 3300035725 Bacteria 155188
368 Ga0373947_0000141 3300035725 Bacteria 37478
369 Ga0373947_0029522 3300035725 Bacteria 3218
370 Ga0373947_0072879 3300035725 Unclassified 2109
371 Ga0373947_0135651 3300035725 Bacteria 1574
372 Ga0373937_0000115 3300036401 Bacteria 76660
373 Ga0373937_0000938 3300036401 Bacteria 24762
374 Ga0373937_0147397 3300036401 Bacteria 2203
375 Ga0373937_0154880 3300036401 Bacteria 2147
376 Ga0373937_0365120 3300036401 Unclassified 1368
377 Ga0373925_0001150 3300037068 Bacteria 23461
378 Ga0373925_0008253 3300037068 Bacteria 7578
379 Ga0373925_0022033 3300037068 Bacteria 4643
380 Ga0373925_0035686 3300037068 Bacteria 3669
381 Ga0373925_0162935 3300037068 Unclassified 1757
382 Ga0373925_0167820 3300037068 Bacteria 1731
383 Ga0373925_0245085 3300037068 Bacteria 1436
384 Ga0373925_0427215 3300037068 Unclassified 1083
385 Ga0436364_0074139 3300037853 Bacteria 2660
386 Ga0436364_0747915 3300037853 Bacteria 4850
387 Ga0436364_1050209 3300037853 Bacteria 3723
388 Ga0436365_0875851 3300039437 Unclassified 1898
389 Ga0436365_0960103 3300039437 Unclassified 1123
390 Ga0436363_0403894 3300039450 Bacteria 7451
391 Ga0436363_1128802 3300039450 Unclassified 2002
392 Ga0466969_0101367 3300044656 Unclassified 1355
393 Ga0466965_0073279 3300044683 Bacteria 1724
394 Ga0466966_0008290 3300044684 Bacteria 6890
395 Ga0466966_0101489 3300044684 Unclassified 1779
396 Ga0466961_0100821 3300044693 Bacteria 1819
397 Ga0466963_0002750 3300044694 Bacteria 9924
398 Ga0466963_0031275 3300044694 Bacteria 3440
399 Ga0466963_0062727 3300044694 Bacteria 2486
400 Ga0466963_0140694 3300044694 Bacteria 1672
401 Ga0466971_0015789 3300044719 Bacteria 3326
402 Ga0466970_0018115 3300044765 Unclassified 3644
403 Ga0466957_0003271 3300044842 Bacteria 8876
404 Ga0466957_0036171 3300044842 Unclassified 2967
405 Ga0466957_0125755 3300044842 Bacteria 1638
406 Ga0466959_0019955 3300045049 Bacteria 4934
407 Ga0466958_0001555 3300045836 Bacteria 10996
408 Ga0466958_0023162 3300045836 Bacteria 3642
409 Ga0466958_0067961 3300045836 Bacteria 2178
410 Ga0466958_0200843 3300045836 Bacteria 1269
411 Ga0466967_0093491 3300045976 Bacteria 2736
412 Ga0495592_0001162 3300046454 Bacteria 18268
413 Ga0495592_0006368 3300046454 Bacteria 8792
414 Ga0495592_0046403 3300046454 Bacteria 3238
415 Ga0495592_0071279 3300046454 Unclassified 2529
416 Ga0495629_0001762 3300046459 Bacteria 16967
417 Ga0495629_0048520 3300046459 Unclassified 2976
418 Ga0495629_0081492 3300046459 Bacteria 2258
419 Ga0495641_0005823 3300046461 Bacteria 8169
420 Ga0495641_0008836 3300046461 Bacteria 6069
421 Ga0495651_0000067 3300046462 Bacteria 76665
422 Ga0495651_0003224 3300046462 Bacteria 12528
423 Ga0495651_0012113 3300046462 Bacteria 6635
424 Ga0495651_0018552 3300046462 Bacteria 5389
425 Ga0495651_0021955 3300046462 Bacteria 4964
426 Ga0495651_0041016 3300046462 Bacteria 3596
427 Ga0495651_0046174 3300046462 Bacteria 3371
428 Ga0495651_0051187 3300046462 Bacteria 3186
429 Ga0495651_0065007 3300046462 Bacteria 2786
430 Ga0495651_0392270 3300046462 Bacteria 908
431 Ga0495653_0000420 3300046463 Bacteria 33951
432 Ga0495653_0014591 3300046463 Bacteria 6412
433 Ga0495653_0028153 3300046463 Bacteria 4495
434 Ga0495653_0046642 3300046463 Bacteria 3354
435 Ga0495653_0054717 3300046463 Bacteria 3048
436 Ga0495653_0075746 3300046463 Bacteria 2503
437 Ga0495653_0112915 3300046463 Bacteria 1949
438 Ga0495653_0120745 3300046463 Bacteria 1868
439 Ga0495653_0124461 3300046463 Unclassified 1832
440 Ga0495580_0027053 3300046472 Bacteria 4176
441 Ga0495580_0067210 3300046472 Bacteria 2508
442 Ga0495582_0003438 3300046473 Bacteria 8924
443 Ga0495582_0007311 3300046473 Bacteria 6119
444 Ga0495639_0007273 3300046475 Bacteria 4753
445 Ga0495639_0052878 3300046475 Unclassified 1849
446 Ga0495639_0219565 3300046475 Unclassified 934
447 Ga0495662_0021422 3300046476 Bacteria 3124
448 Ga0495662_0110149 3300046476 Bacteria 1349
449 Ga0495664_0009529 3300046477 Bacteria 5437
450 Ga0495664_0017914 3300046477 Bacteria 4051
451 Ga0495664_0018583 3300046477 Bacteria 3986
452 Ga0495664_0024151 3300046477 Bacteria 3530
453 Ga0495664_0043352 3300046477 Bacteria 2665
454 Ga0495664_0050238 3300046477 Bacteria 2476
455 Ga0495664_0057993 3300046477 Bacteria 2303
456 Ga0495664_0077523 3300046477 Unclassified 1990
457 Ga0495664_0083498 3300046477 Bacteria 1916
458 Ga0495594_0034273 3300046499 Unclassified 2761
459 Ga0495594_0041845 3300046499 Bacteria 2508
460 Ga0495608_0000095 3300046511 Bacteria 64067
461 Ga0495608_0013938 3300046511 Bacteria 5579
462 Ga0495608_0033082 3300046511 Bacteria 3496
463 Ga0495608_0093154 3300046511 Bacteria 1946
464 Ga0495608_0130911 3300046511 Unclassified 1605
465 Ga0495608_0162264 3300046511 Bacteria 1420
466 Ga0495618_0005430 3300046514 Bacteria 7770
467 Ga0495618_0012085 3300046514 Bacteria 5240
468 Ga0495618_0030072 3300046514 Bacteria 3390
469 Ga0495628_0000226 3300046516 Bacteria 49494
470 Ga0495628_0045515 3300046516 Bacteria 3488
471 Ga0495628_0046686 3300046516 Bacteria 3439
472 Ga0495628_0096190 3300046516 Bacteria 2288
473 Ga0495628_0136949 3300046516 Bacteria 1870
474 Ga0495628_0142528 3300046516 Bacteria 1828
475 Ga0495630_0000621 3300046517 Bacteria 25689
476 Ga0495630_0033879 3300046517 Bacteria 3809
477 Ga0495630_0062550 3300046517 Bacteria 2796
478 Ga0495630_0174759 3300046517 Unclassified 1637
479 Ga0495630_0270236 3300046517 Unclassified 1299
480 Ga0495666_0008890 3300046526 Bacteria 5030
481 Ga0495666_0016050 3300046526 Bacteria 3729
482 Ga0495666_0027944 3300046526 Bacteria 2776
483 Ga0495652_0000337 3300046529 Bacteria 55658
484 Ga0495652_0004687 3300046529 Bacteria 13039
485 Ga0495652_0020965 3300046529 Bacteria 5808
486 Ga0495652_0035183 3300046529 Bacteria 4360
487 Ga0495652_0035986 3300046529 Bacteria 4306
488 Ga0495652_0067958 3300046529 Bacteria 2986
489 Ga0495665_0001232 3300046531 Bacteria 13656
490 Ga0495665_0010206 3300046531 Bacteria 5088
491 Ga0495665_0028072 3300046531 Bacteria 3020
492 Ga0495640_0012221 3300046533 Bacteria 6571
493 Ga0495640_0023445 3300046533 Bacteria 4495
494 Ga0495640_0023734 3300046533 Bacteria 4462
495 Ga0495640_0059482 3300046533 Bacteria 2602
496 Ga0495640_0067957 3300046533 Unclassified 2399
497 Ga0495640_0158204 3300046533 Bacteria 1453
498 Ga0495586_0011987 3300046535 Bacteria 4606
499 Ga0495586_0015203 3300046535 Bacteria 4095
500 Ga0495586_0026236 3300046535 Unclassified 3117
501 Ga0495587_0000078 3300046536 Bacteria 76639
502 Ga0495587_0007741 3300046536 Bacteria 6945
503 Ga0495587_0016156 3300046536 Bacteria 4646
504 Ga0495587_0046128 3300046536 Unclassified 2587
505 Ga0495587_0096263 3300046536 Bacteria 1707
506 Ga0495645_0001175 3300046543 Bacteria 17832
507 Ga0495645_0008366 3300046543 Bacteria 7223
508 Ga0495645_0023605 3300046543 Bacteria 4455
509 Ga0495645_0027262 3300046543 Bacteria 4149
510 Ga0495645_0031499 3300046543 Bacteria 3865
511 Ga0495645_0064832 3300046543 Bacteria 2643
512 Ga0495645_0098956 3300046543 Unclassified 2075
513 Ga0495645_0122063 3300046543 Unclassified 1833
514 Ga0495645_0177544 3300046543 Bacteria 1461
515 Ga0495645_0182305 3300046543 Bacteria 1437
516 Ga0495622_0139275 3300046557 Unclassified 1102
517 Ga0495667_0000775 3300046559 Bacteria 20504
518 Ga0495667_0001084 3300046559 Bacteria 17655
519 Ga0495667_0018223 3300046559 Bacteria 4743
520 Ga0495667_0018435 3300046559 Bacteria 4714
521 Ga0495667_0046268 3300046559 Bacteria 2877
522 Ga0495667_0063621 3300046559 Bacteria 2414
523 Ga0495667_0081206 3300046559 Unclassified 2107
524 Ga0495667_0096810 3300046559 Unclassified 1910
525 Ga0495667_0194654 3300046559 Bacteria 1298
526 Ga0495634_0030110 3300046642 Bacteria 3751
527 Ga0495634_0032839 3300046642 Unclassified 3566
528 Ga0495634_0172706 3300046642 Bacteria 1357
529 Ga0495635_0003168 3300046663 Bacteria 11331
530 Ga0495635_0047735 3300046663 Bacteria 2952
531 Ga0495635_0069113 3300046663 Unclassified 2421
532 Ga0495635_0117189 3300046663 Bacteria 1817
533 Ga0495635_0136712 3300046663 Bacteria 1670
534 Ga0495657_0000013 3300046675 Bacteria 195590
535 Ga0495657_0000098 3300046675 Bacteria 76618
536 Ga0495657_0007061 3300046675 Bacteria 8713
537 Ga0495657_0027700 3300046675 Bacteria 3995
538 Ga0495657_0029918 3300046675 Unclassified 3817
539 Ga0495657_0032131 3300046675 Bacteria 3665
540 Ga0495657_0046510 3300046675 Bacteria 2937
541 Ga0495657_0063864 3300046675 Bacteria 2427
542 Ga0495657_0147536 3300046675 Bacteria 1462
543 Ga0495657_0176432 3300046675 Bacteria 1313
544 Ga0495599_0000447 3300046678 Bacteria 23493
545 Ga0495599_0036480 3300046678 Bacteria 3088
546 Ga0495599_0043012 3300046678 Bacteria 2835
547 Ga0495599_0062950 3300046678 Bacteria 2317
548 Ga0495623_0000845 3300046679 Bacteria 20709
549 Ga0495623_0008762 3300046679 Bacteria 6567
550 Ga0495623_0037632 3300046679 Bacteria 3095
551 Ga0495623_0047139 3300046679 Unclassified 2735
552 Ga0495623_0090881 3300046679 Bacteria 1874
553 Ga0495646_0011512 3300046680 Bacteria 5617
554 Ga0495658_0004740 3300046683 Bacteria 6678
555 Ga0495658_0005794 3300046683 Bacteria 6064
556 Ga0495613_0019933 3300046689 Bacteria 4998
557 Ga0495613_0020505 3300046689 Bacteria 4927
558 Ga0495613_0102122 3300046689 Bacteria 2070
559 Ga0495624_0010866 3300046690 Bacteria 6275
560 Ga0495624_0031339 3300046690 Bacteria 3458
561 Ga0495624_0044841 3300046690 Bacteria 2818
562 Ga0495624_0236274 3300046690 Bacteria 1106
563 Ga0495600_0008555 3300046809 Bacteria 6293
564 Ga0495600_0020510 3300046809 Bacteria 4226
565 Ga0495600_0024574 3300046809 Bacteria 3880
566 Ga0495600_0040568 3300046809 Bacteria 3032
567 Ga0495600_0106827 3300046809 Unclassified 1823
568 Ga0495600_0121285 3300046809 Bacteria 1700
569 Ga0495581_0004305 3300047315 Bacteria 8216
570 Ga0495581_0008580 3300047315 Bacteria 5920
571 Ga0495581_0035489 3300047315 Bacteria 2885
572 Ga0495604_0000142 3300047317 Bacteria 61620
573 Ga0495604_0009707 3300047317 Bacteria 7612
574 Ga0495604_0028691 3300047317 Bacteria 4427
575 Ga0495604_0081466 3300047317 Bacteria 2423
576 Ga0495604_0151330 3300047317 Bacteria 1648
577 Ga0495674_0003177 3300047319 Bacteria 15954
578 Ga0495674_0004597 3300047319 Bacteria 13275
579 Ga0495674_0014117 3300047319 Bacteria 7482
580 Ga0495674_0021622 3300047319 Bacteria 5946
581 Ga0495674_0076958 3300047319 Bacteria 2869
582 Ga0495674_0086460 3300047319 Bacteria 2684
583 Ga0495674_0096528 3300047319 Bacteria 2519
584 Ga0495674_0134740 3300047319 Bacteria 2079
585 Ga0495674_0262515 3300047319 Bacteria 1419
586 Ga0495674_0270437 3300047319 Bacteria 1394
587 Ga0495674_0342196 3300047319 Bacteria 1215
588 Ga0495676_0048961 3300047321 Bacteria 3402
589 Ga0495676_0049931 3300047321 Bacteria 3359
590 Ga0495680_0000111 3300047322 Bacteria 76638
591 Ga0495680_0007755 3300047322 Bacteria 9805
592 Ga0495680_0018841 3300047322 Bacteria 5849
593 Ga0495680_0019979 3300047322 Bacteria 5645
594 Ga0495680_0031589 3300047322 Bacteria 4306
595 Ga0495680_0040005 3300047322 Bacteria 3736
596 Ga0495680_0047990 3300047322 Bacteria 3355
597 Ga0495680_0139256 3300047322 Bacteria 1776
598 Ga0495675_0000910 3300047444 Bacteria 18025
599 Ga0495675_0010201 3300047444 Bacteria 5861
600 Ga0495684_0013810 3300047471 Bacteria 6213
601 Ga0495684_0015171 3300047471 Bacteria 5932
602 Ga0495684_0045672 3300047471 Bacteria 3352
603 Ga0495684_0058386 3300047471 Bacteria 2939
604 Ga0495684_0122860 3300047471 Bacteria 1954
605 Ga0495684_0237335 3300047471 Unclassified 1331
606 Ga0495684_0286234 3300047471 Unclassified 1187
607 Ga0495593_0001196 3300047673 Bacteria 15186
608 Ga0495593_0006283 3300047673 Bacteria 6972
609 Ga0495593_0017301 3300047673 Bacteria 4057
610 Ga0495593_0043698 3300047673 Unclassified 2399
611 Ga0495602_0000686 3300048088 Bacteria 31781
612 Ga0495602_0023040 3300048088 Bacteria 6078
613 Ga0495602_0044846 3300048088 Bacteria 4006
614 Ga0495602_0289347 3300048088 Unclassified 1203
615 Ga0495614_0013523 3300048089 Bacteria 3578
616 Ga0496100_0001988 3300048903 Bacteria 10239
617 Ga0496100_0004323 3300048903 Bacteria 7522
618 Ga0496100_0017830 3300048903 Bacteria 4199
619 Ga0496101_0011391 3300048904 Bacteria 5900
620 Ga0496101_0132225 3300048904 Unclassified 1895
621 Ga0496102_0002403 3300048905 Bacteria 15981
622 Ga0496102_0038077 3300048905 Bacteria 4339
623 Ga0496102_0098354 3300048905 Bacteria 2715
624 Ga0496102_0428916 3300048905 Bacteria 1241
625 Ga0496102_0465930 3300048905 Bacteria 1184
626 Ga0496104_0005141 3300048907 Bacteria 11428
627 Ga0496104_0032944 3300048907 Bacteria 4824
628 Ga0496104_0102413 3300048907 Bacteria 2742
629 Ga0496104_0146772 3300048907 Bacteria 2265
630 Ga0496104_0515094 3300048907 Unclassified 1107
631 Ga0496105_0003238 3300048908 Bacteria 11999
632 Ga0496105_0008601 3300048908 Bacteria 7933
633 Ga0496105_0040489 3300048908 Bacteria 3842
634 Ga0496105_0054981 3300048908 Bacteria 3287
635 Ga0496105_0058772 3300048908 Bacteria 3173
636 Ga0496106_0063244 3300048909 Unclassified 2812
637 Ga0496106_0070230 3300048909 Bacteria 2675
638 Ga0496106_0119109 3300048909 Bacteria 2062
639 Ga0496107_0026118 3300048910 Bacteria 4139
640 Ga0496107_0066095 3300048910 Bacteria 2621
641 Ga0496107_0166484 3300048910 Bacteria 1634
642 Ga0496108_0005350 3300048911 Bacteria 10375
643 Ga0496108_0009716 3300048911 Bacteria 7798
644 Ga0496108_0013921 3300048911 Bacteria 6560
645 Ga0496108_0154782 3300048911 Bacteria 1979
646 Ga0496108_0367669 3300048911 Bacteria 1255
647 Ga0496109_0003103 3300048912 Bacteria 13857
648 Ga0496109_0016593 3300048912 Bacteria 6439
649 Ga0496109_0041887 3300048912 Bacteria 4148
650 Ga0496109_0214400 3300048912 Unclassified 1810
651 Ga0496110_0001275 3300048913 Bacteria 18024
652 Ga0496110_0059620 3300048913 Unclassified 3365
653 Ga0496110_0127275 3300048913 Bacteria 2298
654 Ga0496111_0004308 3300048914 Bacteria 8974
655 Ga0496111_0010036 3300048914 Bacteria 6337
656 Ga0496111_0012249 3300048914 Bacteria 5801
657 Ga0496112_0001872 3300048915 Bacteria 16588
658 Ga0496112_0012492 3300048915 Bacteria 7804
659 Ga0496112_0016478 3300048915 Bacteria 6925
660 Ga0496112_0075838 3300048915 Bacteria 3325
661 Ga0496112_0468566 3300048915 Bacteria 1197
662 Ga0496113_0008348 3300048916 Bacteria 6745
663 Ga0496113_0020882 3300048916 Bacteria 4612
664 Ga0496113_0086892 3300048916 Bacteria 2403
665 Ga0496114_0048452 3300048917 Bacteria 3534
666 Ga0496114_0060445 3300048917 Bacteria 3167
667 Ga0496114_0127014 3300048917 Unclassified 2199
668 Ga0496114_0247939 3300048917 Bacteria 1567
669 Ga0496115_0009144 3300048918 Bacteria 7355
670 Ga0496115_0035600 3300048918 Bacteria 3939
671 Ga0496115_0037058 3300048918 Bacteria 3863
672 Ga0501042_0044201 3300049578 Bacteria 3173
673 Ga0501067_0092711 3300049583 Bacteria 1677
674 Ga0501069_0025864 3300049585 Bacteria 3211
675 nmdc:mga05p37_8967_c1 3300050507 Bacteria 11832
676 nmdc:mga0n895_10653_c1 3300050512 Bacteria 8140
677 nmdc:mga0n895_5399_c1 3300050512 Bacteria 10672
678 nmdc:mga0rr50_103041_c1 3300050513 Unclassified 2246
679 nmdc:mga0rr50_176677_c1 3300050513 Bacteria 1743
680 nmdc:mga0rr50_74415_c1 3300050513 Unclassified 2600
681 nmdc:mga08x19_54970_c1 3300050514 Unclassified 2564
682 nmdc:mga08x19_5528_c1 3300050514 Bacteria 7473
683 nmdc:mga0a205_197506_c1 3300050515 Unclassified 1903
684 Ga0495601_0005503 3300053077 Bacteria 7386
685 Ga0495601_0039898 3300053077 Bacteria 2940
686 Ga0495601_0048020 3300053077 Bacteria 2688
687 Ga0495601_0056733 3300053077 Bacteria 2480
688 Ga0495601_0064978 3300053077 Unclassified 2321
689 Ga0495601_0084883 3300053077 Bacteria 2034
690 Ga0495612_0000219 3300053078 Bacteria 24266
691 Ga0495612_0008818 3300053078 Bacteria 4087
692 Ga0495612_0019936 3300053078 Bacteria 2687
693 Ga0495612_0034361 3300053078 Bacteria 2053
694 Ga0495612_0128783 3300053078 Bacteria 1092
695 Ga0495595_0003727 3300053084 Bacteria 6059
696 Ga0495595_0010621 3300053084 Bacteria 3831
697 Ga0495595_0032540 3300053084 Bacteria 2349
698 Ga0495595_0056146 3300053084 Bacteria 1834
699 Ga0495619_0007442 3300053085 Bacteria 6935
700 Ga0495619_0009673 3300053085 Bacteria 6080
701 Ga0495619_0108689 3300053085 Bacteria 1893
702 Ga0466962_0015331 3300061719 Bacteria 3696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0020527 Ga0373944_0020527_21_845 214
2 3300053084 Ga0495595_0056146 Ga0495595_0056146_970_1794 214
3 3300035172 Ga0373955_0125610 Ga0373955_0125610_13_816 216
4 3300036401 Ga0373937_0365120 Ga0373937_0365120_12_815 216
5 3300046543 Ga0495645_0001175 Ga0495645_0001175_3904_4689 224
6 3300035120 Ga0373957_0048751 Ga0373957_0048751_98_910 225
7 3300028379 Ga0268266_10712342 Ga0268266_107123421 227
8 3300035170 Ga0373943_0226833 Ga0373943_0226833_223_1023 228
9 3300047471 Ga0495684_0237335 Ga0495684_0237335_484_1284 228
10 3300035089 Ga0373944_0000911 Ga0373944_0000911_1480_2313 229
11 3300035113 Ga0373936_0000278 Ga0373936_0000278_14849_15682 229
12 3300035170 Ga0373943_0000119 Ga0373943_0000119_952_1785 229
13 3300035171 Ga0373946_0006354 Ga0373946_0006354_2310_3143 229
14 3300035692 Ga0373935_0007190 Ga0373935_0007190_4217_5050 229
15 3300035695 Ga0373927_0000726 Ga0373927_0000726_1424_2257 229
16 3300035725 Ga0373947_0000141 Ga0373947_0000141_9128_9961 229
17 3300037068 Ga0373925_0001150 Ga0373925_0001150_3300_4133 229
18 3300039450 Ga0436363_1128802 Ga0436363_1128802_1129_1962 229
19 3300046462 Ga0495651_0051187 Ga0495651_0051187_2172_3005 229
20 3300046463 Ga0495653_0014591 Ga0495653_0014591_3819_4652 229
21 3300046476 Ga0495662_0110149 Ga0495662_0110149_293_1126 229
22 3300046477 Ga0495664_0009529 Ga0495664_0009529_1779_2612 229
23 3300046514 Ga0495618_0005430 Ga0495618_0005430_5159_5992 229
24 3300046517 Ga0495630_0062550 Ga0495630_0062550_1064_1897 229
25 3300046529 Ga0495652_0020965 Ga0495652_0020965_3039_3872 229
26 3300046533 Ga0495640_0158204 Ga0495640_0158204_246_1079 229
27 3300046559 Ga0495667_0046268 Ga0495667_0046268_1782_2615 229
28 3300046642 Ga0495634_0030110 Ga0495634_0030110_111_944 229
29 3300046663 Ga0495635_0003168 Ga0495635_0003168_2189_3022 229
30 3300047319 Ga0495674_0003177 Ga0495674_0003177_9291_10124 229
31 3300047322 Ga0495680_0019979 Ga0495680_0019979_1909_2742 229
32 3300047471 Ga0495684_0286234 Ga0495684_0286234_13_846 229
33 3300006028 Ga0070717_10003603 Ga0070717_1000360311 230
34 3300025929 Ga0207664_10003303 Ga0207664_100033032 234
35 3300048909 Ga0496106_0119109 Ga0496106_0119109_17_835 234
36 3300025898 Ga0207692_10203048 Ga0207692_102030482 236
37 3300046477 Ga0495664_0050238 Ga0495664_0050238_929_1786 236
38 3300046543 Ga0495645_0064832 Ga0495645_0064832_747_1604 236
39 3300047319 Ga0495674_0096528 Ga0495674_0096528_403_1260 236
40 3300053077 Ga0495601_0084883 Ga0495601_0084883_964_1821 236
41 3300025915 Ga0207693_10033669 Ga0207693_100336692 237
42 3300035111 Ga0373923_0019629 Ga0373923_0019629_1329_2186 237
43 3300035120 Ga0373957_0073857 Ga0373957_0073857_318_1175 237
44 3300035724 Ga0373933_0115167 Ga0373933_0115167_377_1234 237
45 3300035725 Ga0373947_0029522 Ga0373947_0029522_1237_2094 237
46 3300037068 Ga0373925_0245085 Ga0373925_0245085_575_1426 237
47 3300046459 Ga0495629_0081492 Ga0495629_0081492_1125_1982 237
48 3300046463 Ga0495653_0112915 Ga0495653_0112915_868_1725 237
49 3300046472 Ga0495580_0067210 Ga0495580_0067210_314_1171 237
50 3300046475 Ga0495639_0219565 Ga0495639_0219565_35_886 237
51 3300046499 Ga0495594_0041845 Ga0495594_0041845_519_1376 237
52 3300046526 Ga0495666_0027944 Ga0495666_0027944_811_1668 237
53 3300046533 Ga0495640_0023734 Ga0495640_0023734_734_1591 237
54 3300046559 Ga0495667_0063621 Ga0495667_0063621_434_1291 237
55 3300046642 Ga0495634_0172706 Ga0495634_0172706_67_924 237
56 3300046663 Ga0495635_0117189 Ga0495635_0117189_67_924 237
57 3300046675 Ga0495657_0007061 Ga0495657_0007061_1404_2261 237
58 3300046689 Ga0495613_0102122 Ga0495613_0102122_434_1294 237
59 3300047319 Ga0495674_0086460 Ga0495674_0086460_1176_2033 237
60 3300047673 Ga0495593_0006283 Ga0495593_0006283_1110_1967 237
61 3300048089 Ga0495614_0013523 Ga0495614_0013523_106_963 237
62 3300005337 Ga0070682_100054068 Ga0070682_1000540682 238
63 3300005435 Ga0070714_100008242 Ga0070714_1000082428 238
64 3300005435 Ga0070714_100079839 Ga0070714_1000798393 238
65 3300005530 Ga0070679_100490584 Ga0070679_1004905842 238
66 3300005547 Ga0070693_100049804 Ga0070693_1000498042 238
67 3300005548 Ga0070665_100351019 Ga0070665_1003510191 238
68 3300005614 Ga0068856_100002953 Ga0068856_10000295312 238
69 3300005842 Ga0068858_100108159 Ga0068858_1001081592 238
70 3300006028 Ga0070717_10006492 Ga0070717_100064924 238
71 3300006028 Ga0070717_10021020 Ga0070717_100210202 238
72 3300009101 Ga0105247_10027574 Ga0105247_100275743 238
73 3300009148 Ga0105243_10321718 Ga0105243_103217182 238
74 3300013297 Ga0157378_10152203 Ga0157378_101522032 238
75 3300013306 Ga0163162_10133087 Ga0163162_101330872 238
76 3300025916 Ga0207663_10397783 Ga0207663_103977832 238
77 3300025929 Ga0207664_10003313 Ga0207664_1000331311 238
78 3300025929 Ga0207664_10051601 Ga0207664_100516012 238
79 3300025931 Ga0207644_10128498 Ga0207644_101284982 238
80 3300026035 Ga0207703_10069611 Ga0207703_100696112 238
81 3300026078 Ga0207702_10005745 Ga0207702_100057452 238
82 3300028379 Ga0268266_10096904 Ga0268266_100969042 238
83 3300035113 Ga0373936_0040784 Ga0373936_0040784_708_1568 238
84 3300035695 Ga0373927_0091246 Ga0373927_0091246_115_975 238
85 3300044656 Ga0466969_0101367 Ga0466969_0101367_480_1322 238
86 3300044683 Ga0466965_0073279 Ga0466965_0073279_575_1417 238
87 3300044684 Ga0466966_0101489 Ga0466966_0101489_586_1428 238
88 3300044693 Ga0466961_0100821 Ga0466961_0100821_815_1657 238
89 3300044694 Ga0466963_0002750 Ga0466963_0002750_5661_6503 238
90 3300044694 Ga0466963_0031275 Ga0466963_0031275_408_1244 238
91 3300044719 Ga0466971_0015789 Ga0466971_0015789_1467_2309 238
92 3300044765 Ga0466970_0018115 Ga0466970_0018115_2578_3420 238
93 3300044842 Ga0466957_0003271 Ga0466957_0003271_4705_5547 238
94 3300044842 Ga0466957_0036171 Ga0466957_0036171_2053_2892 238
95 3300044842 Ga0466957_0125755 Ga0466957_0125755_569_1405 238
96 3300045049 Ga0466959_0019955 Ga0466959_0019955_1092_1934 238
97 3300045836 Ga0466958_0001555 Ga0466958_0001555_7951_8793 238
98 3300045836 Ga0466958_0023162 Ga0466958_0023162_526_1362 238
99 3300045976 Ga0466967_0093491 Ga0466967_0093491_461_1303 238
100 3300046463 Ga0495653_0000420 Ga0495653_0000420_27700_28527 238
101 3300046477 Ga0495664_0043352 Ga0495664_0043352_1509_2369 238
102 3300046535 Ga0495586_0015203 Ga0495586_0015203_1730_2587 238
103 3300046690 Ga0495624_0236274 Ga0495624_0236274_168_1028 238
104 3300047319 Ga0495674_0014117 Ga0495674_0014117_5890_6750 238
105 3300048905 Ga0496102_0465930 Ga0496102_0465930_293_1150 238
106 3300048917 Ga0496114_0060445 Ga0496114_0060445_283_1140 238
107 3300053077 Ga0495601_0048020 Ga0495601_0048020_645_1505 238
108 3300053078 Ga0495612_0034361 Ga0495612_0034361_998_1855 238
109 3300061719 Ga0466962_0015331 Ga0466962_0015331_171_1010 238
110 3300005338 Ga0068868_100140033 Ga0068868_1001400332 239
111 3300005578 Ga0068854_100037719 Ga0068854_1000377193 239
112 3300005615 Ga0070702_100006338 Ga0070702_1000063382 239
113 3300005618 Ga0068864_100052245 Ga0068864_1000522454 239
114 3300005843 Ga0068860_100040221 Ga0068860_1000402215 239
115 3300006175 Ga0070712_100157010 Ga0070712_1001570102 239
116 3300009093 Ga0105240_10139607 Ga0105240_101396074 239
117 3300009098 Ga0105245_10131097 Ga0105245_101310973 239
118 3300009177 Ga0105248_10477006 Ga0105248_104770062 239
119 3300009551 Ga0105238_10062516 Ga0105238_100625162 239
120 3300010375 Ga0105239_10038464 Ga0105239_100384644 239
121 3300011119 Ga0105246_10027214 Ga0105246_100272142 239
122 3300013307 Ga0157372_10089926 Ga0157372_100899262 239
123 3300013308 Ga0157375_10068029 Ga0157375_100680293 239
124 3300014325 Ga0163163_10014804 Ga0163163_100148047 239
125 3300014745 Ga0157377_10065297 Ga0157377_100652972 239
126 3300025901 Ga0207688_10005389 Ga0207688_100053892 239
127 3300025908 Ga0207643_10016674 Ga0207643_100166742 239
128 3300025911 Ga0207654_10103334 Ga0207654_101033342 239
129 3300025914 Ga0207671_10009587 Ga0207671_100095877 239
130 3300025915 Ga0207693_10013139 Ga0207693_100131397 239
131 3300025924 Ga0207694_10055655 Ga0207694_100556552 239
132 3300025927 Ga0207687_10000248 Ga0207687_100002482 239
133 3300025932 Ga0207690_10009338 Ga0207690_100093383 239
134 3300025938 Ga0207704_10021420 Ga0207704_100214202 239
135 3300025942 Ga0207689_10143764 Ga0207689_101437642 239
136 3300025949 Ga0207667_10059573 Ga0207667_100595733 239
137 3300025981 Ga0207640_10185389 Ga0207640_101853892 239
138 3300026023 Ga0207677_10073746 Ga0207677_100737462 239
139 3300026095 Ga0207676_10037130 Ga0207676_100371304 239
140 3300026142 Ga0207698_10017520 Ga0207698_100175205 239
141 3300046517 Ga0495630_0000621 Ga0495630_0000621_15225_16088 239
142 3300046536 Ga0495587_0096263 Ga0495587_0096263_198_1058 239
143 3300046675 Ga0495657_0000013 Ga0495657_0000013_129514_130377 239
144 3300046679 Ga0495623_0090881 Ga0495623_0090881_322_1182 239
145 3300047317 Ga0495604_0151330 Ga0495604_0151330_508_1368 239
146 3300048903 Ga0496100_0001988 Ga0496100_0001988_7476_8336 239
147 3300048903 Ga0496100_0004323 Ga0496100_0004323_4928_5776 239
148 3300048904 Ga0496101_0011391 Ga0496101_0011391_890_1750 239
149 3300048904 Ga0496101_0132225 Ga0496101_0132225_57_905 239
150 3300048905 Ga0496102_0002403 Ga0496102_0002403_3988_4848 239
151 3300048905 Ga0496102_0038077 Ga0496102_0038077_834_1682 239
152 3300048907 Ga0496104_0032944 Ga0496104_0032944_2903_3763 239
153 3300048907 Ga0496104_0515094 Ga0496104_0515094_176_1024 239
154 3300048908 Ga0496105_0040489 Ga0496105_0040489_2301_3161 239
155 3300048908 Ga0496105_0054981 Ga0496105_0054981_1520_2368 239
156 3300048909 Ga0496106_0063244 Ga0496106_0063244_1847_2695 239
157 3300048910 Ga0496107_0066095 Ga0496107_0066095_1518_2378 239
158 3300048910 Ga0496107_0166484 Ga0496107_0166484_426_1274 239
159 3300048911 Ga0496108_0005350 Ga0496108_0005350_5110_5958 239
160 3300048911 Ga0496108_0013921 Ga0496108_0013921_3392_4252 239
161 3300048912 Ga0496109_0003103 Ga0496109_0003103_8012_8860 239
162 3300048912 Ga0496109_0016593 Ga0496109_0016593_1441_2301 239
163 3300048913 Ga0496110_0001275 Ga0496110_0001275_1266_2126 239
164 3300048913 Ga0496110_0059620 Ga0496110_0059620_60_908 239
165 3300048914 Ga0496111_0004308 Ga0496111_0004308_3467_4327 239
166 3300048914 Ga0496111_0010036 Ga0496111_0010036_1171_2019 239
167 3300048915 Ga0496112_0016478 Ga0496112_0016478_4418_5266 239
168 3300048915 Ga0496112_0075838 Ga0496112_0075838_885_1745 239
169 3300048916 Ga0496113_0020882 Ga0496113_0020882_896_1756 239
170 3300048916 Ga0496113_0086892 Ga0496113_0086892_894_1742 239
171 3300048918 Ga0496115_0009144 Ga0496115_0009144_5916_6776 239
172 3300053078 Ga0495612_0000219 Ga0495612_0000219_17522_18385 239
173 3300025928 Ga0207700_10350729 Ga0207700_103507292 240
174 3300049583 Ga0501067_0092711 Ga0501067_0092711_112_969 240
175 3300049585 Ga0501069_0025864 Ga0501069_0025864_1659_2516 240
176 3300025906 Ga0207699_10132172 Ga0207699_101321722 241
177 3300048915 Ga0496112_0001872 Ga0496112_0001872_1155_2009 241
178 3300028556 Ga0265337_1001444 Ga0265337_100144412 242
179 3300028558 Ga0265326_10000206 Ga0265326_1000020610 242
180 3300028563 Ga0265319_1001776 Ga0265319_100177610 242
181 3300028577 Ga0265318_10000927 Ga0265318_100009272 242
182 3300028654 Ga0265322_10009353 Ga0265322_100093533 242
183 3300028666 Ga0265336_10000049 Ga0265336_1000004941 242
184 3300028800 Ga0265338_10000046 Ga0265338_10000046136 242
185 3300029957 Ga0265324_10001396 Ga0265324_1000139612 242
186 3300031247 Ga0265340_10000003 Ga0265340_1000000341 242
187 3300031249 Ga0265339_10099968 Ga0265339_100999682 242
188 3300031344 Ga0265316_10191254 Ga0265316_101912542 242
189 3300044684 Ga0466966_0008290 Ga0466966_0008290_2293_3156 242
190 3300045836 Ga0466958_0067961 Ga0466958_0067961_239_1096 242
191 3300045836 Ga0466958_0200843 Ga0466958_0200843_55_918 242
192 3300046462 Ga0495651_0392270 Ga0495651_0392270_35_895 242
193 3300046516 Ga0495628_0096190 Ga0495628_0096190_1231_2091 242
194 3300053077 Ga0495601_0005503 Ga0495601_0005503_3662_4513 242
195 3300009093 Ga0105240_10004674 Ga0105240_100046747 243
196 3300025913 Ga0207695_10002407 Ga0207695_100024077 243
197 3300031711 Ga0265314_10042959 Ga0265314_100429592 248
198 3300028800 Ga0265338_10143514 Ga0265338_101435142 251
199 3300031241 Ga0265325_10028097 Ga0265325_100280972 251
200 3300031247 Ga0265340_10029548 Ga0265340_100295483 251
201 3300031344 Ga0265316_10274304 Ga0265316_102743042 251
202 3300037068 Ga0373925_0008253 Ga0373925_0008253_4304_5320 254
203 3300025928 Ga0207700_10143566 Ga0207700_101435662 255
204 3300035086 Ga0373934_0007668 Ga0373934_0007668_556_1518 256
205 3300035118 Ga0373954_0038183 Ga0373954_0038183_718_1680 256
206 3300035119 Ga0373956_0018153 Ga0373956_0018153_1872_2834 256
207 3300035119 Ga0373956_0108425 Ga0373956_0108425_325_1266 256
208 3300035410 Ga0373924_0016732 Ga0373924_0016732_18_980 256
209 3300035692 Ga0373935_0176487 Ga0373935_0176487_88_1050 256
210 3300035724 Ga0373933_0000803 Ga0373933_0000803_4442_5404 256
211 3300036401 Ga0373937_0000938 Ga0373937_0000938_677_1639 256
212 3300046454 Ga0495592_0046403 Ga0495592_0046403_446_1408 256
213 3300046462 Ga0495651_0021955 Ga0495651_0021955_2015_2977 256
214 3300046462 Ga0495651_0046174 Ga0495651_0046174_1199_2140 256
215 3300046463 Ga0495653_0124461 Ga0495653_0124461_88_1050 256
216 3300046477 Ga0495664_0083498 Ga0495664_0083498_317_1279 256
217 3300046511 Ga0495608_0033082 Ga0495608_0033082_637_1599 256
218 3300046516 Ga0495628_0045515 Ga0495628_0045515_993_1955 256
219 3300046517 Ga0495630_0174759 Ga0495630_0174759_211_1152 256
220 3300046526 Ga0495666_0016050 Ga0495666_0016050_2281_3243 256
221 3300046529 Ga0495652_0067958 Ga0495652_0067958_1239_2180 256
222 3300046533 Ga0495640_0067957 Ga0495640_0067957_677_1639 256
223 3300046536 Ga0495587_0016156 Ga0495587_0016156_1842_2783 256
224 3300046536 Ga0495587_0046128 Ga0495587_0046128_841_1803 256
225 3300046543 Ga0495645_0098956 Ga0495645_0098956_754_1716 256
226 3300046675 Ga0495657_0046510 Ga0495657_0046510_1885_2826 256
227 3300046675 Ga0495657_0147536 Ga0495657_0147536_103_1065 256
228 3300046678 Ga0495599_0043012 Ga0495599_0043012_1012_1953 256
229 3300046679 Ga0495623_0047139 Ga0495623_0047139_1271_2212 256
230 3300046809 Ga0495600_0024574 Ga0495600_0024574_2011_2952 256
231 3300046809 Ga0495600_0106827 Ga0495600_0106827_619_1581 256
232 3300047315 Ga0495581_0035489 Ga0495581_0035489_1851_2813 256
233 3300047319 Ga0495674_0262515 Ga0495674_0262515_376_1338 256
234 3300047673 Ga0495593_0043698 Ga0495593_0043698_761_1723 256
235 3300048088 Ga0495602_0044846 Ga0495602_0044846_1680_2642 256
236 3300049578 Ga0501042_0044201 Ga0501042_0044201_1825_2742 256
237 3300053077 Ga0495601_0056733 Ga0495601_0056733_1122_2084 256
238 3300005338 Ga0068868_100275250 Ga0068868_1002752502 258
239 3300005563 Ga0068855_100341577 Ga0068855_1003415772 258
240 3300005617 Ga0068859_100502730 Ga0068859_1005027302 258
241 3300006237 Ga0097621_100015595 Ga0097621_1000155953 258
242 3300006358 Ga0068871_100139639 Ga0068871_1001396392 258
243 3300006844 Ga0075428_100051308 Ga0075428_1000513082 258
244 3300006852 Ga0075433_10002240 Ga0075433_1000224010 258
245 3300006880 Ga0075429_100319387 Ga0075429_1003193872 258
246 3300006914 Ga0075436_100050415 Ga0075436_1000504153 258
247 3300006931 Ga0097620_100502733 Ga0097620_1005027332 258
248 3300009101 Ga0105247_10237233 Ga0105247_102372331 258
249 3300009147 Ga0114129_10003946 Ga0114129_1000394611 258
250 3300013308 Ga0157375_10408137 Ga0157375_104081372 258
251 3300014968 Ga0157379_10437337 Ga0157379_104373372 258
252 3300025911 Ga0207654_10190410 Ga0207654_101904102 258
253 3300025915 Ga0207693_10003373 Ga0207693_100033737 258
254 3300025916 Ga0207663_10018192 Ga0207663_100181923 258
255 3300025929 Ga0207664_10021472 Ga0207664_100214722 258
256 3300026088 Ga0207641_10096417 Ga0207641_100964172 258
257 3300027907 Ga0207428_10011845 Ga0207428_100118457 258
258 3300031251 Ga0265327_10007884 Ga0265327_100078844 258
259 3300034817 Ga0373948_0010383 Ga0373948_0010383_369_1331 258
260 3300035084 Ga0373928_0041706 Ga0373928_0041706_71_1033 258
261 3300035088 Ga0373940_0017042 Ga0373940_0017042_716_1678 258
262 3300035207 Ga0373942_0031515 Ga0373942_0031515_398_1360 258
263 3300035241 Ga0373961_0007010 Ga0373961_0007010_1178_2140 258
264 3300046543 Ga0495645_0122063 Ga0495645_0122063_791_1753 258
265 3300047471 Ga0495684_0045672 Ga0495684_0045672_1838_2779 258
266 3300048908 Ga0496105_0058772 Ga0496105_0058772_1521_2483 258
267 3300048909 Ga0496106_0070230 Ga0496106_0070230_1075_2037 258
268 3300048910 Ga0496107_0026118 Ga0496107_0026118_1100_2062 258
269 3300048911 Ga0496108_0154782 Ga0496108_0154782_502_1464 258
270 3300048917 Ga0496114_0048452 Ga0496114_0048452_71_1033 258
271 3300048918 Ga0496115_0037058 Ga0496115_0037058_2111_3073 258
272 3300050507 nmdc:mga05p37_8967_c1 nmdc:mga05p37_8967_c1_7099_8064 258
273 3300050512 nmdc:mga0n895_5399_c1 nmdc:mga0n895_5399_c1_5911_6876 258
274 3300050513 nmdc:mga0rr50_103041_c1 nmdc:mga0rr50_103041_c1_527_1492 258
275 3300050513 nmdc:mga0rr50_176677_c1 nmdc:mga0rr50_176677_c1_511_1473 258
276 3300050514 nmdc:mga08x19_5528_c1 nmdc:mga08x19_5528_c1_3879_4844 258
277 3300050515 nmdc:mga0a205_197506_c1 nmdc:mga0a205_197506_c1_184_1149 258
278 3300037068 Ga0373925_0427215 Ga0373925_0427215_164_1060 259
279 3300005535 Ga0070684_100211824 Ga0070684_1002118242 260
280 3300005577 Ga0068857_100060034 Ga0068857_1000600343 260
281 3300022467 Ga0224712_10009118 Ga0224712_100091182 260
282 3300026116 Ga0207674_10120370 Ga0207674_101203702 260
283 3300035086 Ga0373934_0000291 Ga0373934_0000291_1092_2054 260
284 3300035117 Ga0373953_0001302 Ga0373953_0001302_1061_2023 260
285 3300035118 Ga0373954_0013242 Ga0373954_0013242_217_1179 260
286 3300035172 Ga0373955_0000058 Ga0373955_0000058_26357_27319 260
287 3300035410 Ga0373924_0000761 Ga0373924_0000761_1076_2038 260
288 3300035724 Ga0373933_0000046 Ga0373933_0000046_59737_60699 260
289 3300036401 Ga0373937_0000115 Ga0373937_0000115_59757_60719 260
290 3300046454 Ga0495592_0001162 Ga0495592_0001162_15942_16904 260
291 3300046462 Ga0495651_0000067 Ga0495651_0000067_59755_60717 260
292 3300046463 Ga0495653_0054717 Ga0495653_0054717_1608_2570 260
293 3300046511 Ga0495608_0000095 Ga0495608_0000095_24792_25754 260
294 3300046516 Ga0495628_0000226 Ga0495628_0000226_15949_16911 260
295 3300046529 Ga0495652_0000337 Ga0495652_0000337_38758_39720 260
296 3300046536 Ga0495587_0000078 Ga0495587_0000078_59757_60719 260
297 3300046559 Ga0495667_0000775 Ga0495667_0000775_15949_16911 260
298 3300046675 Ga0495657_0000098 Ga0495657_0000098_15930_16892 260
299 3300046678 Ga0495599_0000447 Ga0495599_0000447_6583_7545 260
300 3300046679 Ga0495623_0000845 Ga0495623_0000845_15939_16901 260
301 3300046809 Ga0495600_0040568 Ga0495600_0040568_1674_2636 260
302 3300047317 Ga0495604_0000142 Ga0495604_0000142_59750_60712 260
303 3300047322 Ga0495680_0000111 Ga0495680_0000111_15949_16911 260
304 3300047444 Ga0495675_0000910 Ga0495675_0000910_1115_2077 260
305 3300048088 Ga0495602_0000686 Ga0495602_0000686_29976_30938 260
306 3300053084 Ga0495595_0032540 Ga0495595_0032540_1232_2194 260
307 3300005434 Ga0070709_10039750 Ga0070709_100397503 261
308 3300025929 Ga0207664_10002889 Ga0207664_100028892 261
309 3300005329 Ga0070683_100383221 Ga0070683_1003832212 263
310 3300005435 Ga0070714_100155112 Ga0070714_1001551122 263
311 3300005436 Ga0070713_100174758 Ga0070713_1001747582 263
312 3300026088 Ga0207641_10288278 Ga0207641_102882782 263
313 3300035116 Ga0373945_0069969 Ga0373945_0069969_73_1056 263
314 3300035118 Ga0373954_0039507 Ga0373954_0039507_199_1182 263
315 3300036401 Ga0373937_0154880 Ga0373937_0154880_893_1876 263
316 3300046462 Ga0495651_0065007 Ga0495651_0065007_649_1632 263
317 3300046511 Ga0495608_0162264 Ga0495608_0162264_273_1256 263
318 3300046516 Ga0495628_0142528 Ga0495628_0142528_456_1439 263
319 3300046531 Ga0495665_0028072 Ga0495665_0028072_694_1677 263
320 3300046533 Ga0495640_0059482 Ga0495640_0059482_15_998 263
321 3300046543 Ga0495645_0177544 Ga0495645_0177544_71_1054 263
322 3300046663 Ga0495635_0136712 Ga0495635_0136712_408_1391 263
323 3300046675 Ga0495657_0176432 Ga0495657_0176432_99_1082 263
324 3300046678 Ga0495599_0062950 Ga0495599_0062950_857_1840 263
325 3300046809 Ga0495600_0121285 Ga0495600_0121285_69_1052 263
326 3300047322 Ga0495680_0047990 Ga0495680_0047990_1673_2656 263
327 3300048088 Ga0495602_0289347 Ga0495602_0289347_138_1121 263
328 3300048911 Ga0496108_0009716 Ga0496108_0009716_1582_2499 263
329 3300053078 Ga0495612_0128783 Ga0495612_0128783_80_1063 263
330 3300005614 Ga0068856_100233339 Ga0068856_1002333392 264
331 3300020081 Ga0206354_10140575 Ga0206354_101405752 264
332 3300026116 Ga0207674_10037897 Ga0207674_100378972 264
333 3300035725 Ga0373947_0135651 Ga0373947_0135651_21_1004 264
334 3300005439 Ga0070711_100108650 Ga0070711_1001086502 265
335 3300006358 Ga0068871_100180451 Ga0068871_1001804512 265
336 3300009098 Ga0105245_10500529 Ga0105245_105005292 265
337 3300009545 Ga0105237_10079901 Ga0105237_100799012 265
338 3300009551 Ga0105238_10499540 Ga0105238_104995402 265
339 3300021388 Ga0213875_10009737 Ga0213875_100097374 265
340 3300037853 Ga0436364_0747915 Ga0436364_0747915_847_1785 265
341 3300048907 Ga0496104_0146772 Ga0496104_0146772_68_1006 265
342 3300048912 Ga0496109_0041887 Ga0496109_0041887_2617_3555 265
343 3300048917 Ga0496114_0247939 Ga0496114_0247939_66_1004 265
344 3300005439 Ga0070711_100099795 Ga0070711_1000997952 267
345 3300005466 Ga0070685_10076248 Ga0070685_100762481 267
346 3300005467 Ga0070706_100178783 Ga0070706_1001787832 267
347 3300005468 Ga0070707_100060607 Ga0070707_1000606074 267
348 3300005471 Ga0070698_100392409 Ga0070698_1003924091 267
349 3300005577 Ga0068857_100163977 Ga0068857_1001639772 267
350 3300005841 Ga0068863_100322229 Ga0068863_1003222292 267
351 3300006028 Ga0070717_10137478 Ga0070717_101374782 267
352 3300006871 Ga0075434_100238577 Ga0075434_1002385772 267
353 3300013100 Ga0157373_10038638 Ga0157373_100386382 267
354 3300025901 Ga0207688_10009340 Ga0207688_100093403 267
355 3300025910 Ga0207684_10065876 Ga0207684_100658763 267
356 3300025916 Ga0207663_10107367 Ga0207663_101073672 267
357 3300025922 Ga0207646_10210101 Ga0207646_102101011 267
358 3300026116 Ga0207674_10008764 Ga0207674_100087647 267
359 3300026118 Ga0207675_100008580 Ga0207675_1000085803 267
360 3300035083 Ga0373926_0001318 Ga0373926_0001318_5136_6113 267
361 3300035692 Ga0373935_0005380 Ga0373935_0005380_5663_6640 267
362 3300035725 Ga0373947_0000012 Ga0373947_0000012_104111_105088 267
363 3300046517 Ga0495630_0270236 Ga0495630_0270236_148_1125 267
364 3300046557 Ga0495622_0139275 Ga0495622_0139275_90_1088 267
365 3300028019 Ga0224573_1002200 Ga0224573_10022002 268
366 3300035086 Ga0373934_0048968 Ga0373934_0048968_671_1654 268
367 3300037853 Ga0436364_0074139 Ga0436364_0074139_844_1833 269
368 3300046477 Ga0495664_0077523 Ga0495664_0077523_362_1306 269
369 3300046559 Ga0495667_0096810 Ga0495667_0096810_775_1785 269
370 3300047321 Ga0495676_0049931 Ga0495676_0049931_670_1614 269
371 3300005355 Ga0070671_100060210 Ga0070671_1000602102 270
372 3300005364 Ga0070673_100208795 Ga0070673_1002087952 270
373 3300005440 Ga0070705_100052232 Ga0070705_1000522322 270
374 3300005441 Ga0070700_100037831 Ga0070700_1000378312 270
375 3300005467 Ga0070706_100041618 Ga0070706_1000416183 270
376 3300005471 Ga0070698_100079619 Ga0070698_1000796192 270
377 3300005530 Ga0070679_100017200 Ga0070679_1000172002 270
378 3300005539 Ga0068853_100021702 Ga0068853_1000217022 270
379 3300005544 Ga0070686_100327818 Ga0070686_1003278181 270
380 3300005563 Ga0068855_100282024 Ga0068855_1002820242 270
381 3300005719 Ga0068861_100187713 Ga0068861_1001877132 270
382 3300005840 Ga0068870_10020961 Ga0068870_100209612 270
383 3300005841 Ga0068863_100074456 Ga0068863_1000744562 270
384 3300006028 Ga0070717_10004576 Ga0070717_100045768 270
385 3300009545 Ga0105237_10478340 Ga0105237_104783402 270
386 3300013102 Ga0157371_10164054 Ga0157371_101640542 270
387 3300013105 Ga0157369_10050496 Ga0157369_100504962 270
388 3300014325 Ga0163163_10270409 Ga0163163_102704092 270
389 3300020077 Ga0206351_10712940 Ga0206351_107129402 270
390 3300020081 Ga0206354_10185635 Ga0206354_101856351 270
391 3300020082 Ga0206353_10226583 Ga0206353_102265832 270
392 3300022467 Ga0224712_10021828 Ga0224712_100218282 270
393 3300022467 Ga0224712_10059808 Ga0224712_100598082 270
394 3300025910 Ga0207684_10001231 Ga0207684_100012313 270
395 3300025912 Ga0207707_10123833 Ga0207707_101238333 270
396 3300025912 Ga0207707_10206896 Ga0207707_102068962 270
397 3300025919 Ga0207657_10001310 Ga0207657_1000131014 270
398 3300025928 Ga0207700_10031540 Ga0207700_100315403 270
399 3300025941 Ga0207711_10196810 Ga0207711_101968102 270
400 3300026067 Ga0207678_10026431 Ga0207678_100264316 270
401 3300026075 Ga0207708_10029372 Ga0207708_100293722 270
402 3300026088 Ga0207641_10057581 Ga0207641_100575812 270
403 3300026088 Ga0207641_10214251 Ga0207641_102142512 270
404 3300026142 Ga0207698_10026148 Ga0207698_100261483 270
405 3300035086 Ga0373934_0012865 Ga0373934_0012865_1656_2663 270
406 3300035086 Ga0373934_0053390 Ga0373934_0053390_489_1487 270
407 3300035089 Ga0373944_0003180 Ga0373944_0003180_2737_3744 270
408 3300035112 Ga0373932_0051135 Ga0373932_0051135_44_1045 270
409 3300035113 Ga0373936_0063976 Ga0373936_0063976_313_1314 270
410 3300035116 Ga0373945_0005152 Ga0373945_0005152_480_1487 270
411 3300035117 Ga0373953_0002922 Ga0373953_0002922_2342_3349 270
412 3300035170 Ga0373943_0005908 Ga0373943_0005908_1899_2906 270
413 3300035171 Ga0373946_0016025 Ga0373946_0016025_1648_2655 270
414 3300035241 Ga0373961_0013273 Ga0373961_0013273_528_1508 270
415 3300035692 Ga0373935_0031617 Ga0373935_0031617_203_1198 270
416 3300035695 Ga0373927_0014004 Ga0373927_0014004_2969_3976 270
417 3300035724 Ga0373933_0010382 Ga0373933_0010382_1663_2670 270
418 3300035725 Ga0373947_0072879 Ga0373947_0072879_365_1372 270
419 3300036401 Ga0373937_0147397 Ga0373937_0147397_374_1372 270
420 3300037068 Ga0373925_0035686 Ga0373925_0035686_1938_2945 270
421 3300046454 Ga0495592_0071279 Ga0495592_0071279_1327_2334 270
422 3300046459 Ga0495629_0048520 Ga0495629_0048520_1232_2239 270
423 3300046461 Ga0495641_0008836 Ga0495641_0008836_3285_4292 270
424 3300046462 Ga0495651_0012113 Ga0495651_0012113_1808_2815 270
425 3300046463 Ga0495653_0028153 Ga0495653_0028153_1102_2109 270
426 3300046463 Ga0495653_0075746 Ga0495653_0075746_959_1999 270
427 3300046472 Ga0495580_0027053 Ga0495580_0027053_1583_2590 270
428 3300046473 Ga0495582_0007311 Ga0495582_0007311_4228_5235 270
429 3300046475 Ga0495639_0052878 Ga0495639_0052878_105_1112 270
430 3300046476 Ga0495662_0021422 Ga0495662_0021422_1380_2387 270
431 3300046477 Ga0495664_0024151 Ga0495664_0024151_746_1753 270
432 3300046499 Ga0495594_0034273 Ga0495594_0034273_1117_2124 270
433 3300046511 Ga0495608_0013938 Ga0495608_0013938_1479_2486 270
434 3300046511 Ga0495608_0130911 Ga0495608_0130911_379_1389 270
435 3300046514 Ga0495618_0030072 Ga0495618_0030072_1133_2140 270
436 3300046517 Ga0495630_0033879 Ga0495630_0033879_1557_2564 270
437 3300046526 Ga0495666_0008890 Ga0495666_0008890_1778_2785 270
438 3300046529 Ga0495652_0035986 Ga0495652_0035986_1379_2386 270
439 3300046531 Ga0495665_0010206 Ga0495665_0010206_1778_2785 270
440 3300046533 Ga0495640_0023445 Ga0495640_0023445_2387_3394 270
441 3300046535 Ga0495586_0026236 Ga0495586_0026236_1386_2393 270
442 3300046543 Ga0495645_0023605 Ga0495645_0023605_1379_2386 270
443 3300046559 Ga0495667_0018223 Ga0495667_0018223_2635_3642 270
444 3300046559 Ga0495667_0081206 Ga0495667_0081206_797_1795 270
445 3300046559 Ga0495667_0194654 Ga0495667_0194654_323_1285 270
446 3300046642 Ga0495634_0032839 Ga0495634_0032839_1822_2829 270
447 3300046663 Ga0495635_0069113 Ga0495635_0069113_782_1789 270
448 3300046675 Ga0495657_0032131 Ga0495657_0032131_1557_2564 270
449 3300046675 Ga0495657_0063864 Ga0495657_0063864_886_1896 270
450 3300046679 Ga0495623_0008762 Ga0495623_0008762_1043_2050 270
451 3300046680 Ga0495646_0011512 Ga0495646_0011512_4031_5038 270
452 3300046683 Ga0495658_0005794 Ga0495658_0005794_1271_2278 270
453 3300046689 Ga0495613_0020505 Ga0495613_0020505_2634_3641 270
454 3300046690 Ga0495624_0010866 Ga0495624_0010866_1130_2137 270
455 3300046809 Ga0495600_0020510 Ga0495600_0020510_1663_2670 270
456 3300047315 Ga0495581_0004305 Ga0495581_0004305_4288_5295 270
457 3300047317 Ga0495604_0028691 Ga0495604_0028691_1062_2069 270
458 3300047319 Ga0495674_0021622 Ga0495674_0021622_3650_4657 270
459 3300047319 Ga0495674_0270437 Ga0495674_0270437_48_1058 270
460 3300047321 Ga0495676_0048961 Ga0495676_0048961_1294_2301 270
461 3300047322 Ga0495680_0040005 Ga0495680_0040005_1514_2512 270
462 3300047322 Ga0495680_0139256 Ga0495680_0139256_537_1547 270
463 3300047444 Ga0495675_0010201 Ga0495675_0010201_2177_3184 270
464 3300047471 Ga0495684_0015171 Ga0495684_0015171_3447_4454 270
465 3300047471 Ga0495684_0058386 Ga0495684_0058386_1419_2429 270
466 3300047673 Ga0495593_0017301 Ga0495593_0017301_1102_2109 270
467 3300048905 Ga0496102_0428916 Ga0496102_0428916_108_1109 270
468 3300048907 Ga0496104_0102413 Ga0496104_0102413_1202_2203 270
469 3300048908 Ga0496105_0008601 Ga0496105_0008601_2921_3922 270
470 3300048911 Ga0496108_0367669 Ga0496108_0367669_169_1170 270
471 3300048913 Ga0496110_0127275 Ga0496110_0127275_997_2019 270
472 3300048914 Ga0496111_0012249 Ga0496111_0012249_3997_4998 270
473 3300053077 Ga0495601_0064978 Ga0495601_0064978_196_1203 270
474 3300053078 Ga0495612_0008818 Ga0495612_0008818_2864_3862 270
475 3300053085 Ga0495619_0007442 Ga0495619_0007442_2387_3394 270
476 3300005338 Ga0068868_100185278 Ga0068868_1001852782 271
477 3300005614 Ga0068856_100071590 Ga0068856_1000715902 271
478 3300006871 Ga0075434_100059863 Ga0075434_1000598634 271
479 3300009147 Ga0114129_10343872 Ga0114129_103438722 271
480 3300026023 Ga0207677_10185444 Ga0207677_101854442 271
481 3300026078 Ga0207702_10425031 Ga0207702_104250312 271
482 3300028666 Ga0265336_10022334 Ga0265336_100223342 271
483 3300028800 Ga0265338_10020419 Ga0265338_100204192 271
484 3300039450 Ga0436363_0403894 Ga0436363_0403894_1059_2000 271
485 3300050513 nmdc:mga0rr50_74415_c1 nmdc:mga0rr50_74415_c1_1122_2084 271
486 3300005467 Ga0070706_100117356 Ga0070706_1001173562 272
487 3300005468 Ga0070707_100007193 Ga0070707_1000071939 272
488 3300005471 Ga0070698_100000052 Ga0070698_10000005231 272
489 3300005471 Ga0070698_100001531 Ga0070698_10000153117 272
490 3300005471 Ga0070698_100062705 Ga0070698_1000627053 272
491 3300005518 Ga0070699_100000680 Ga0070699_10000068014 272
492 3300006028 Ga0070717_10107040 Ga0070717_101070402 272
493 3300025908 Ga0207643_10014378 Ga0207643_100143783 272
494 3300025910 Ga0207684_10148743 Ga0207684_101487432 272
495 3300025922 Ga0207646_10005738 Ga0207646_100057385 272
496 3300005434 Ga0070709_10001842 Ga0070709_1000184210 273
497 3300005434 Ga0070709_10015096 Ga0070709_100150963 273
498 3300005435 Ga0070714_100029642 Ga0070714_1000296422 273
499 3300005435 Ga0070714_100034292 Ga0070714_1000342924 273
500 3300005435 Ga0070714_100084343 Ga0070714_1000843432 273
501 3300005435 Ga0070714_100142812 Ga0070714_1001428122 273
502 3300005436 Ga0070713_100006439 Ga0070713_1000064398 273
503 3300005436 Ga0070713_100033666 Ga0070713_1000336664 273
504 3300005436 Ga0070713_100036237 Ga0070713_1000362373 273
505 3300005436 Ga0070713_100094123 Ga0070713_1000941233 273
506 3300005436 Ga0070713_100129657 Ga0070713_1001296572 273
507 3300005437 Ga0070710_10002857 Ga0070710_100028579 273
508 3300005437 Ga0070710_10022953 Ga0070710_100229532 273
509 3300005439 Ga0070711_100017584 Ga0070711_1000175842 273
510 3300005439 Ga0070711_100047566 Ga0070711_1000475662 273
511 3300005445 Ga0070708_100464717 Ga0070708_1004647171 273
512 3300005458 Ga0070681_10362988 Ga0070681_103629882 273
513 3300005467 Ga0070706_100024074 Ga0070706_1000240745 273
514 3300005468 Ga0070707_100002470 Ga0070707_10000247011 273
515 3300005471 Ga0070698_100003355 Ga0070698_10000335511 273
516 3300005471 Ga0070698_100245607 Ga0070698_1002456072 273
517 3300005614 Ga0068856_100024199 Ga0068856_1000241994 273
518 3300005842 Ga0068858_100404975 Ga0068858_1004049752 273
519 3300006028 Ga0070717_10024868 Ga0070717_100248685 273
520 3300006028 Ga0070717_10047421 Ga0070717_100474214 273
521 3300006028 Ga0070717_10209736 Ga0070717_102097362 273
522 3300006163 Ga0070715_10005103 Ga0070715_100051032 273
523 3300006163 Ga0070715_10013460 Ga0070715_100134602 273
524 3300006173 Ga0070716_100009787 Ga0070716_1000097875 273
525 3300006173 Ga0070716_100017430 Ga0070716_1000174302 273
526 3300006173 Ga0070716_100040838 Ga0070716_1000408382 273
527 3300006175 Ga0070712_100099026 Ga0070712_1000990262 273
528 3300006852 Ga0075433_10055501 Ga0075433_100555012 273
529 3300006871 Ga0075434_100080133 Ga0075434_1000801333 273
530 3300013105 Ga0157369_10066884 Ga0157369_100668842 273
531 3300013296 Ga0157374_10122690 Ga0157374_101226902 273
532 3300025898 Ga0207692_10001454 Ga0207692_100014542 273
533 3300025898 Ga0207692_10016652 Ga0207692_100166523 273
534 3300025898 Ga0207692_10073866 Ga0207692_100738662 273
535 3300025905 Ga0207685_10022255 Ga0207685_100222552 273
536 3300025906 Ga0207699_10001649 Ga0207699_100016498 273
537 3300025906 Ga0207699_10006888 Ga0207699_100068884 273
538 3300025910 Ga0207684_10003550 Ga0207684_100035506 273
539 3300025915 Ga0207693_10001823 Ga0207693_1000182317 273
540 3300025915 Ga0207693_10015224 Ga0207693_100152245 273
541 3300025915 Ga0207693_10273891 Ga0207693_102738912 273
542 3300025915 Ga0207693_10426998 Ga0207693_104269981 273
543 3300025915 Ga0207693_10453916 Ga0207693_104539161 273
544 3300025916 Ga0207663_10024199 Ga0207663_100241992 273
545 3300025916 Ga0207663_10024217 Ga0207663_100242172 273
546 3300025916 Ga0207663_10067652 Ga0207663_100676522 273
547 3300025922 Ga0207646_10000410 Ga0207646_100004109 273
548 3300025922 Ga0207646_10039734 Ga0207646_100397343 273
549 3300025928 Ga0207700_10007761 Ga0207700_100077616 273
550 3300025928 Ga0207700_10008631 Ga0207700_100086312 273
551 3300025928 Ga0207700_10009627 Ga0207700_100096275 273
552 3300025928 Ga0207700_10034111 Ga0207700_100341113 273
553 3300025929 Ga0207664_10016279 Ga0207664_100162792 273
554 3300025929 Ga0207664_10145961 Ga0207664_101459612 273
555 3300025929 Ga0207664_10481950 Ga0207664_104819502 273
556 3300025939 Ga0207665_10000820 Ga0207665_100008204 273
557 3300025939 Ga0207665_10004211 Ga0207665_100042118 273
558 3300025939 Ga0207665_10078040 Ga0207665_100780402 273
559 3300028800 Ga0265338_10011760 Ga0265338_100117609 273
560 3300028800 Ga0265338_10023545 Ga0265338_100235456 273
561 3300035111 Ga0373923_0021064 Ga0373923_0021064_538_1488 273
562 3300035113 Ga0373936_0009357 Ga0373936_0009357_1602_2552 273
563 3300035118 Ga0373954_0015957 Ga0373954_0015957_241_1215 273
564 3300035119 Ga0373956_0011541 Ga0373956_0011541_874_1827 273
565 3300035120 Ga0373957_0048340 Ga0373957_0048340_456_1409 273
566 3300035410 Ga0373924_0004232 Ga0373924_0004232_1059_2009 273
567 3300035692 Ga0373935_0005652 Ga0373935_0005652_2991_3941 273
568 3300035692 Ga0373935_0024881 Ga0373935_0024881_2260_3213 273
569 3300035692 Ga0373935_0083509 Ga0373935_0083509_591_1547 273
570 3300035692 Ga0373935_0166036 Ga0373935_0166036_71_1021 273
571 3300037068 Ga0373925_0022033 Ga0373925_0022033_2930_3883 273
572 3300037068 Ga0373925_0162935 Ga0373925_0162935_165_1121 273
573 3300037068 Ga0373925_0167820 Ga0373925_0167820_18_971 273
574 3300044694 Ga0466963_0140694 Ga0466963_0140694_583_1539 273
575 3300046454 Ga0495592_0006368 Ga0495592_0006368_5367_6320 273
576 3300046459 Ga0495629_0001762 Ga0495629_0001762_7795_8745 273
577 3300046461 Ga0495641_0005823 Ga0495641_0005823_6072_7022 273
578 3300046462 Ga0495651_0003224 Ga0495651_0003224_89_1042 273
579 3300046462 Ga0495651_0041016 Ga0495651_0041016_2242_3192 273
580 3300046463 Ga0495653_0046642 Ga0495653_0046642_405_1355 273
581 3300046473 Ga0495582_0003438 Ga0495582_0003438_3022_3972 273
582 3300046475 Ga0495639_0007273 Ga0495639_0007273_493_1443 273
583 3300046477 Ga0495664_0017914 Ga0495664_0017914_1175_2125 273
584 3300046477 Ga0495664_0057993 Ga0495664_0057993_411_1361 273
585 3300046514 Ga0495618_0012085 Ga0495618_0012085_411_1361 273
586 3300046516 Ga0495628_0046686 Ga0495628_0046686_244_1197 273
587 3300046529 Ga0495652_0004687 Ga0495652_0004687_7355_8308 273
588 3300046531 Ga0495665_0001232 Ga0495665_0001232_7472_8422 273
589 3300046533 Ga0495640_0012221 Ga0495640_0012221_321_1277 273
590 3300046535 Ga0495586_0011987 Ga0495586_0011987_2751_3701 273
591 3300046536 Ga0495587_0007741 Ga0495587_0007741_2011_2964 273
592 3300046543 Ga0495645_0008366 Ga0495645_0008366_4242_5195 273
593 3300046543 Ga0495645_0027262 Ga0495645_0027262_2309_3259 273
594 3300046543 Ga0495645_0031499 Ga0495645_0031499_2419_3375 273
595 3300046543 Ga0495645_0182305 Ga0495645_0182305_434_1384 273
596 3300046559 Ga0495667_0001084 Ga0495667_0001084_5493_6446 273
597 3300046675 Ga0495657_0027700 Ga0495657_0027700_312_1265 273
598 3300046679 Ga0495623_0037632 Ga0495623_0037632_2074_3027 273
599 3300046683 Ga0495658_0004740 Ga0495658_0004740_3049_3999 273
600 3300046689 Ga0495613_0019933 Ga0495613_0019933_3158_4108 273
601 3300046690 Ga0495624_0031339 Ga0495624_0031339_1653_2603 273
602 3300046690 Ga0495624_0044841 Ga0495624_0044841_1184_2140 273
603 3300046809 Ga0495600_0008555 Ga0495600_0008555_5047_6000 273
604 3300047315 Ga0495581_0008580 Ga0495581_0008580_2030_2980 273
605 3300047317 Ga0495604_0009707 Ga0495604_0009707_5105_6058 273
606 3300047319 Ga0495674_0004597 Ga0495674_0004597_7812_8768 273
607 3300047319 Ga0495674_0076958 Ga0495674_0076958_1413_2363 273
608 3300047319 Ga0495674_0342196 Ga0495674_0342196_92_1045 273
609 3300047322 Ga0495680_0007755 Ga0495680_0007755_5343_6296 273
610 3300047322 Ga0495680_0031589 Ga0495680_0031589_2437_3387 273
611 3300047471 Ga0495684_0013810 Ga0495684_0013810_5018_5971 273
612 3300047673 Ga0495593_0001196 Ga0495593_0001196_11074_12024 273
613 3300048903 Ga0496100_0017830 Ga0496100_0017830_1444_2391 273
614 3300048905 Ga0496102_0098354 Ga0496102_0098354_1038_1985 273
615 3300048907 Ga0496104_0005141 Ga0496104_0005141_5176_6123 273
616 3300048908 Ga0496105_0003238 Ga0496105_0003238_5387_6334 273
617 3300048912 Ga0496109_0214400 Ga0496109_0214400_90_1037 273
618 3300048915 Ga0496112_0012492 Ga0496112_0012492_2050_2997 273
619 3300048916 Ga0496113_0008348 Ga0496113_0008348_2087_3034 273
620 3300048917 Ga0496114_0127014 Ga0496114_0127014_714_1661 273
621 3300048918 Ga0496115_0035600 Ga0496115_0035600_1667_2614 273
622 3300050512 nmdc:mga0n895_10653_c1 nmdc:mga0n895_10653_c1_5453_6400 273
623 3300050514 nmdc:mga08x19_54970_c1 nmdc:mga08x19_54970_c1_431_1378 273
624 3300053077 Ga0495601_0039898 Ga0495601_0039898_1549_2505 273
625 3300053078 Ga0495612_0019936 Ga0495612_0019936_1085_2041 273
626 3300053084 Ga0495595_0003727 Ga0495595_0003727_2451_3401 273
627 3300053084 Ga0495595_0010621 Ga0495595_0010621_2518_3471 273
628 3300053085 Ga0495619_0009673 Ga0495619_0009673_1263_2213 273
629 3300005434 Ga0070709_10000154 Ga0070709_1000015418 274
630 3300005435 Ga0070714_100006056 Ga0070714_1000060568 274
631 3300005436 Ga0070713_100000392 Ga0070713_1000003924 274
632 3300005437 Ga0070710_10001998 Ga0070710_100019982 274
633 3300005439 Ga0070711_100004404 Ga0070711_1000044049 274
634 3300005445 Ga0070708_100006382 Ga0070708_1000063827 274
635 3300005467 Ga0070706_100013788 Ga0070706_1000137882 274
636 3300005467 Ga0070706_100082273 Ga0070706_1000822732 274
637 3300005467 Ga0070706_100197160 Ga0070706_1001971602 274
638 3300005468 Ga0070707_100029449 Ga0070707_1000294495 274
639 3300005471 Ga0070698_100073638 Ga0070698_1000736382 274
640 3300005471 Ga0070698_100080388 Ga0070698_1000803882 274
641 3300006028 Ga0070717_10000872 Ga0070717_100008728 274
642 3300006163 Ga0070715_10010248 Ga0070715_100102484 274
643 3300006173 Ga0070716_100000326 Ga0070716_1000003265 274
644 3300006175 Ga0070712_100001194 Ga0070712_10000119415 274
645 3300006175 Ga0070712_100319642 Ga0070712_1003196422 274
646 3300006175 Ga0070712_100390879 Ga0070712_1003908791 274
647 3300025898 Ga0207692_10000150 Ga0207692_100001509 274
648 3300025906 Ga0207699_10000205 Ga0207699_1000020532 274
649 3300025910 Ga0207684_10047080 Ga0207684_100470802 274
650 3300025915 Ga0207693_10000355 Ga0207693_1000035515 274
651 3300025922 Ga0207646_10029887 Ga0207646_100298874 274
652 3300025928 Ga0207700_10006240 Ga0207700_100062401 274
653 3300025929 Ga0207664_10001022 Ga0207664_1000102216 274
654 3300025939 Ga0207665_10000480 Ga0207665_1000048013 274
655 3300039437 Ga0436365_0875851 Ga0436365_0875851_78_1058 274
656 3300005435 Ga0070714_100000250 Ga0070714_10000025032 275
657 3300005436 Ga0070713_100046325 Ga0070713_1000463252 275
658 3300005617 Ga0068859_100161621 Ga0068859_1001616212 275
659 3300006175 Ga0070712_100186137 Ga0070712_1001861372 275
660 3300006931 Ga0097620_100161632 Ga0097620_1001616323 275
661 3300009093 Ga0105240_10132544 Ga0105240_101325442 275
662 3300009176 Ga0105242_10081715 Ga0105242_100817152 275
663 3300021388 Ga0213875_10014031 Ga0213875_100140315 275
664 3300025920 Ga0207649_10067066 Ga0207649_100670662 275
665 3300025928 Ga0207700_10080243 Ga0207700_100802432 275
666 3300025929 Ga0207664_10001579 Ga0207664_100015798 275
667 3300025929 Ga0207664_10017269 Ga0207664_100172691 275
668 3300025933 Ga0207706_10008680 Ga0207706_100086802 275
669 3300025939 Ga0207665_10015042 Ga0207665_100150422 275
670 3300025942 Ga0207689_10012065 Ga0207689_100120654 275
671 3300026121 Ga0207683_10006285 Ga0207683_100062855 275
672 3300035724 Ga0373933_0106653 Ga0373933_0106653_298_1269 275
673 3300037853 Ga0436364_1050209 Ga0436364_1050209_231_1211 275
674 3300046462 Ga0495651_0018552 Ga0495651_0018552_1587_2558 275
675 3300046463 Ga0495653_0120745 Ga0495653_0120745_409_1380 275
676 3300046477 Ga0495664_0018583 Ga0495664_0018583_2016_2987 275
677 3300046511 Ga0495608_0093154 Ga0495608_0093154_476_1447 275
678 3300046516 Ga0495628_0136949 Ga0495628_0136949_328_1299 275
679 3300046529 Ga0495652_0035183 Ga0495652_0035183_844_1815 275
680 3300046559 Ga0495667_0018435 Ga0495667_0018435_633_1604 275
681 3300046663 Ga0495635_0047735 Ga0495635_0047735_1066_2037 275
682 3300046675 Ga0495657_0029918 Ga0495657_0029918_2126_3097 275
683 3300046678 Ga0495599_0036480 Ga0495599_0036480_1173_2144 275
684 3300047317 Ga0495604_0081466 Ga0495604_0081466_882_1853 275
685 3300047319 Ga0495674_0134740 Ga0495674_0134740_492_1463 275
686 3300047322 Ga0495680_0018841 Ga0495680_0018841_1446_2417 275
687 3300047471 Ga0495684_0122860 Ga0495684_0122860_268_1239 275
688 3300048088 Ga0495602_0023040 Ga0495602_0023040_1586_2557 275
689 3300053085 Ga0495619_0108689 Ga0495619_0108689_595_1566 275
690 3300044694 Ga0466963_0062727 Ga0466963_0062727_315_1298 277
691 3300048915 Ga0496112_0468566 Ga0496112_0468566_107_1090 277
692 3300005327 Ga0070658_10219132 Ga0070658_102191322 278
693 3300005343 Ga0070687_100163035 Ga0070687_1001630351 278
694 3300005434 Ga0070709_10204086 Ga0070709_102040862 278
695 3300006358 Ga0068871_100150648 Ga0068871_1001506482 278
696 3300025906 Ga0207699_10066224 Ga0207699_100662241 278
697 3300025909 Ga0207705_10294298 Ga0207705_102942982 278
698 3300025936 Ga0207670_10040413 Ga0207670_100404132 278
699 3300026067 Ga0207678_10002951 Ga0207678_1000295113 278
700 3300026089 Ga0207648_10072108 Ga0207648_100721082 278
701 3300035092 Ga0373952_0013920 Ga0373952_0013920_296_1276 278
702 3300039437 Ga0436365_0960103 Ga0436365_0960103_33_1022 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

193

267

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9069 139 213
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9009 139 213
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9003 139 211
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.897 139 211
2fwl-assembly1.cif.gz_B the cytochrome c552/cua complex from thermus thermophilus 0.8903 140 213
ID Description Score Start End Superfamily
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9163 138 225 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9142 138 222 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9032 139 213 2.60.40.420
4txvD00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8653 137 227 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.843 140 212 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A534X6Q5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.938 139 224 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A1B7W373-F1-model_v4 Cytochrome C oxidase subunit II 0.9362 135 226 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2R6HYA6-F1-model_v4 Cytochrome c oxidase subunit II 0.9327 140 226 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-E1IGZ6-F1-model_v4 Cytochrome c oxidase, subunit II 0.9301 139 222 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A534AHQ0-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.93 139 229 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Feature Viewer

pLDDT pTM Quality
80.88 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map