F476106
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 253 | 1400 | 38 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0591104|Ga0395900_0591104_836_964 |
| Length | 42 |
| Sequence | MAPFTDPELARKNVRLGWLLFGIFLLLFAGTFGVAFLYLAFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 3 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 5 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 6 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 7 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 8 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 14 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 15 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 16 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 17 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 18 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 24 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 36 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 42 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 71 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 73 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 74 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 75 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 76 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 77 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 84 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 86 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 93 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 96 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 97 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 98 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 103 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 105 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 107 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 119 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 122 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 125 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 126 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.71 |
| Rhizosphere | 89.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0591104 | 3300037418 | Bacteria | 1051 |
| 2 | Ga0070710_11157663 | 3300005437 | Bacteria | 570 |
| 3 | Ga0070664_100764184 | 3300005564 | Bacteria | 902 |
| 4 | Ga0068857_100537848 | 3300005577 | Bacteria | 1100 |
| 5 | Ga0068857_102348706 | 3300005577 | Bacteria | 524 |
| 6 | Ga0068856_100065074 | 3300005614 | Bacteria | 3602 |
| 7 | Ga0068856_100112187 | 3300005614 | Bacteria | 2724 |
| 8 | Ga0068863_100445810 | 3300005841 | Bacteria | 1270 |
| 9 | Ga0068860_102150714 | 3300005843 | Unclassified | 579 |
| 10 | Ga0070717_10058314 | 3300006028 | Bacteria | 3192 |
| 11 | Ga0070717_10107197 | 3300006028 | Bacteria | 2379 |
| 12 | Ga0070717_10111880 | 3300006028 | Bacteria | 2330 |
| 13 | Ga0070717_10293750 | 3300006028 | Bacteria | 1443 |
| 14 | Ga0070717_10363685 | 3300006028 | Bacteria | 1295 |
| 15 | Ga0070717_10784415 | 3300006028 | Bacteria | 867 |
| 16 | Ga0070715_10000948 | 3300006163 | Bacteria | 8098 |
| 17 | Ga0070715_10497960 | 3300006163 | Bacteria | 697 |
| 18 | Ga0070715_11098406 | 3300006163 | Bacteria | 501 |
| 19 | Ga0070716_100003355 | 3300006173 | Bacteria | 7529 |
| 20 | Ga0070716_100463523 | 3300006173 | Bacteria | 927 |
| 21 | Ga0070716_100805149 | 3300006173 | Bacteria | 728 |
| 22 | Ga0070716_101430677 | 3300006173 | Bacteria | 563 |
| 23 | Ga0070712_100054038 | 3300006175 | Bacteria | 2806 |
| 24 | Ga0070712_100114735 | 3300006175 | Bacteria | 2017 |
| 25 | Ga0070712_100232096 | 3300006175 | Bacteria | 1466 |
| 26 | Ga0070712_100297695 | 3300006175 | Bacteria | 1305 |
| 27 | Ga0070712_100639888 | 3300006175 | Bacteria | 903 |
| 28 | Ga0097621_100708829 | 3300006237 | Bacteria | 927 |
| 29 | Ga0097621_100709100 | 3300006237 | Bacteria | 927 |
| 30 | Ga0068871_100935773 | 3300006358 | Unclassified | 804 |
| 31 | Ga0075433_10144857 | 3300006852 | Bacteria | 2112 |
| 32 | Ga0075433_11785915 | 3300006852 | Unclassified | 529 |
| 33 | Ga0075434_100037607 | 3300006871 | Bacteria | 4792 |
| 34 | Ga0075434_101510775 | 3300006871 | Bacteria | 681 |
| 35 | Ga0075434_102472552 | 3300006871 | Bacteria | 521 |
| 36 | Ga0075436_100383248 | 3300006914 | Bacteria | 1017 |
| 37 | Ga0075436_100613548 | 3300006914 | Bacteria | 802 |
| 38 | Ga0099794_10371337 | 3300007265 | Bacteria | 745 |
| 39 | Ga0105240_11273755 | 3300009093 | Unclassified | 776 |
| 40 | Ga0105245_10594946 | 3300009098 | Bacteria | 1132 |
| 41 | Ga0105245_10611017 | 3300009098 | Bacteria | 1118 |
| 42 | Ga0105245_10717380 | 3300009098 | Unclassified | 1034 |
| 43 | Ga0105242_11656206 | 3300009176 | Bacteria | 675 |
| 44 | Ga0105248_10162033 | 3300009177 | Bacteria | 2522 |
| 45 | Ga0105238_10290448 | 3300009551 | Bacteria | 1617 |
| 46 | Ga0099796_10124412 | 3300010159 | Bacteria | 994 |
| 47 | Ga0105239_10427718 | 3300010375 | Bacteria | 1501 |
| 48 | Ga0105239_13082614 | 3300010375 | Bacteria | 543 |
| 49 | Ga0105246_10859752 | 3300011119 | Bacteria | 810 |
| 50 | Ga0157373_10989757 | 3300013100 | Unclassified | 627 |
| 51 | Ga0157371_11526391 | 3300013102 | Bacteria | 521 |
| 52 | Ga0157370_10786736 | 3300013104 | Bacteria | 866 |
| 53 | Ga0157370_10922208 | 3300013104 | Bacteria | 792 |
| 54 | Ga0157370_11031751 | 3300013104 | Bacteria | 744 |
| 55 | Ga0157369_10036406 | 3300013105 | Bacteria | 5392 |
| 56 | Ga0157369_10384260 | 3300013105 | Bacteria | 1457 |
| 57 | Ga0157369_10405568 | 3300013105 | Bacteria | 1414 |
| 58 | Ga0157369_10571362 | 3300013105 | Bacteria | 1168 |
| 59 | Ga0157369_10733626 | 3300013105 | Bacteria | 1017 |
| 60 | Ga0157369_10929375 | 3300013105 | Bacteria | 892 |
| 61 | Ga0157369_11125977 | 3300013105 | Bacteria | 802 |
| 62 | Ga0157374_10043054 | 3300013296 | Bacteria | 4169 |
| 63 | Ga0157374_10062924 | 3300013296 | Bacteria | 3479 |
| 64 | Ga0157374_10739468 | 3300013296 | Bacteria | 998 |
| 65 | Ga0157374_12979035 | 3300013296 | Unclassified | 500 |
| 66 | Ga0163162_11289799 | 3300013306 | Unclassified | 830 |
| 67 | Ga0157372_10070515 | 3300013307 | Bacteria | 3932 |
| 68 | Ga0157372_10225721 | 3300013307 | Unclassified | 2171 |
| 69 | Ga0157372_10452791 | 3300013307 | Bacteria | 1496 |
| 70 | Ga0157372_12264480 | 3300013307 | Unclassified | 624 |
| 71 | Ga0157375_10202136 | 3300013308 | Bacteria | 2143 |
| 72 | Ga0163163_11728264 | 3300014325 | Bacteria | 686 |
| 73 | Ga0182008_10487483 | 3300014497 | Bacteria | 676 |
| 74 | Ga0157379_10059231 | 3300014968 | Bacteria | 3424 |
| 75 | Ga0157376_10049834 | 3300014969 | Bacteria | 3471 |
| 76 | Ga0206356_10044910 | 3300020070 | Bacteria | 1616 |
| 77 | Ga0206354_11148611 | 3300020081 | Bacteria | 844 |
| 78 | Ga0206353_10090081 | 3300020082 | Bacteria | 1722 |
| 79 | Ga0206353_11737025 | 3300020082 | Bacteria | 725 |
| 80 | Ga0213876_10760253 | 3300021384 | Bacteria | 516 |
| 81 | Ga0207692_10011074 | 3300025898 | Bacteria | 3820 |
| 82 | Ga0207692_10040028 | 3300025898 | Bacteria | 2310 |
| 83 | Ga0207692_10637311 | 3300025898 | Bacteria | 688 |
| 84 | Ga0207692_11058531 | 3300025898 | Bacteria | 537 |
| 85 | Ga0207685_10002067 | 3300025905 | Bacteria | 4485 |
| 86 | Ga0207685_10462154 | 3300025905 | Bacteria | 662 |
| 87 | Ga0207699_10006523 | 3300025906 | Bacteria | 5656 |
| 88 | Ga0207699_10147315 | 3300025906 | Bacteria | 1554 |
| 89 | Ga0207699_11164078 | 3300025906 | Bacteria | 571 |
| 90 | Ga0207705_10080573 | 3300025909 | Bacteria | 2372 |
| 91 | Ga0207705_10268550 | 3300025909 | Bacteria | 1304 |
| 92 | Ga0207684_10500306 | 3300025910 | Bacteria | 1042 |
| 93 | Ga0207707_10107723 | 3300025912 | Bacteria | 2436 |
| 94 | Ga0207707_10738238 | 3300025912 | Bacteria | 824 |
| 95 | Ga0207707_10874882 | 3300025912 | Bacteria | 744 |
| 96 | Ga0207693_10000745 | 3300025915 | Bacteria | 29290 |
| 97 | Ga0207693_10007103 | 3300025915 | Bacteria | 9237 |
| 98 | Ga0207693_10408870 | 3300025915 | Bacteria | 1061 |
| 99 | Ga0207693_10451931 | 3300025915 | Bacteria | 1004 |
| 100 | Ga0207693_10792254 | 3300025915 | Bacteria | 731 |
| 101 | Ga0207663_10022898 | 3300025916 | Bacteria | 3576 |
| 102 | Ga0207663_10077887 | 3300025916 | Bacteria | 2159 |
| 103 | Ga0207663_10705648 | 3300025916 | Bacteria | 799 |
| 104 | Ga0207663_11507861 | 3300025916 | Bacteria | 541 |
| 105 | Ga0207663_11642654 | 3300025916 | Bacteria | 517 |
| 106 | Ga0207660_10241427 | 3300025917 | Bacteria | 1423 |
| 107 | Ga0207660_10480221 | 3300025917 | Bacteria | 1007 |
| 108 | Ga0207660_10751692 | 3300025917 | Bacteria | 796 |
| 109 | Ga0207657_10007302 | 3300025919 | Bacteria | 11331 |
| 110 | Ga0207657_10049531 | 3300025919 | Bacteria | 3660 |
| 111 | Ga0207657_10070725 | 3300025919 | Bacteria | 2956 |
| 112 | Ga0207649_10147839 | 3300025920 | Bacteria | 1615 |
| 113 | Ga0207649_10717597 | 3300025920 | Bacteria | 776 |
| 114 | Ga0207649_11186658 | 3300025920 | Bacteria | 603 |
| 115 | Ga0207652_10251379 | 3300025921 | Bacteria | 1594 |
| 116 | Ga0207652_10478669 | 3300025921 | Bacteria | 1121 |
| 117 | Ga0207652_10598223 | 3300025921 | Bacteria | 989 |
| 118 | Ga0207646_10000785 | 3300025922 | Bacteria | 41163 |
| 119 | Ga0207646_10260192 | 3300025922 | Bacteria | 1568 |
| 120 | Ga0207687_10107096 | 3300025927 | Bacteria | 2068 |
| 121 | Ga0207687_10708384 | 3300025927 | Bacteria | 855 |
| 122 | Ga0207700_10002676 | 3300025928 | Bacteria | 10263 |
| 123 | Ga0207700_10109462 | 3300025928 | Bacteria | 2220 |
| 124 | Ga0207700_10196100 | 3300025928 | Bacteria | 1699 |
| 125 | Ga0207700_10564345 | 3300025928 | Bacteria | 1011 |
| 126 | Ga0207700_11241096 | 3300025928 | Bacteria | 665 |
| 127 | Ga0207700_11934159 | 3300025928 | Bacteria | 516 |
| 128 | Ga0207664_10021059 | 3300025929 | Bacteria | 4840 |
| 129 | Ga0207664_10084127 | 3300025929 | Bacteria | 2594 |
| 130 | Ga0207664_10106892 | 3300025929 | Bacteria | 2321 |
| 131 | Ga0207664_10143967 | 3300025929 | Bacteria | 2019 |
| 132 | Ga0207664_10145301 | 3300025929 | Bacteria | 2010 |
| 133 | Ga0207664_10158498 | 3300025929 | Bacteria | 1929 |
| 134 | Ga0207664_10180584 | 3300025929 | Bacteria | 1811 |
| 135 | Ga0207664_10313299 | 3300025929 | Bacteria | 1383 |
| 136 | Ga0207664_10415570 | 3300025929 | Bacteria | 1198 |
| 137 | Ga0207664_10461744 | 3300025929 | Bacteria | 1134 |
| 138 | Ga0207664_10639747 | 3300025929 | Bacteria | 956 |
| 139 | Ga0207664_10815597 | 3300025929 | Bacteria | 839 |
| 140 | Ga0207664_11210029 | 3300025929 | Bacteria | 674 |
| 141 | Ga0207664_11613461 | 3300025929 | Unclassified | 571 |
| 142 | Ga0207664_11888093 | 3300025929 | Bacteria | 520 |
| 143 | Ga0207664_12006823 | 3300025929 | Bacteria | 501 |
| 144 | Ga0207644_10385282 | 3300025931 | Bacteria | 1144 |
| 145 | Ga0207690_10656146 | 3300025932 | Bacteria | 860 |
| 146 | Ga0207690_10799905 | 3300025932 | Bacteria | 779 |
| 147 | Ga0207686_10724047 | 3300025934 | Bacteria | 792 |
| 148 | Ga0207665_10001126 | 3300025939 | Bacteria | 17976 |
| 149 | Ga0207665_10109893 | 3300025939 | Bacteria | 1936 |
| 150 | Ga0207665_11266956 | 3300025939 | Bacteria | 588 |
| 151 | Ga0207711_10243885 | 3300025941 | Bacteria | 1648 |
| 152 | Ga0207661_10654748 | 3300025944 | Bacteria | 965 |
| 153 | Ga0207661_10998481 | 3300025944 | Unclassified | 771 |
| 154 | Ga0207661_11352880 | 3300025944 | Bacteria | 654 |
| 155 | Ga0207661_11952865 | 3300025944 | Bacteria | 533 |
| 156 | Ga0207679_10315203 | 3300025945 | Bacteria | 1353 |
| 157 | Ga0207679_10429779 | 3300025945 | Bacteria | 1167 |
| 158 | Ga0207667_10205505 | 3300025949 | Bacteria | 2019 |
| 159 | Ga0207667_11526324 | 3300025949 | Bacteria | 638 |
| 160 | Ga0207639_10525801 | 3300026041 | Bacteria | 1084 |
| 161 | Ga0207639_11151184 | 3300026041 | Bacteria | 728 |
| 162 | Ga0207639_11196606 | 3300026041 | Unclassified | 713 |
| 163 | Ga0207678_10287560 | 3300026067 | Bacteria | 1412 |
| 164 | Ga0207702_10068409 | 3300026078 | Bacteria | 3051 |
| 165 | Ga0207702_10098038 | 3300026078 | Bacteria | 2581 |
| 166 | Ga0207702_10542929 | 3300026078 | Bacteria | 1136 |
| 167 | Ga0207698_11482965 | 3300026142 | Bacteria | 694 |
| 168 | Ga0207698_11808155 | 3300026142 | Bacteria | 626 |
| 169 | Ga0207428_10287891 | 3300027907 | Bacteria | 1218 |
| 170 | Ga0268264_12319667 | 3300028381 | Unclassified | 543 |
| 171 | Ga0265326_10007165 | 3300028558 | Bacteria | 3428 |
| 172 | Ga0265326_10025248 | 3300028558 | Bacteria | 1695 |
| 173 | Ga0265319_1016183 | 3300028563 | Bacteria | 2864 |
| 174 | Ga0265319_1052069 | 3300028563 | Bacteria | 1348 |
| 175 | Ga0265319_1286504 | 3300028563 | Unclassified | 501 |
| 176 | Ga0265334_10002601 | 3300028573 | Bacteria | 8412 |
| 177 | Ga0265334_10157498 | 3300028573 | Bacteria | 799 |
| 178 | Ga0265318_10000633 | 3300028577 | Bacteria | 24181 |
| 179 | Ga0265318_10026077 | 3300028577 | Bacteria | 2304 |
| 180 | Ga0265318_10061572 | 3300028577 | Bacteria | 1398 |
| 181 | Ga0265318_10095995 | 3300028577 | Bacteria | 1091 |
| 182 | Ga0265318_10211203 | 3300028577 | Unclassified | 709 |
| 183 | Ga0265323_10201493 | 3300028653 | Bacteria | 626 |
| 184 | Ga0265322_10015772 | 3300028654 | Bacteria | 2181 |
| 185 | Ga0265322_10082578 | 3300028654 | Unclassified | 912 |
| 186 | Ga0265322_10247027 | 3300028654 | Bacteria | 512 |
| 187 | Ga0265338_10017133 | 3300028800 | Bacteria | 7830 |
| 188 | Ga0265338_10018943 | 3300028800 | Bacteria | 7336 |
| 189 | Ga0265338_10019624 | 3300028800 | Bacteria | 7158 |
| 190 | Ga0265338_10401884 | 3300028800 | Bacteria | 976 |
| 191 | Ga0265338_10580100 | 3300028800 | Bacteria | 782 |
| 192 | Ga0265330_10002779 | 3300031235 | Bacteria | 9395 |
| 193 | Ga0265330_10302312 | 3300031235 | Bacteria | 674 |
| 194 | Ga0265332_10006125 | 3300031238 | Bacteria | 5490 |
| 195 | Ga0265332_10394495 | 3300031238 | Bacteria | 572 |
| 196 | Ga0265328_10008252 | 3300031239 | Bacteria | 4305 |
| 197 | Ga0265320_10017649 | 3300031240 | Bacteria | 3955 |
| 198 | Ga0265320_10034456 | 3300031240 | Bacteria | 2575 |
| 199 | Ga0265320_10162881 | 3300031240 | Bacteria | 1004 |
| 200 | Ga0265320_10181968 | 3300031240 | Bacteria | 942 |
| 201 | Ga0265325_10008761 | 3300031241 | Bacteria | 5949 |
| 202 | Ga0265325_10046388 | 3300031241 | Bacteria | 2254 |
| 203 | Ga0265325_10129283 | 3300031241 | Bacteria | 1211 |
| 204 | Ga0265329_10001093 | 3300031242 | Bacteria | 13312 |
| 205 | Ga0265329_10194887 | 3300031242 | Bacteria | 665 |
| 206 | Ga0265340_10003071 | 3300031247 | Bacteria | 9478 |
| 207 | Ga0265340_10062773 | 3300031247 | Bacteria | 1774 |
| 208 | Ga0265340_10149598 | 3300031247 | Bacteria | 1065 |
| 209 | Ga0265339_10010742 | 3300031249 | Bacteria | 5670 |
| 210 | Ga0265339_10084167 | 3300031249 | Bacteria | 1676 |
| 211 | Ga0265339_10378755 | 3300031249 | Bacteria | 663 |
| 212 | Ga0265331_10039278 | 3300031250 | Bacteria | 2308 |
| 213 | Ga0265327_10054714 | 3300031251 | Bacteria | 2064 |
| 214 | Ga0265327_10153798 | 3300031251 | Bacteria | 1067 |
| 215 | Ga0265316_10013122 | 3300031344 | Bacteria | 7380 |
| 216 | Ga0265316_10014571 | 3300031344 | Bacteria | 6913 |
| 217 | Ga0265316_10160270 | 3300031344 | Bacteria | 1682 |
| 218 | Ga0265313_10010591 | 3300031595 | Bacteria | 5809 |
| 219 | Ga0265313_10013762 | 3300031595 | Bacteria | 4825 |
| 220 | Ga0265313_10082263 | 3300031595 | Bacteria | 1460 |
| 221 | Ga0265314_10012611 | 3300031711 | Bacteria | 6881 |
| 222 | Ga0265314_10022648 | 3300031711 | Bacteria | 4810 |
| 223 | Ga0265314_10028551 | 3300031711 | Bacteria | 4158 |
| 224 | Ga0265342_10015434 | 3300031712 | Bacteria | 5022 |
| 225 | Ga0265342_10102346 | 3300031712 | Bacteria | 1630 |
| 226 | Ga0265342_10280908 | 3300031712 | Bacteria | 881 |
| 227 | Ga0373948_0056106 | 3300034817 | Bacteria | 856 |
| 228 | Ga0373934_0512907 | 3300035086 | Bacteria | 504 |
| 229 | Ga0373940_0067924 | 3300035088 | Bacteria | 1032 |
| 230 | Ga0373952_0050654 | 3300035092 | Bacteria | 989 |
| 231 | Ga0373939_0388982 | 3300035114 | Bacteria | 575 |
| 232 | Ga0373941_0062192 | 3300035115 | Bacteria | 1218 |
| 233 | Ga0373953_0257906 | 3300035117 | Bacteria | 758 |
| 234 | Ga0373953_0384074 | 3300035117 | Bacteria | 617 |
| 235 | Ga0373954_0533084 | 3300035118 | Bacteria | 582 |
| 236 | Ga0373956_0130267 | 3300035119 | Bacteria | 1177 |
| 237 | Ga0373957_0307810 | 3300035120 | Bacteria | 673 |
| 238 | Ga0373960_0300862 | 3300035121 | Bacteria | 596 |
| 239 | Ga0373943_0919162 | 3300035170 | Bacteria | 523 |
| 240 | Ga0373946_0230190 | 3300035171 | Bacteria | 898 |
| 241 | Ga0373962_0058709 | 3300035242 | Bacteria | 1125 |
| 242 | Ga0373924_0093813 | 3300035410 | Bacteria | 1286 |
| 243 | Ga0373931_0014101 | 3300035691 | Bacteria | 3902 |
| 244 | Ga0373935_0037735 | 3300035692 | Bacteria | 3024 |
| 245 | Ga0373935_1504351 | 3300035692 | Unclassified | 504 |
| 246 | Ga0373933_0195799 | 3300035724 | Bacteria | 1292 |
| 247 | Ga0373947_0929308 | 3300035725 | Bacteria | 594 |
| 248 | Ga0373937_0002033 | 3300036401 | Bacteria | 16891 |
| 249 | Ga0373937_0186662 | 3300036401 | Bacteria | 1948 |
| 250 | Ga0373937_0719603 | 3300036401 | Bacteria | 945 |
| 251 | Ga0373925_1182254 | 3300037068 | Bacteria | 629 |
| 252 | Ga0395899_0047446 | 3300037312 | Bacteria | 3198 |
| 253 | Ga0395899_0057892 | 3300037312 | Bacteria | 2859 |
| 254 | Ga0395899_0067585 | 3300037312 | Bacteria | 2622 |
| 255 | Ga0395900_0030345 | 3300037418 | Bacteria | 5551 |
| 256 | Ga0395900_0035416 | 3300037418 | Bacteria | 5141 |
| 257 | Ga0395900_0098878 | 3300037418 | Bacteria | 2998 |
| 258 | Ga0395900_0428741 | 3300037418 | Bacteria | 1282 |
| 259 | Ga0395900_1709206 | 3300037418 | Bacteria | 540 |
| 260 | Ga0395898_0020962 | 3300037466 | Bacteria | 6631 |
| 261 | Ga0395898_0084361 | 3300037466 | Bacteria | 3062 |
| 262 | Ga0395898_0383815 | 3300037466 | Bacteria | 1340 |
| 263 | Ga0395898_0444001 | 3300037466 | Bacteria | 1236 |
| 264 | Ga0395898_0623328 | 3300037466 | Bacteria | 1021 |
| 265 | Ga0395898_0631911 | 3300037466 | Bacteria | 1013 |
| 266 | Ga0395898_0938157 | 3300037466 | Bacteria | 803 |
| 267 | Ga0395898_1123903 | 3300037466 | Bacteria | 718 |
| 268 | Ga0395905_0089531 | 3300037471 | Bacteria | 2884 |
| 269 | Ga0395905_0114155 | 3300037471 | Bacteria | 2538 |
| 270 | Ga0395905_0916723 | 3300037471 | Unclassified | 779 |
| 271 | Ga0395905_1558262 | 3300037471 | Bacteria | 565 |
| 272 | Ga0395901_0009177 | 3300038443 | Bacteria | 10021 |
| 273 | Ga0395901_0017820 | 3300038443 | Bacteria | 7248 |
| 274 | Ga0395901_0273352 | 3300038443 | Bacteria | 1757 |
| 275 | Ga0395901_0438043 | 3300038443 | Bacteria | 1338 |
| 276 | Ga0395901_0526323 | 3300038443 | Bacteria | 1200 |
| 277 | Ga0395901_1009372 | 3300038443 | Bacteria | 808 |
| 278 | Ga0395901_1567046 | 3300038443 | Bacteria | 613 |
| 279 | Ga0395901_1981058 | 3300038443 | Bacteria | 529 |
| 280 | Ga0436365_1727373 | 3300039437 | Bacteria | 1222 |
| 281 | Ga0436360_1250321 | 3300039438 | Unclassified | 907 |
| 282 | Ga0436363_1652782 | 3300039450 | Bacteria | 732 |
| 283 | Ga0466969_0001344 | 3300044656 | Bacteria | 13262 |
| 284 | Ga0466969_0061412 | 3300044656 | Bacteria | 1825 |
| 285 | Ga0466969_0288416 | 3300044656 | Bacteria | 743 |
| 286 | Ga0466965_0050060 | 3300044683 | Bacteria | 2071 |
| 287 | Ga0466965_0058393 | 3300044683 | Bacteria | 1924 |
| 288 | Ga0466965_0091325 | 3300044683 | Bacteria | 1549 |
| 289 | Ga0466965_0213444 | 3300044683 | Bacteria | 1027 |
| 290 | Ga0466965_0419956 | 3300044683 | Bacteria | 741 |
| 291 | Ga0466965_0574034 | 3300044683 | Bacteria | 639 |
| 292 | Ga0466966_0002635 | 3300044684 | Bacteria | 11745 |
| 293 | Ga0466966_0021639 | 3300044684 | Bacteria | 4222 |
| 294 | Ga0466966_0145615 | 3300044684 | Bacteria | 1446 |
| 295 | Ga0466966_0841067 | 3300044684 | Bacteria | 553 |
| 296 | Ga0466961_0001489 | 3300044693 | Bacteria | 14537 |
| 297 | Ga0466961_0003353 | 3300044693 | Bacteria | 9994 |
| 298 | Ga0466961_0004912 | 3300044693 | Bacteria | 8407 |
| 299 | Ga0466961_0022211 | 3300044693 | Bacteria | 4082 |
| 300 | Ga0466961_0443854 | 3300044693 | Bacteria | 785 |
| 301 | Ga0466963_0000049 | 3300044694 | Bacteria | 39571 |
| 302 | Ga0466963_0006191 | 3300044694 | Bacteria | 7066 |
| 303 | Ga0466963_0006435 | 3300044694 | Bacteria | 6948 |
| 304 | Ga0466963_0006856 | 3300044694 | Bacteria | 6778 |
| 305 | Ga0466963_0007471 | 3300044694 | Bacteria | 6520 |
| 306 | Ga0466963_0011460 | 3300044694 | Bacteria | 5400 |
| 307 | Ga0466963_0013668 | 3300044694 | Bacteria | 4991 |
| 308 | Ga0466963_0014157 | 3300044694 | Bacteria | 4914 |
| 309 | Ga0466963_0026461 | 3300044694 | Bacteria | 3710 |
| 310 | Ga0466963_0032990 | 3300044694 | Bacteria | 3357 |
| 311 | Ga0466963_0056345 | 3300044694 | Bacteria | 2615 |
| 312 | Ga0466963_0079348 | 3300044694 | Bacteria | 2221 |
| 313 | Ga0466963_0129902 | 3300044694 | Unclassified | 1739 |
| 314 | Ga0466963_0243732 | 3300044694 | Unclassified | 1261 |
| 315 | Ga0466963_0252400 | 3300044694 | Bacteria | 1238 |
| 316 | Ga0466963_0412508 | 3300044694 | Bacteria | 952 |
| 317 | Ga0466963_0457300 | 3300044694 | Bacteria | 901 |
| 318 | Ga0466963_0506307 | 3300044694 | Bacteria | 852 |
| 319 | Ga0466963_0787951 | 3300044694 | Bacteria | 670 |
| 320 | Ga0466963_1007865 | 3300044694 | Bacteria | 586 |
| 321 | Ga0466964_0003456 | 3300044706 | Bacteria | 5764 |
| 322 | Ga0466964_0006319 | 3300044706 | Bacteria | 4411 |
| 323 | Ga0466964_0011005 | 3300044706 | Bacteria | 3417 |
| 324 | Ga0466964_0015458 | 3300044706 | Bacteria | 2905 |
| 325 | Ga0466964_0023759 | 3300044706 | Bacteria | 2384 |
| 326 | Ga0466964_0026335 | 3300044706 | Bacteria | 2276 |
| 327 | Ga0466964_0161493 | 3300044706 | Bacteria | 1048 |
| 328 | Ga0466964_0165578 | 3300044706 | Bacteria | 1037 |
| 329 | Ga0466964_0438633 | 3300044706 | Bacteria | 690 |
| 330 | Ga0466964_0494797 | 3300044706 | Bacteria | 656 |
| 331 | Ga0466971_0002587 | 3300044719 | Bacteria | 7649 |
| 332 | Ga0466971_0004215 | 3300044719 | Bacteria | 6194 |
| 333 | Ga0466971_0013651 | 3300044719 | Bacteria | 3570 |
| 334 | Ga0466971_0049426 | 3300044719 | Bacteria | 1892 |
| 335 | Ga0466971_0091090 | 3300044719 | Bacteria | 1396 |
| 336 | Ga0466971_0114499 | 3300044719 | Bacteria | 1246 |
| 337 | Ga0466971_0459763 | 3300044719 | Unclassified | 625 |
| 338 | Ga0466971_0461309 | 3300044719 | Bacteria | 624 |
| 339 | Ga0466971_0620374 | 3300044719 | Bacteria | 540 |
| 340 | Ga0466968_0002705 | 3300044735 | Bacteria | 6541 |
| 341 | Ga0466968_0003546 | 3300044735 | Bacteria | 5773 |
| 342 | Ga0466968_0011935 | 3300044735 | Bacteria | 3392 |
| 343 | Ga0466968_0027753 | 3300044735 | Bacteria | 2330 |
| 344 | Ga0466968_0081299 | 3300044735 | Bacteria | 1424 |
| 345 | Ga0466968_0331365 | 3300044735 | Bacteria | 737 |
| 346 | Ga0466968_0341425 | 3300044735 | Bacteria | 726 |
| 347 | Ga0466968_0355164 | 3300044735 | Bacteria | 712 |
| 348 | Ga0466970_0026021 | 3300044765 | Bacteria | 3066 |
| 349 | Ga0466970_0086056 | 3300044765 | Bacteria | 1703 |
| 350 | Ga0466970_0502160 | 3300044765 | Bacteria | 698 |
| 351 | Ga0466970_0559742 | 3300044765 | Bacteria | 661 |
| 352 | Ga0466957_0001599 | 3300044842 | Bacteria | 11892 |
| 353 | Ga0466957_0002669 | 3300044842 | Bacteria | 9634 |
| 354 | Ga0466957_0010319 | 3300044842 | Bacteria | 5356 |
| 355 | Ga0466957_0010897 | 3300044842 | Bacteria | 5230 |
| 356 | Ga0466957_0012961 | 3300044842 | Bacteria | 4830 |
| 357 | Ga0466957_0012966 | 3300044842 | Bacteria | 4829 |
| 358 | Ga0466957_0014939 | 3300044842 | Bacteria | 4530 |
| 359 | Ga0466957_0024600 | 3300044842 | Bacteria | 3564 |
| 360 | Ga0466957_0053930 | 3300044842 | Bacteria | 2452 |
| 361 | Ga0466957_0094070 | 3300044842 | Bacteria | 1882 |
| 362 | Ga0466957_0499160 | 3300044842 | Bacteria | 843 |
| 363 | Ga0466957_0499662 | 3300044842 | Bacteria | 843 |
| 364 | Ga0466960_0020062 | 3300044901 | Bacteria | 2955 |
| 365 | Ga0466960_0216457 | 3300044901 | Bacteria | 1052 |
| 366 | Ga0466960_0267123 | 3300044901 | Bacteria | 955 |
| 367 | Ga0466960_0413337 | 3300044901 | Bacteria | 779 |
| 368 | Ga0466959_0001570 | 3300045049 | Bacteria | 14073 |
| 369 | Ga0466959_0009471 | 3300045049 | Bacteria | 6930 |
| 370 | Ga0466959_0010896 | 3300045049 | Bacteria | 6518 |
| 371 | Ga0466959_0026344 | 3300045049 | Bacteria | 4309 |
| 372 | Ga0466959_0080504 | 3300045049 | Bacteria | 2348 |
| 373 | Ga0466959_0202113 | 3300045049 | Bacteria | 1383 |
| 374 | Ga0466959_0371608 | 3300045049 | Bacteria | 974 |
| 375 | Ga0466959_0414258 | 3300045049 | Bacteria | 915 |
| 376 | Ga0466959_0440214 | 3300045049 | Bacteria | 884 |
| 377 | Ga0466958_0000746 | 3300045836 | Bacteria | 14259 |
| 378 | Ga0466958_0002299 | 3300045836 | Bacteria | 9531 |
| 379 | Ga0466958_0032097 | 3300045836 | Bacteria | 3122 |
| 380 | Ga0466958_0078055 | 3300045836 | Bacteria | 2034 |
| 381 | Ga0466958_0144162 | 3300045836 | Bacteria | 1500 |
| 382 | Ga0466958_0153784 | 3300045836 | Bacteria | 1451 |
| 383 | Ga0466958_0197253 | 3300045836 | Bacteria | 1280 |
| 384 | Ga0466958_0223841 | 3300045836 | Bacteria | 1200 |
| 385 | Ga0466958_0233326 | 3300045836 | Bacteria | 1175 |
| 386 | Ga0466958_0707043 | 3300045836 | Bacteria | 656 |
| 387 | Ga0466958_1008981 | 3300045836 | Bacteria | 543 |
| 388 | Ga0466967_0003030 | 3300045976 | Bacteria | 10780 |
| 389 | Ga0466967_0004223 | 3300045976 | Bacteria | 9637 |
| 390 | Ga0466967_0025778 | 3300045976 | Bacteria | 4853 |
| 391 | Ga0466967_0030338 | 3300045976 | Bacteria | 4536 |
| 392 | Ga0466967_0044334 | 3300045976 | Bacteria | 3857 |
| 393 | Ga0466967_0080101 | 3300045976 | Bacteria | 2946 |
| 394 | Ga0466967_0120153 | 3300045976 | Bacteria | 2426 |
| 395 | Ga0466967_0129164 | 3300045976 | Bacteria | 2344 |
| 396 | Ga0466967_0137635 | 3300045976 | Bacteria | 2272 |
| 397 | Ga0466967_0158017 | 3300045976 | Bacteria | 2126 |
| 398 | Ga0466967_0174847 | 3300045976 | Bacteria | 2022 |
| 399 | Ga0466967_0244552 | 3300045976 | Bacteria | 1712 |
| 400 | Ga0466967_0277583 | 3300045976 | Bacteria | 1607 |
| 401 | Ga0466967_0378792 | 3300045976 | Bacteria | 1373 |
| 402 | Ga0466967_0412325 | 3300045976 | Bacteria | 1315 |
| 403 | Ga0466967_0494661 | 3300045976 | Bacteria | 1199 |
| 404 | Ga0466967_0509888 | 3300045976 | Bacteria | 1181 |
| 405 | Ga0466967_0575219 | 3300045976 | Bacteria | 1110 |
| 406 | Ga0466967_0996248 | 3300045976 | Bacteria | 834 |
| 407 | Ga0466967_1578884 | 3300045976 | Bacteria | 653 |
| 408 | Ga0466967_1796419 | 3300045976 | Bacteria | 610 |
| 409 | Ga0466967_1902874 | 3300045976 | Bacteria | 592 |
| 410 | Ga0495592_0001046 | 3300046454 | Bacteria | 19192 |
| 411 | Ga0495592_0008205 | 3300046454 | Bacteria | 7842 |
| 412 | Ga0495592_0174674 | 3300046454 | Bacteria | 1468 |
| 413 | Ga0495603_0010214 | 3300046455 | Bacteria | 5682 |
| 414 | Ga0495603_0179595 | 3300046455 | Bacteria | 1225 |
| 415 | Ga0495603_0386708 | 3300046455 | Bacteria | 802 |
| 416 | Ga0495629_0068732 | 3300046459 | Bacteria | 2472 |
| 417 | Ga0495629_0150951 | 3300046459 | Bacteria | 1615 |
| 418 | Ga0495629_0300714 | 3300046459 | Bacteria | 1099 |
| 419 | Ga0495641_0009576 | 3300046461 | Bacteria | 5742 |
| 420 | Ga0495641_0024307 | 3300046461 | Bacteria | 2993 |
| 421 | Ga0495651_0000004 | 3300046462 | Bacteria | 177080 |
| 422 | Ga0495651_0807427 | 3300046462 | Unclassified | 578 |
| 423 | Ga0495653_0001654 | 3300046463 | Bacteria | 17517 |
| 424 | Ga0495653_0054325 | 3300046463 | Bacteria | 3061 |
| 425 | Ga0495653_0267316 | 3300046463 | Bacteria | 1128 |
| 426 | Ga0495653_0392243 | 3300046463 | Bacteria | 884 |
| 427 | Ga0495580_1043394 | 3300046472 | Bacteria | 519 |
| 428 | Ga0495582_0077852 | 3300046473 | Bacteria | 1839 |
| 429 | Ga0495582_0308016 | 3300046473 | Bacteria | 911 |
| 430 | Ga0495582_0834374 | 3300046473 | Unclassified | 533 |
| 431 | Ga0495582_0866677 | 3300046473 | Bacteria | 522 |
| 432 | Ga0495605_0111191 | 3300046474 | Bacteria | 1250 |
| 433 | Ga0495662_0054037 | 3300046476 | Bacteria | 1940 |
| 434 | Ga0495664_0756680 | 3300046477 | Unclassified | 572 |
| 435 | Ga0495584_0301474 | 3300046491 | Bacteria | 814 |
| 436 | Ga0495585_0215797 | 3300046492 | Bacteria | 970 |
| 437 | Ga0495594_0210073 | 3300046499 | Bacteria | 1110 |
| 438 | Ga0495594_0224935 | 3300046499 | Bacteria | 1070 |
| 439 | Ga0495596_0053855 | 3300046500 | Bacteria | 1574 |
| 440 | Ga0495607_0451472 | 3300046501 | Bacteria | 577 |
| 441 | Ga0495608_0000706 | 3300046511 | Bacteria | 23235 |
| 442 | Ga0495608_0010721 | 3300046511 | Bacteria | 6394 |
| 443 | Ga0495608_0048719 | 3300046511 | Bacteria | 2814 |
| 444 | Ga0495608_0293412 | 3300046511 | Bacteria | 1008 |
| 445 | Ga0495608_0343773 | 3300046511 | Bacteria | 919 |
| 446 | Ga0495608_0397773 | 3300046511 | Bacteria | 843 |
| 447 | Ga0495618_0004348 | 3300046514 | Bacteria | 8714 |
| 448 | Ga0495618_0053834 | 3300046514 | Bacteria | 2545 |
| 449 | Ga0495618_0664319 | 3300046514 | Bacteria | 615 |
| 450 | Ga0495628_0002866 | 3300046516 | Bacteria | 15457 |
| 451 | Ga0495628_0051574 | 3300046516 | Bacteria | 3252 |
| 452 | Ga0495628_0484667 | 3300046516 | Bacteria | 894 |
| 453 | Ga0495630_0021049 | 3300046517 | Bacteria | 4815 |
| 454 | Ga0495630_0071822 | 3300046517 | Bacteria | 2605 |
| 455 | Ga0495630_0399654 | 3300046517 | Bacteria | 1053 |
| 456 | Ga0495630_0669412 | 3300046517 | Bacteria | 794 |
| 457 | Ga0495631_0364444 | 3300046518 | Bacteria | 615 |
| 458 | Ga0495644_0015647 | 3300046523 | Bacteria | 2908 |
| 459 | Ga0495663_0028389 | 3300046525 | Bacteria | 1647 |
| 460 | Ga0495652_0000047 | 3300046529 | Bacteria | 121525 |
| 461 | Ga0495652_0019141 | 3300046529 | Bacteria | 6099 |
| 462 | Ga0495652_0069035 | 3300046529 | Bacteria | 2959 |
| 463 | Ga0495652_0598786 | 3300046529 | Bacteria | 752 |
| 464 | Ga0495665_0184635 | 3300046531 | Bacteria | 1083 |
| 465 | Ga0495640_0009269 | 3300046533 | Bacteria | 7673 |
| 466 | Ga0495640_0194966 | 3300046533 | Bacteria | 1286 |
| 467 | Ga0495640_0777708 | 3300046533 | Bacteria | 571 |
| 468 | Ga0495586_0059721 | 3300046535 | Bacteria | 2072 |
| 469 | Ga0495586_0394825 | 3300046535 | Bacteria | 796 |
| 470 | Ga0495587_0000103 | 3300046536 | Bacteria | 64471 |
| 471 | Ga0495587_0131102 | 3300046536 | Bacteria | 1433 |
| 472 | Ga0495587_0164621 | 3300046536 | Bacteria | 1261 |
| 473 | Ga0495587_0430071 | 3300046536 | Bacteria | 732 |
| 474 | Ga0495598_0102528 | 3300046537 | Bacteria | 949 |
| 475 | Ga0495645_0000028 | 3300046543 | Bacteria | 113461 |
| 476 | Ga0495645_0205109 | 3300046543 | Bacteria | 1334 |
| 477 | Ga0495645_0243258 | 3300046543 | Bacteria | 1199 |
| 478 | Ga0495622_0280640 | 3300046557 | Bacteria | 728 |
| 479 | Ga0495667_0076410 | 3300046559 | Bacteria | 2179 |
| 480 | Ga0495667_0080928 | 3300046559 | Bacteria | 2111 |
| 481 | Ga0495667_0295261 | 3300046559 | Bacteria | 1027 |
| 482 | Ga0495667_0506610 | 3300046559 | Bacteria | 756 |
| 483 | Ga0495656_0035756 | 3300046615 | Bacteria | 2042 |
| 484 | Ga0495668_0640092 | 3300046616 | Bacteria | 588 |
| 485 | Ga0495634_0049770 | 3300046642 | Bacteria | 2816 |
| 486 | Ga0495634_0278764 | 3300046642 | Bacteria | 1016 |
| 487 | Ga0495634_0395681 | 3300046642 | Bacteria | 821 |
| 488 | Ga0495611_0015105 | 3300046648 | Bacteria | 3300 |
| 489 | Ga0495635_0135638 | 3300046663 | Bacteria | 1678 |
| 490 | Ga0495635_0158119 | 3300046663 | Bacteria | 1542 |
| 491 | Ga0495659_0081627 | 3300046664 | Bacteria | 1228 |
| 492 | Ga0495661_0324640 | 3300046665 | Bacteria | 764 |
| 493 | Ga0495588_0417906 | 3300046674 | Bacteria | 704 |
| 494 | Ga0495588_0484839 | 3300046674 | Bacteria | 648 |
| 495 | Ga0495657_0005251 | 3300046675 | Bacteria | 10253 |
| 496 | Ga0495657_0065585 | 3300046675 | Bacteria | 2387 |
| 497 | Ga0495657_0330079 | 3300046675 | Bacteria | 905 |
| 498 | Ga0495657_0591451 | 3300046675 | Bacteria | 642 |
| 499 | Ga0495657_0713058 | 3300046675 | Bacteria | 576 |
| 500 | Ga0495599_0000073 | 3300046678 | Bacteria | 70685 |
| 501 | Ga0495599_0004413 | 3300046678 | Bacteria | 8322 |
| 502 | Ga0495599_0249147 | 3300046678 | Bacteria | 1081 |
| 503 | Ga0495623_0000105 | 3300046679 | Bacteria | 51809 |
| 504 | Ga0495623_0027100 | 3300046679 | Bacteria | 3686 |
| 505 | Ga0495646_0001581 | 3300046680 | Bacteria | 13581 |
| 506 | Ga0495646_0031795 | 3300046680 | Bacteria | 3287 |
| 507 | Ga0495646_0092281 | 3300046680 | Bacteria | 1747 |
| 508 | Ga0495647_0544368 | 3300046681 | Bacteria | 542 |
| 509 | Ga0495658_0151018 | 3300046683 | Bacteria | 1427 |
| 510 | Ga0495658_0284828 | 3300046683 | Bacteria | 1043 |
| 511 | Ga0495613_0008298 | 3300046689 | Bacteria | 7711 |
| 512 | Ga0495624_0008700 | 3300046690 | Bacteria | 7069 |
| 513 | Ga0495624_0112544 | 3300046690 | Bacteria | 1673 |
| 514 | Ga0495624_0265932 | 3300046690 | Bacteria | 1036 |
| 515 | Ga0495624_0587559 | 3300046690 | Bacteria | 664 |
| 516 | Ga0495670_0246020 | 3300046691 | Bacteria | 953 |
| 517 | Ga0495671_0237542 | 3300046692 | Bacteria | 881 |
| 518 | Ga0495589_0354256 | 3300046794 | Bacteria | 676 |
| 519 | Ga0495600_0013086 | 3300046809 | Bacteria | 5206 |
| 520 | Ga0495600_0075320 | 3300046809 | Bacteria | 2204 |
| 521 | Ga0495600_0920550 | 3300046809 | Bacteria | 515 |
| 522 | Ga0495581_0036218 | 3300047315 | Bacteria | 2855 |
| 523 | Ga0495604_0000027 | 3300047317 | Bacteria | 143025 |
| 524 | Ga0495604_0095420 | 3300047317 | Bacteria | 2197 |
| 525 | Ga0495604_0123131 | 3300047317 | Bacteria | 1874 |
| 526 | Ga0495604_0291368 | 3300047317 | Bacteria | 1099 |
| 527 | Ga0495636_0126327 | 3300047318 | Bacteria | 1135 |
| 528 | Ga0495674_0015274 | 3300047319 | Bacteria | 7184 |
| 529 | Ga0495674_0143541 | 3300047319 | Bacteria | 2005 |
| 530 | Ga0495674_1075144 | 3300047319 | Unclassified | 613 |
| 531 | Ga0495674_1444405 | 3300047319 | Bacteria | 511 |
| 532 | Ga0495676_0163727 | 3300047321 | Bacteria | 1571 |
| 533 | Ga0495676_0344945 | 3300047321 | Bacteria | 996 |
| 534 | Ga0495676_0465074 | 3300047321 | Bacteria | 833 |
| 535 | Ga0495676_0574067 | 3300047321 | Bacteria | 736 |
| 536 | Ga0495680_0003487 | 3300047322 | Bacteria | 15443 |
| 537 | Ga0495680_0011938 | 3300047322 | Bacteria | 7665 |
| 538 | Ga0495680_0064102 | 3300047322 | Bacteria | 2819 |
| 539 | Ga0495680_0078811 | 3300047322 | Bacteria | 2492 |
| 540 | Ga0495680_1067043 | 3300047322 | Bacteria | 512 |
| 541 | Ga0495675_0000273 | 3300047444 | Bacteria | 37403 |
| 542 | Ga0495675_0291671 | 3300047444 | Bacteria | 971 |
| 543 | Ga0495677_0242928 | 3300047445 | Bacteria | 703 |
| 544 | Ga0495684_0003752 | 3300047471 | Bacteria | 11850 |
| 545 | Ga0495684_0233848 | 3300047471 | Bacteria | 1343 |
| 546 | Ga0495684_0648824 | 3300047471 | Bacteria | 706 |
| 547 | Ga0495593_0351799 | 3300047673 | Bacteria | 736 |
| 548 | Ga0495602_0000096 | 3300048088 | Bacteria | 82587 |
| 549 | Ga0495602_0131998 | 3300048088 | Bacteria | 1990 |
| 550 | Ga0495602_0162455 | 3300048088 | Bacteria | 1742 |
| 551 | Ga0495602_0642461 | 3300048088 | Bacteria | 725 |
| 552 | Ga0495614_0624501 | 3300048089 | Bacteria | 518 |
| 553 | Ga0495614_0657285 | 3300048089 | Bacteria | 506 |
| 554 | Ga0496100_0054122 | 3300048903 | Bacteria | 2616 |
| 555 | Ga0496100_0094681 | 3300048903 | Bacteria | 2046 |
| 556 | Ga0496100_0143429 | 3300048903 | Bacteria | 1695 |
| 557 | Ga0496100_0550877 | 3300048903 | Bacteria | 892 |
| 558 | Ga0496101_0016305 | 3300048904 | Bacteria | 5015 |
| 559 | Ga0496101_0029371 | 3300048904 | Bacteria | 3845 |
| 560 | Ga0496101_0092700 | 3300048904 | Bacteria | 2249 |
| 561 | Ga0496101_0749753 | 3300048904 | Bacteria | 770 |
| 562 | Ga0496102_0063837 | 3300048905 | Bacteria | 3372 |
| 563 | Ga0496102_0174231 | 3300048905 | Bacteria | 2025 |
| 564 | Ga0496102_1060036 | 3300048905 | Bacteria | 731 |
| 565 | Ga0496102_1627251 | 3300048905 | Bacteria | 564 |
| 566 | Ga0496103_0017305 | 3300048906 | Bacteria | 4313 |
| 567 | Ga0496103_0402863 | 3300048906 | Bacteria | 879 |
| 568 | Ga0496104_0002863 | 3300048907 | Bacteria | 14870 |
| 569 | Ga0496104_0036455 | 3300048907 | Bacteria | 4598 |
| 570 | Ga0496104_0091308 | 3300048907 | Bacteria | 2911 |
| 571 | Ga0496104_0203134 | 3300048907 | Bacteria | 1893 |
| 572 | Ga0496104_1406887 | 3300048907 | Unclassified | 600 |
| 573 | Ga0496104_1533731 | 3300048907 | Bacteria | 569 |
| 574 | Ga0496105_0001941 | 3300048908 | Bacteria | 14854 |
| 575 | Ga0496105_0015342 | 3300048908 | Bacteria | 6103 |
| 576 | Ga0496105_0262049 | 3300048908 | Bacteria | 1398 |
| 577 | Ga0496105_0301676 | 3300048908 | Bacteria | 1287 |
| 578 | Ga0496105_0818995 | 3300048908 | Bacteria | 707 |
| 579 | Ga0496105_0995478 | 3300048908 | Bacteria | 627 |
| 580 | Ga0496106_0186804 | 3300048909 | Bacteria | 1646 |
| 581 | Ga0496106_1573951 | 3300048909 | Bacteria | 504 |
| 582 | Ga0496107_0002689 | 3300048910 | Bacteria | 11655 |
| 583 | Ga0496107_0065732 | 3300048910 | Bacteria | 2630 |
| 584 | Ga0496107_0292599 | 3300048910 | Bacteria | 1212 |
| 585 | Ga0496107_1230725 | 3300048910 | Bacteria | 537 |
| 586 | Ga0496108_0004672 | 3300048911 | Bacteria | 11040 |
| 587 | Ga0496108_0042821 | 3300048911 | Bacteria | 3780 |
| 588 | Ga0496108_0065521 | 3300048911 | Bacteria | 3062 |
| 589 | Ga0496108_0131396 | 3300048911 | Bacteria | 2152 |
| 590 | Ga0496109_0017047 | 3300048912 | Bacteria | 6357 |
| 591 | Ga0496109_0036221 | 3300048912 | Bacteria | 4453 |
| 592 | Ga0496109_0122543 | 3300048912 | Bacteria | 2422 |
| 593 | Ga0496109_1133115 | 3300048912 | Unclassified | 719 |
| 594 | Ga0496110_0009448 | 3300048913 | Bacteria | 7897 |
| 595 | Ga0496110_0044600 | 3300048913 | Bacteria | 3872 |
| 596 | Ga0496110_0059592 | 3300048913 | Bacteria | 3366 |
| 597 | Ga0496110_1606303 | 3300048913 | Bacteria | 560 |
| 598 | Ga0496111_0004132 | 3300048914 | Bacteria | 9121 |
| 599 | Ga0496111_0040544 | 3300048914 | Bacteria | 3340 |
| 600 | Ga0496111_0790677 | 3300048914 | Bacteria | 687 |
| 601 | Ga0496111_0934227 | 3300048914 | Bacteria | 624 |
| 602 | Ga0496111_1003157 | 3300048914 | Bacteria | 598 |
| 603 | Ga0496112_0135579 | 3300048915 | Bacteria | 2432 |
| 604 | Ga0496112_0565632 | 3300048915 | Bacteria | 1070 |
| 605 | Ga0496112_1074049 | 3300048915 | Bacteria | 723 |
| 606 | Ga0496112_1455494 | 3300048915 | Bacteria | 599 |
| 607 | Ga0496113_0030212 | 3300048916 | Bacteria | 3920 |
| 608 | Ga0496113_0200751 | 3300048916 | Bacteria | 1585 |
| 609 | Ga0496113_0882782 | 3300048916 | Unclassified | 708 |
| 610 | Ga0496113_1451758 | 3300048916 | Unclassified | 530 |
| 611 | Ga0496114_0013996 | 3300048917 | Bacteria | 6431 |
| 612 | Ga0496114_0021553 | 3300048917 | Bacteria | 5242 |
| 613 | Ga0496114_0074808 | 3300048917 | Bacteria | 2852 |
| 614 | Ga0496114_0668535 | 3300048917 | Bacteria | 912 |
| 615 | Ga0496115_0039348 | 3300048918 | Bacteria | 3755 |
| 616 | Ga0496115_0043642 | 3300048918 | Bacteria | 3576 |
| 617 | Ga0496115_0108648 | 3300048918 | Bacteria | 2277 |
| 618 | Ga0496115_0170763 | 3300048918 | Bacteria | 1798 |
| 619 | Ga0496115_0248274 | 3300048918 | Bacteria | 1466 |
| 620 | Ga0496115_0771047 | 3300048918 | Bacteria | 750 |
| 621 | Ga0496115_0923961 | 3300048918 | Unclassified | 671 |
| 622 | Ga0501031_0065770 | 3300049568 | Bacteria | 2362 |
| 623 | Ga0501031_0965455 | 3300049568 | Unclassified | 545 |
| 624 | Ga0501034_0063157 | 3300049571 | Bacteria | 3717 |
| 625 | Ga0501036_0224417 | 3300049572 | Bacteria | 1577 |
| 626 | Ga0501037_0231786 | 3300049573 | Bacteria | 1296 |
| 627 | Ga0501038_0200369 | 3300049574 | Bacteria | 1602 |
| 628 | Ga0501039_0459801 | 3300049575 | Bacteria | 999 |
| 629 | Ga0501040_0057669 | 3300049576 | Bacteria | 2666 |
| 630 | Ga0501046_0067678 | 3300049580 | Bacteria | 2781 |
| 631 | Ga0501046_0587576 | 3300049580 | Bacteria | 791 |
| 632 | Ga0501047_0249352 | 3300049581 | Bacteria | 1624 |
| 633 | Ga0501048_0160003 | 3300049582 | Bacteria | 1593 |
| 634 | Ga0501067_0017348 | 3300049583 | Bacteria | 3979 |
| 635 | Ga0501067_0058244 | 3300049583 | Bacteria | 2140 |
| 636 | Ga0501067_0352416 | 3300049583 | Bacteria | 820 |
| 637 | Ga0501068_0574480 | 3300049584 | Unclassified | 734 |
| 638 | Ga0501069_0132452 | 3300049585 | Bacteria | 1428 |
| 639 | Ga0501070_0001820 | 3300049586 | Bacteria | 18782 |
| 640 | Ga0501070_0077782 | 3300049586 | Bacteria | 2745 |
| 641 | Ga0501071_1332088 | 3300049587 | Bacteria | 554 |
| 642 | Ga0501072_0040841 | 3300049588 | Bacteria | 3643 |
| 643 | Ga0501072_0748954 | 3300049588 | Bacteria | 766 |
| 644 | Ga0501072_1370217 | 3300049588 | Bacteria | 547 |
| 645 | Ga0501073_0018504 | 3300049589 | Bacteria | 5036 |
| 646 | Ga0501073_0324231 | 3300049589 | Bacteria | 1063 |
| 647 | Ga0501073_0419322 | 3300049589 | Bacteria | 925 |
| 648 | Ga0501074_0007159 | 3300049590 | Bacteria | 8056 |
| 649 | Ga0501074_0116750 | 3300049590 | Bacteria | 1909 |
| 650 | Ga0501075_0152661 | 3300049591 | Bacteria | 1760 |
| 651 | Ga0501076_0686042 | 3300049592 | Bacteria | 845 |
| 652 | Ga0501077_0075569 | 3300049593 | Bacteria | 2133 |
| 653 | Ga0501079_0055171 | 3300049741 | Bacteria | 3066 |
| 654 | Ga0501079_0372051 | 3300049741 | Bacteria | 1120 |
| 655 | Ga0501079_0530475 | 3300049741 | Bacteria | 925 |
| 656 | Ga0501080_0000309 | 3300049742 | Bacteria | 37361 |
| 657 | Ga0501080_0238942 | 3300049742 | Bacteria | 1658 |
| 658 | Ga0501080_0437500 | 3300049742 | Bacteria | 1173 |
| 659 | Ga0501080_1327098 | 3300049742 | Unclassified | 615 |
| 660 | Ga0501081_0043310 | 3300049743 | Bacteria | 3087 |
| 661 | Ga0501081_1461432 | 3300049743 | Bacteria | 519 |
| 662 | Ga0501083_0000241 | 3300049744 | Bacteria | 35214 |
| 663 | Ga0501083_0357205 | 3300049744 | Bacteria | 950 |
| 664 | Ga0501035_0286156 | 3300049822 | Bacteria | 1392 |
| 665 | Ga0501044_0291569 | 3300049823 | Bacteria | 1563 |
| 666 | Ga0501045_0046836 | 3300049824 | Bacteria | 3148 |
| 667 | nmdc:mga0n895_1228613_c1 | 3300050512 | Bacteria | 722 |
| 668 | nmdc:mga0n895_28075_c1 | 3300050512 | Bacteria | 5351 |
| 669 | nmdc:mga0rr50_91259_c1 | 3300050513 | Bacteria | 2372 |
| 670 | nmdc:mga0a205_1540006_c1 | 3300050515 | Bacteria | 513 |
| 671 | nmdc:mga0a205_169928_c1 | 3300050515 | Bacteria | 2076 |
| 672 | Ga0495601_0005767 | 3300053077 | Bacteria | 7224 |
| 673 | Ga0495601_0028771 | 3300053077 | Bacteria | 3443 |
| 674 | Ga0495601_0106044 | 3300053077 | Bacteria | 1817 |
| 675 | Ga0495601_0838338 | 3300053077 | Unclassified | 582 |
| 676 | Ga0495601_0921353 | 3300053077 | Unclassified | 551 |
| 677 | Ga0495612_0024814 | 3300053078 | Bacteria | 2407 |
| 678 | Ga0495612_0030133 | 3300053078 | Bacteria | 2186 |
| 679 | Ga0495612_0465482 | 3300053078 | Bacteria | 578 |
| 680 | Ga0495595_0002579 | 3300053084 | Bacteria | 7107 |
| 681 | Ga0495595_0006279 | 3300053084 | Bacteria | 4839 |
| 682 | Ga0495595_0032742 | 3300053084 | Bacteria | 2342 |
| 683 | Ga0495595_0185732 | 3300053084 | Bacteria | 1032 |
| 684 | Ga0495619_0017049 | 3300053085 | Bacteria | 4604 |
| 685 | Ga0495619_0028638 | 3300053085 | Bacteria | 3594 |
| 686 | Ga0495619_0245685 | 3300053085 | Bacteria | 1240 |
| 687 | Ga0495619_0319839 | 3300053085 | Bacteria | 1074 |
| 688 | Ga0495619_0694672 | 3300053085 | Bacteria | 692 |
| 689 | Ga0501084_0922246 | 3300054114 | Bacteria | 734 |
| 690 | Ga0501084_1402295 | 3300054114 | Unclassified | 585 |
| 691 | Ga0501082_0066999 | 3300060353 | Bacteria | 3091 |
| 692 | Ga0466962_0002364 | 3300061719 | Bacteria | 8937 |
| 693 | Ga0466962_0002404 | 3300061719 | Bacteria | 8878 |
| 694 | Ga0466962_0003493 | 3300061719 | Bacteria | 7490 |
| 695 | Ga0466962_0006158 | 3300061719 | Bacteria | 5765 |
| 696 | Ga0466962_0008841 | 3300061719 | Bacteria | 4827 |
| 697 | Ga0466962_0065297 | 3300061719 | Bacteria | 1738 |
| 698 | Ga0466962_0596925 | 3300061719 | Bacteria | 563 |
| 699 | Ga0466962_0628993 | 3300061719 | Bacteria | 548 |
| 700 | Ga0530510_0035647 | 3300061734 | Bacteria | 3585 |
| 701 | Ga0395900_0591104 | |||
| 702 | Ga0070710_11157663 | |||
| 703 | Ga0070664_100764184 | |||
| 704 | Ga0068857_100537848 | |||
| 705 | Ga0068857_102348706 | |||
| 706 | Ga0068856_100065074 | |||
| 707 | Ga0068856_100112187 | |||
| 708 | Ga0068863_100445810 | |||
| 709 | Ga0068860_102150714 | |||
| 710 | Ga0070717_10058314 | |||
| 711 | Ga0070717_10107197 | |||
| 712 | Ga0070717_10111880 | |||
| 713 | Ga0070717_10293750 | |||
| 714 | Ga0070717_10363685 | |||
| 715 | Ga0070717_10784415 | |||
| 716 | Ga0070715_10000948 | |||
| 717 | Ga0070715_10497960 | |||
| 718 | Ga0070715_11098406 | |||
| 719 | Ga0070716_100003355 | |||
| 720 | Ga0070716_100463523 | |||
| 721 | Ga0070716_100805149 | |||
| 722 | Ga0070716_101430677 | |||
| 723 | Ga0070712_100054038 | |||
| 724 | Ga0070712_100114735 | |||
| 725 | Ga0070712_100232096 | |||
| 726 | Ga0070712_100297695 | |||
| 727 | Ga0070712_100639888 | |||
| 728 | Ga0097621_100708829 | |||
| 729 | Ga0097621_100709100 | |||
| 730 | Ga0068871_100935773 | |||
| 731 | Ga0075433_10144857 | |||
| 732 | Ga0075433_11785915 | |||
| 733 | Ga0075434_100037607 | |||
| 734 | Ga0075434_101510775 | |||
| 735 | Ga0075434_102472552 | |||
| 736 | Ga0075436_100383248 | |||
| 737 | Ga0075436_100613548 | |||
| 738 | Ga0099794_10371337 | |||
| 739 | Ga0105240_11273755 | |||
| 740 | Ga0105245_10594946 | |||
| 741 | Ga0105245_10611017 | |||
| 742 | Ga0105245_10717380 | |||
| 743 | Ga0105242_11656206 | |||
| 744 | Ga0105248_10162033 | |||
| 745 | Ga0105238_10290448 | |||
| 746 | Ga0099796_10124412 | |||
| 747 | Ga0105239_10427718 | |||
| 748 | Ga0105239_13082614 | |||
| 749 | Ga0105246_10859752 | |||
| 750 | Ga0157373_10989757 | |||
| 751 | Ga0157371_11526391 | |||
| 752 | Ga0157370_10786736 | |||
| 753 | Ga0157370_10922208 | |||
| 754 | Ga0157370_11031751 | |||
| 755 | Ga0157369_10036406 | |||
| 756 | Ga0157369_10384260 | |||
| 757 | Ga0157369_10405568 | |||
| 758 | Ga0157369_10571362 | |||
| 759 | Ga0157369_10733626 | |||
| 760 | Ga0157369_10929375 | |||
| 761 | Ga0157369_11125977 | |||
| 762 | Ga0157374_10043054 | |||
| 763 | Ga0157374_10062924 | |||
| 764 | Ga0157374_10739468 | |||
| 765 | Ga0157374_12979035 | |||
| 766 | Ga0163162_11289799 | |||
| 767 | Ga0157372_10070515 | |||
| 768 | Ga0157372_10225721 | |||
| 769 | Ga0157372_10452791 | |||
| 770 | Ga0157372_12264480 | |||
| 771 | Ga0157375_10202136 | |||
| 772 | Ga0163163_11728264 | |||
| 773 | Ga0182008_10487483 | |||
| 774 | Ga0157379_10059231 | |||
| 775 | Ga0157376_10049834 | |||
| 776 | Ga0206356_10044910 | |||
| 777 | Ga0206354_11148611 | |||
| 778 | Ga0206353_10090081 | |||
| 779 | Ga0206353_11737025 | |||
| 780 | Ga0213876_10760253 | |||
| 781 | Ga0207692_10011074 | |||
| 782 | Ga0207692_10040028 | |||
| 783 | Ga0207692_10637311 | |||
| 784 | Ga0207692_11058531 | |||
| 785 | Ga0207685_10002067 | |||
| 786 | Ga0207685_10462154 | |||
| 787 | Ga0207699_10006523 | |||
| 788 | Ga0207699_10147315 | |||
| 789 | Ga0207699_11164078 | |||
| 790 | Ga0207705_10080573 | |||
| 791 | Ga0207705_10268550 | |||
| 792 | Ga0207684_10500306 | |||
| 793 | Ga0207707_10107723 | |||
| 794 | Ga0207707_10738238 | |||
| 795 | Ga0207707_10874882 | |||
| 796 | Ga0207693_10000745 | |||
| 797 | Ga0207693_10007103 | |||
| 798 | Ga0207693_10408870 | |||
| 799 | Ga0207693_10451931 | |||
| 800 | Ga0207693_10792254 | |||
| 801 | Ga0207663_10022898 | |||
| 802 | Ga0207663_10077887 | |||
| 803 | Ga0207663_10705648 | |||
| 804 | Ga0207663_11507861 | |||
| 805 | Ga0207663_11642654 | |||
| 806 | Ga0207660_10241427 | |||
| 807 | Ga0207660_10480221 | |||
| 808 | Ga0207660_10751692 | |||
| 809 | Ga0207657_10007302 | |||
| 810 | Ga0207657_10049531 | |||
| 811 | Ga0207657_10070725 | |||
| 812 | Ga0207649_10147839 | |||
| 813 | Ga0207649_10717597 | |||
| 814 | Ga0207649_11186658 | |||
| 815 | Ga0207652_10251379 | |||
| 816 | Ga0207652_10478669 | |||
| 817 | Ga0207652_10598223 | |||
| 818 | Ga0207646_10000785 | |||
| 819 | Ga0207646_10260192 | |||
| 820 | Ga0207687_10107096 | |||
| 821 | Ga0207687_10708384 | |||
| 822 | Ga0207700_10002676 | |||
| 823 | Ga0207700_10109462 | |||
| 824 | Ga0207700_10196100 | |||
| 825 | Ga0207700_10564345 | |||
| 826 | Ga0207700_11241096 | |||
| 827 | Ga0207700_11934159 | |||
| 828 | Ga0207664_10021059 | |||
| 829 | Ga0207664_10084127 | |||
| 830 | Ga0207664_10106892 | |||
| 831 | Ga0207664_10143967 | |||
| 832 | Ga0207664_10145301 | |||
| 833 | Ga0207664_10158498 | |||
| 834 | Ga0207664_10180584 | |||
| 835 | Ga0207664_10313299 | |||
| 836 | Ga0207664_10415570 | |||
| 837 | Ga0207664_10461744 | |||
| 838 | Ga0207664_10639747 | |||
| 839 | Ga0207664_10815597 | |||
| 840 | Ga0207664_11210029 | |||
| 841 | Ga0207664_11613461 | |||
| 842 | Ga0207664_11888093 | |||
| 843 | Ga0207664_12006823 | |||
| 844 | Ga0207644_10385282 | |||
| 845 | Ga0207690_10656146 | |||
| 846 | Ga0207690_10799905 | |||
| 847 | Ga0207686_10724047 | |||
| 848 | Ga0207665_10001126 | |||
| 849 | Ga0207665_10109893 | |||
| 850 | Ga0207665_11266956 | |||
| 851 | Ga0207711_10243885 | |||
| 852 | Ga0207661_10654748 | |||
| 853 | Ga0207661_10998481 | |||
| 854 | Ga0207661_11352880 | |||
| 855 | Ga0207661_11952865 | |||
| 856 | Ga0207679_10315203 | |||
| 857 | Ga0207679_10429779 | |||
| 858 | Ga0207667_10205505 | |||
| 859 | Ga0207667_11526324 | |||
| 860 | Ga0207639_10525801 | |||
| 861 | Ga0207639_11151184 | |||
| 862 | Ga0207639_11196606 | |||
| 863 | Ga0207678_10287560 | |||
| 864 | Ga0207702_10068409 | |||
| 865 | Ga0207702_10098038 | |||
| 866 | Ga0207702_10542929 | |||
| 867 | Ga0207698_11482965 | |||
| 868 | Ga0207698_11808155 | |||
| 869 | Ga0207428_10287891 | |||
| 870 | Ga0268264_12319667 | |||
| 871 | Ga0265326_10007165 | |||
| 872 | Ga0265326_10025248 | |||
| 873 | Ga0265319_1016183 | |||
| 874 | Ga0265319_1052069 | |||
| 875 | Ga0265319_1286504 | |||
| 876 | Ga0265334_10002601 | |||
| 877 | Ga0265334_10157498 | |||
| 878 | Ga0265318_10000633 | |||
| 879 | Ga0265318_10026077 | |||
| 880 | Ga0265318_10061572 | |||
| 881 | Ga0265318_10095995 | |||
| 882 | Ga0265318_10211203 | |||
| 883 | Ga0265323_10201493 | |||
| 884 | Ga0265322_10015772 | |||
| 885 | Ga0265322_10082578 | |||
| 886 | Ga0265322_10247027 | |||
| 887 | Ga0265338_10017133 | |||
| 888 | Ga0265338_10018943 | |||
| 889 | Ga0265338_10019624 | |||
| 890 | Ga0265338_10401884 | |||
| 891 | Ga0265338_10580100 | |||
| 892 | Ga0265330_10002779 | |||
| 893 | Ga0265330_10302312 | |||
| 894 | Ga0265332_10006125 | |||
| 895 | Ga0265332_10394495 | |||
| 896 | Ga0265328_10008252 | |||
| 897 | Ga0265320_10017649 | |||
| 898 | Ga0265320_10034456 | |||
| 899 | Ga0265320_10162881 | |||
| 900 | Ga0265320_10181968 | |||
| 901 | Ga0265325_10008761 | |||
| 902 | Ga0265325_10046388 | |||
| 903 | Ga0265325_10129283 | |||
| 904 | Ga0265329_10001093 | |||
| 905 | Ga0265329_10194887 | |||
| 906 | Ga0265340_10003071 | |||
| 907 | Ga0265340_10062773 | |||
| 908 | Ga0265340_10149598 | |||
| 909 | Ga0265339_10010742 | |||
| 910 | Ga0265339_10084167 | |||
| 911 | Ga0265339_10378755 | |||
| 912 | Ga0265331_10039278 | |||
| 913 | Ga0265327_10054714 | |||
| 914 | Ga0265327_10153798 | |||
| 915 | Ga0265316_10013122 | |||
| 916 | Ga0265316_10014571 | |||
| 917 | Ga0265316_10160270 | |||
| 918 | Ga0265313_10010591 | |||
| 919 | Ga0265313_10013762 | |||
| 920 | Ga0265313_10082263 | |||
| 921 | Ga0265314_10012611 | |||
| 922 | Ga0265314_10022648 | |||
| 923 | Ga0265314_10028551 | |||
| 924 | Ga0265342_10015434 | |||
| 925 | Ga0265342_10102346 | |||
| 926 | Ga0265342_10280908 | |||
| 927 | Ga0373948_0056106 | |||
| 928 | Ga0373934_0512907 | |||
| 929 | Ga0373940_0067924 | |||
| 930 | Ga0373952_0050654 | |||
| 931 | Ga0373939_0388982 | |||
| 932 | Ga0373941_0062192 | |||
| 933 | Ga0373953_0257906 | |||
| 934 | Ga0373953_0384074 | |||
| 935 | Ga0373954_0533084 | |||
| 936 | Ga0373956_0130267 | |||
| 937 | Ga0373957_0307810 | |||
| 938 | Ga0373960_0300862 | |||
| 939 | Ga0373943_0919162 | |||
| 940 | Ga0373946_0230190 | |||
| 941 | Ga0373962_0058709 | |||
| 942 | Ga0373924_0093813 | |||
| 943 | Ga0373931_0014101 | |||
| 944 | Ga0373935_0037735 | |||
| 945 | Ga0373935_1504351 | |||
| 946 | Ga0373933_0195799 | |||
| 947 | Ga0373947_0929308 | |||
| 948 | Ga0373937_0002033 | |||
| 949 | Ga0373937_0186662 | |||
| 950 | Ga0373937_0719603 | |||
| 951 | Ga0373925_1182254 | |||
| 952 | Ga0395899_0047446 | |||
| 953 | Ga0395899_0057892 | |||
| 954 | Ga0395899_0067585 | |||
| 955 | Ga0395900_0030345 | |||
| 956 | Ga0395900_0035416 | |||
| 957 | Ga0395900_0098878 | |||
| 958 | Ga0395900_0428741 | |||
| 959 | Ga0395900_1709206 | |||
| 960 | Ga0395898_0020962 | |||
| 961 | Ga0395898_0084361 | |||
| 962 | Ga0395898_0383815 | |||
| 963 | Ga0395898_0444001 | |||
| 964 | Ga0395898_0623328 | |||
| 965 | Ga0395898_0631911 | |||
| 966 | Ga0395898_0938157 | |||
| 967 | Ga0395898_1123903 | |||
| 968 | Ga0395905_0089531 | |||
| 969 | Ga0395905_0114155 | |||
| 970 | Ga0395905_0916723 | |||
| 971 | Ga0395905_1558262 | |||
| 972 | Ga0395901_0009177 | |||
| 973 | Ga0395901_0017820 | |||
| 974 | Ga0395901_0273352 | |||
| 975 | Ga0395901_0438043 | |||
| 976 | Ga0395901_0526323 | |||
| 977 | Ga0395901_1009372 | |||
| 978 | Ga0395901_1567046 | |||
| 979 | Ga0395901_1981058 | |||
| 980 | Ga0436365_1727373 | |||
| 981 | Ga0436360_1250321 | |||
| 982 | Ga0436363_1652782 | |||
| 983 | Ga0466969_0001344 | |||
| 984 | Ga0466969_0061412 | |||
| 985 | Ga0466969_0288416 | |||
| 986 | Ga0466965_0050060 | |||
| 987 | Ga0466965_0058393 | |||
| 988 | Ga0466965_0091325 | |||
| 989 | Ga0466965_0213444 | |||
| 990 | Ga0466965_0419956 | |||
| 991 | Ga0466965_0574034 | |||
| 992 | Ga0466966_0002635 | |||
| 993 | Ga0466966_0021639 | |||
| 994 | Ga0466966_0145615 | |||
| 995 | Ga0466966_0841067 | |||
| 996 | Ga0466961_0001489 | |||
| 997 | Ga0466961_0003353 | |||
| 998 | Ga0466961_0004912 | |||
| 999 | Ga0466961_0022211 | |||
| 1000 | Ga0466961_0443854 | |||
| 1001 | Ga0466963_0000049 | |||
| 1002 | Ga0466963_0006191 | |||
| 1003 | Ga0466963_0006435 | |||
| 1004 | Ga0466963_0006856 | |||
| 1005 | Ga0466963_0007471 | |||
| 1006 | Ga0466963_0011460 | |||
| 1007 | Ga0466963_0013668 | |||
| 1008 | Ga0466963_0014157 | |||
| 1009 | Ga0466963_0026461 | |||
| 1010 | Ga0466963_0032990 | |||
| 1011 | Ga0466963_0056345 | |||
| 1012 | Ga0466963_0079348 | |||
| 1013 | Ga0466963_0129902 | |||
| 1014 | Ga0466963_0243732 | |||
| 1015 | Ga0466963_0252400 | |||
| 1016 | Ga0466963_0412508 | |||
| 1017 | Ga0466963_0457300 | |||
| 1018 | Ga0466963_0506307 | |||
| 1019 | Ga0466963_0787951 | |||
| 1020 | Ga0466963_1007865 | |||
| 1021 | Ga0466964_0003456 | |||
| 1022 | Ga0466964_0006319 | |||
| 1023 | Ga0466964_0011005 | |||
| 1024 | Ga0466964_0015458 | |||
| 1025 | Ga0466964_0023759 | |||
| 1026 | Ga0466964_0026335 | |||
| 1027 | Ga0466964_0161493 | |||
| 1028 | Ga0466964_0165578 | |||
| 1029 | Ga0466964_0438633 | |||
| 1030 | Ga0466964_0494797 | |||
| 1031 | Ga0466971_0002587 | |||
| 1032 | Ga0466971_0004215 | |||
| 1033 | Ga0466971_0013651 | |||
| 1034 | Ga0466971_0049426 | |||
| 1035 | Ga0466971_0091090 | |||
| 1036 | Ga0466971_0114499 | |||
| 1037 | Ga0466971_0459763 | |||
| 1038 | Ga0466971_0461309 | |||
| 1039 | Ga0466971_0620374 | |||
| 1040 | Ga0466968_0002705 | |||
| 1041 | Ga0466968_0003546 | |||
| 1042 | Ga0466968_0011935 | |||
| 1043 | Ga0466968_0027753 | |||
| 1044 | Ga0466968_0081299 | |||
| 1045 | Ga0466968_0331365 | |||
| 1046 | Ga0466968_0341425 | |||
| 1047 | Ga0466968_0355164 | |||
| 1048 | Ga0466970_0026021 | |||
| 1049 | Ga0466970_0086056 | |||
| 1050 | Ga0466970_0502160 | |||
| 1051 | Ga0466970_0559742 | |||
| 1052 | Ga0466957_0001599 | |||
| 1053 | Ga0466957_0002669 | |||
| 1054 | Ga0466957_0010319 | |||
| 1055 | Ga0466957_0010897 | |||
| 1056 | Ga0466957_0012961 | |||
| 1057 | Ga0466957_0012966 | |||
| 1058 | Ga0466957_0014939 | |||
| 1059 | Ga0466957_0024600 | |||
| 1060 | Ga0466957_0053930 | |||
| 1061 | Ga0466957_0094070 | |||
| 1062 | Ga0466957_0499160 | |||
| 1063 | Ga0466957_0499662 | |||
| 1064 | Ga0466960_0020062 | |||
| 1065 | Ga0466960_0216457 | |||
| 1066 | Ga0466960_0267123 | |||
| 1067 | Ga0466960_0413337 | |||
| 1068 | Ga0466959_0001570 | |||
| 1069 | Ga0466959_0009471 | |||
| 1070 | Ga0466959_0010896 | |||
| 1071 | Ga0466959_0026344 | |||
| 1072 | Ga0466959_0080504 | |||
| 1073 | Ga0466959_0202113 | |||
| 1074 | Ga0466959_0371608 | |||
| 1075 | Ga0466959_0414258 | |||
| 1076 | Ga0466959_0440214 | |||
| 1077 | Ga0466958_0000746 | |||
| 1078 | Ga0466958_0002299 | |||
| 1079 | Ga0466958_0032097 | |||
| 1080 | Ga0466958_0078055 | |||
| 1081 | Ga0466958_0144162 | |||
| 1082 | Ga0466958_0153784 | |||
| 1083 | Ga0466958_0197253 | |||
| 1084 | Ga0466958_0223841 | |||
| 1085 | Ga0466958_0233326 | |||
| 1086 | Ga0466958_0707043 | |||
| 1087 | Ga0466958_1008981 | |||
| 1088 | Ga0466967_0003030 | |||
| 1089 | Ga0466967_0004223 | |||
| 1090 | Ga0466967_0025778 | |||
| 1091 | Ga0466967_0030338 | |||
| 1092 | Ga0466967_0044334 | |||
| 1093 | Ga0466967_0080101 | |||
| 1094 | Ga0466967_0120153 | |||
| 1095 | Ga0466967_0129164 | |||
| 1096 | Ga0466967_0137635 | |||
| 1097 | Ga0466967_0158017 | |||
| 1098 | Ga0466967_0174847 | |||
| 1099 | Ga0466967_0244552 | |||
| 1100 | Ga0466967_0277583 | |||
| 1101 | Ga0466967_0378792 | |||
| 1102 | Ga0466967_0412325 | |||
| 1103 | Ga0466967_0494661 | |||
| 1104 | Ga0466967_0509888 | |||
| 1105 | Ga0466967_0575219 | |||
| 1106 | Ga0466967_0996248 | |||
| 1107 | Ga0466967_1578884 | |||
| 1108 | Ga0466967_1796419 | |||
| 1109 | Ga0466967_1902874 | |||
| 1110 | Ga0495592_0001046 | |||
| 1111 | Ga0495592_0008205 | |||
| 1112 | Ga0495592_0174674 | |||
| 1113 | Ga0495603_0010214 | |||
| 1114 | Ga0495603_0179595 | |||
| 1115 | Ga0495603_0386708 | |||
| 1116 | Ga0495629_0068732 | |||
| 1117 | Ga0495629_0150951 | |||
| 1118 | Ga0495629_0300714 | |||
| 1119 | Ga0495641_0009576 | |||
| 1120 | Ga0495641_0024307 | |||
| 1121 | Ga0495651_0000004 | |||
| 1122 | Ga0495651_0807427 | |||
| 1123 | Ga0495653_0001654 | |||
| 1124 | Ga0495653_0054325 | |||
| 1125 | Ga0495653_0267316 | |||
| 1126 | Ga0495653_0392243 | |||
| 1127 | Ga0495580_1043394 | |||
| 1128 | Ga0495582_0077852 | |||
| 1129 | Ga0495582_0308016 | |||
| 1130 | Ga0495582_0834374 | |||
| 1131 | Ga0495582_0866677 | |||
| 1132 | Ga0495605_0111191 | |||
| 1133 | Ga0495662_0054037 | |||
| 1134 | Ga0495664_0756680 | |||
| 1135 | Ga0495584_0301474 | |||
| 1136 | Ga0495585_0215797 | |||
| 1137 | Ga0495594_0210073 | |||
| 1138 | Ga0495594_0224935 | |||
| 1139 | Ga0495596_0053855 | |||
| 1140 | Ga0495607_0451472 | |||
| 1141 | Ga0495608_0000706 | |||
| 1142 | Ga0495608_0010721 | |||
| 1143 | Ga0495608_0048719 | |||
| 1144 | Ga0495608_0293412 | |||
| 1145 | Ga0495608_0343773 | |||
| 1146 | Ga0495608_0397773 | |||
| 1147 | Ga0495618_0004348 | |||
| 1148 | Ga0495618_0053834 | |||
| 1149 | Ga0495618_0664319 | |||
| 1150 | Ga0495628_0002866 | |||
| 1151 | Ga0495628_0051574 | |||
| 1152 | Ga0495628_0484667 | |||
| 1153 | Ga0495630_0021049 | |||
| 1154 | Ga0495630_0071822 | |||
| 1155 | Ga0495630_0399654 | |||
| 1156 | Ga0495630_0669412 | |||
| 1157 | Ga0495631_0364444 | |||
| 1158 | Ga0495644_0015647 | |||
| 1159 | Ga0495663_0028389 | |||
| 1160 | Ga0495652_0000047 | |||
| 1161 | Ga0495652_0019141 | |||
| 1162 | Ga0495652_0069035 | |||
| 1163 | Ga0495652_0598786 | |||
| 1164 | Ga0495665_0184635 | |||
| 1165 | Ga0495640_0009269 | |||
| 1166 | Ga0495640_0194966 | |||
| 1167 | Ga0495640_0777708 | |||
| 1168 | Ga0495586_0059721 | |||
| 1169 | Ga0495586_0394825 | |||
| 1170 | Ga0495587_0000103 | |||
| 1171 | Ga0495587_0131102 | |||
| 1172 | Ga0495587_0164621 | |||
| 1173 | Ga0495587_0430071 | |||
| 1174 | Ga0495598_0102528 | |||
| 1175 | Ga0495645_0000028 | |||
| 1176 | Ga0495645_0205109 | |||
| 1177 | Ga0495645_0243258 | |||
| 1178 | Ga0495622_0280640 | |||
| 1179 | Ga0495667_0076410 | |||
| 1180 | Ga0495667_0080928 | |||
| 1181 | Ga0495667_0295261 | |||
| 1182 | Ga0495667_0506610 | |||
| 1183 | Ga0495656_0035756 | |||
| 1184 | Ga0495668_0640092 | |||
| 1185 | Ga0495634_0049770 | |||
| 1186 | Ga0495634_0278764 | |||
| 1187 | Ga0495634_0395681 | |||
| 1188 | Ga0495611_0015105 | |||
| 1189 | Ga0495635_0135638 | |||
| 1190 | Ga0495635_0158119 | |||
| 1191 | Ga0495659_0081627 | |||
| 1192 | Ga0495661_0324640 | |||
| 1193 | Ga0495588_0417906 | |||
| 1194 | Ga0495588_0484839 | |||
| 1195 | Ga0495657_0005251 | |||
| 1196 | Ga0495657_0065585 | |||
| 1197 | Ga0495657_0330079 | |||
| 1198 | Ga0495657_0591451 | |||
| 1199 | Ga0495657_0713058 | |||
| 1200 | Ga0495599_0000073 | |||
| 1201 | Ga0495599_0004413 | |||
| 1202 | Ga0495599_0249147 | |||
| 1203 | Ga0495623_0000105 | |||
| 1204 | Ga0495623_0027100 | |||
| 1205 | Ga0495646_0001581 | |||
| 1206 | Ga0495646_0031795 | |||
| 1207 | Ga0495646_0092281 | |||
| 1208 | Ga0495647_0544368 | |||
| 1209 | Ga0495658_0151018 | |||
| 1210 | Ga0495658_0284828 | |||
| 1211 | Ga0495613_0008298 | |||
| 1212 | Ga0495624_0008700 | |||
| 1213 | Ga0495624_0112544 | |||
| 1214 | Ga0495624_0265932 | |||
| 1215 | Ga0495624_0587559 | |||
| 1216 | Ga0495670_0246020 | |||
| 1217 | Ga0495671_0237542 | |||
| 1218 | Ga0495589_0354256 | |||
| 1219 | Ga0495600_0013086 | |||
| 1220 | Ga0495600_0075320 | |||
| 1221 | Ga0495600_0920550 | |||
| 1222 | Ga0495581_0036218 | |||
| 1223 | Ga0495604_0000027 | |||
| 1224 | Ga0495604_0095420 | |||
| 1225 | Ga0495604_0123131 | |||
| 1226 | Ga0495604_0291368 | |||
| 1227 | Ga0495636_0126327 | |||
| 1228 | Ga0495674_0015274 | |||
| 1229 | Ga0495674_0143541 | |||
| 1230 | Ga0495674_1075144 | |||
| 1231 | Ga0495674_1444405 | |||
| 1232 | Ga0495676_0163727 | |||
| 1233 | Ga0495676_0344945 | |||
| 1234 | Ga0495676_0465074 | |||
| 1235 | Ga0495676_0574067 | |||
| 1236 | Ga0495680_0003487 | |||
| 1237 | Ga0495680_0011938 | |||
| 1238 | Ga0495680_0064102 | |||
| 1239 | Ga0495680_0078811 | |||
| 1240 | Ga0495680_1067043 | |||
| 1241 | Ga0495675_0000273 | |||
| 1242 | Ga0495675_0291671 | |||
| 1243 | Ga0495677_0242928 | |||
| 1244 | Ga0495684_0003752 | |||
| 1245 | Ga0495684_0233848 | |||
| 1246 | Ga0495684_0648824 | |||
| 1247 | Ga0495593_0351799 | |||
| 1248 | Ga0495602_0000096 | |||
| 1249 | Ga0495602_0131998 | |||
| 1250 | Ga0495602_0162455 | |||
| 1251 | Ga0495602_0642461 | |||
| 1252 | Ga0495614_0624501 | |||
| 1253 | Ga0495614_0657285 | |||
| 1254 | Ga0496100_0054122 | |||
| 1255 | Ga0496100_0094681 | |||
| 1256 | Ga0496100_0143429 | |||
| 1257 | Ga0496100_0550877 | |||
| 1258 | Ga0496101_0016305 | |||
| 1259 | Ga0496101_0029371 | |||
| 1260 | Ga0496101_0092700 | |||
| 1261 | Ga0496101_0749753 | |||
| 1262 | Ga0496102_0063837 | |||
| 1263 | Ga0496102_0174231 | |||
| 1264 | Ga0496102_1060036 | |||
| 1265 | Ga0496102_1627251 | |||
| 1266 | Ga0496103_0017305 | |||
| 1267 | Ga0496103_0402863 | |||
| 1268 | Ga0496104_0002863 | |||
| 1269 | Ga0496104_0036455 | |||
| 1270 | Ga0496104_0091308 | |||
| 1271 | Ga0496104_0203134 | |||
| 1272 | Ga0496104_1406887 | |||
| 1273 | Ga0496104_1533731 | |||
| 1274 | Ga0496105_0001941 | |||
| 1275 | Ga0496105_0015342 | |||
| 1276 | Ga0496105_0262049 | |||
| 1277 | Ga0496105_0301676 | |||
| 1278 | Ga0496105_0818995 | |||
| 1279 | Ga0496105_0995478 | |||
| 1280 | Ga0496106_0186804 | |||
| 1281 | Ga0496106_1573951 | |||
| 1282 | Ga0496107_0002689 | |||
| 1283 | Ga0496107_0065732 | |||
| 1284 | Ga0496107_0292599 | |||
| 1285 | Ga0496107_1230725 | |||
| 1286 | Ga0496108_0004672 | |||
| 1287 | Ga0496108_0042821 | |||
| 1288 | Ga0496108_0065521 | |||
| 1289 | Ga0496108_0131396 | |||
| 1290 | Ga0496109_0017047 | |||
| 1291 | Ga0496109_0036221 | |||
| 1292 | Ga0496109_0122543 | |||
| 1293 | Ga0496109_1133115 | |||
| 1294 | Ga0496110_0009448 | |||
| 1295 | Ga0496110_0044600 | |||
| 1296 | Ga0496110_0059592 | |||
| 1297 | Ga0496110_1606303 | |||
| 1298 | Ga0496111_0004132 | |||
| 1299 | Ga0496111_0040544 | |||
| 1300 | Ga0496111_0790677 | |||
| 1301 | Ga0496111_0934227 | |||
| 1302 | Ga0496111_1003157 | |||
| 1303 | Ga0496112_0135579 | |||
| 1304 | Ga0496112_0565632 | |||
| 1305 | Ga0496112_1074049 | |||
| 1306 | Ga0496112_1455494 | |||
| 1307 | Ga0496113_0030212 | |||
| 1308 | Ga0496113_0200751 | |||
| 1309 | Ga0496113_0882782 | |||
| 1310 | Ga0496113_1451758 | |||
| 1311 | Ga0496114_0013996 | |||
| 1312 | Ga0496114_0021553 | |||
| 1313 | Ga0496114_0074808 | |||
| 1314 | Ga0496114_0668535 | |||
| 1315 | Ga0496115_0039348 | |||
| 1316 | Ga0496115_0043642 | |||
| 1317 | Ga0496115_0108648 | |||
| 1318 | Ga0496115_0170763 | |||
| 1319 | Ga0496115_0248274 | |||
| 1320 | Ga0496115_0771047 | |||
| 1321 | Ga0496115_0923961 | |||
| 1322 | Ga0501031_0065770 | |||
| 1323 | Ga0501031_0965455 | |||
| 1324 | Ga0501034_0063157 | |||
| 1325 | Ga0501036_0224417 | |||
| 1326 | Ga0501037_0231786 | |||
| 1327 | Ga0501038_0200369 | |||
| 1328 | Ga0501039_0459801 | |||
| 1329 | Ga0501040_0057669 | |||
| 1330 | Ga0501046_0067678 | |||
| 1331 | Ga0501046_0587576 | |||
| 1332 | Ga0501047_0249352 | |||
| 1333 | Ga0501048_0160003 | |||
| 1334 | Ga0501067_0017348 | |||
| 1335 | Ga0501067_0058244 | |||
| 1336 | Ga0501067_0352416 | |||
| 1337 | Ga0501068_0574480 | |||
| 1338 | Ga0501069_0132452 | |||
| 1339 | Ga0501070_0001820 | |||
| 1340 | Ga0501070_0077782 | |||
| 1341 | Ga0501071_1332088 | |||
| 1342 | Ga0501072_0040841 | |||
| 1343 | Ga0501072_0748954 | |||
| 1344 | Ga0501072_1370217 | |||
| 1345 | Ga0501073_0018504 | |||
| 1346 | Ga0501073_0324231 | |||
| 1347 | Ga0501073_0419322 | |||
| 1348 | Ga0501074_0007159 | |||
| 1349 | Ga0501074_0116750 | |||
| 1350 | Ga0501075_0152661 | |||
| 1351 | Ga0501076_0686042 | |||
| 1352 | Ga0501077_0075569 | |||
| 1353 | Ga0501079_0055171 | |||
| 1354 | Ga0501079_0372051 | |||
| 1355 | Ga0501079_0530475 | |||
| 1356 | Ga0501080_0000309 | |||
| 1357 | Ga0501080_0238942 | |||
| 1358 | Ga0501080_0437500 | |||
| 1359 | Ga0501080_1327098 | |||
| 1360 | Ga0501081_0043310 | |||
| 1361 | Ga0501081_1461432 | |||
| 1362 | Ga0501083_0000241 | |||
| 1363 | Ga0501083_0357205 | |||
| 1364 | Ga0501035_0286156 | |||
| 1365 | Ga0501044_0291569 | |||
| 1366 | Ga0501045_0046836 | |||
| 1367 | nmdc:mga0n895_1228613_c1 | |||
| 1368 | nmdc:mga0n895_28075_c1 | |||
| 1369 | nmdc:mga0rr50_91259_c1 | |||
| 1370 | nmdc:mga0a205_1540006_c1 | |||
| 1371 | nmdc:mga0a205_169928_c1 | |||
| 1372 | Ga0495601_0005767 | |||
| 1373 | Ga0495601_0028771 | |||
| 1374 | Ga0495601_0106044 | |||
| 1375 | Ga0495601_0838338 | |||
| 1376 | Ga0495601_0921353 | |||
| 1377 | Ga0495612_0024814 | |||
| 1378 | Ga0495612_0030133 | |||
| 1379 | Ga0495612_0465482 | |||
| 1380 | Ga0495595_0002579 | |||
| 1381 | Ga0495595_0006279 | |||
| 1382 | Ga0495595_0032742 | |||
| 1383 | Ga0495595_0185732 | |||
| 1384 | Ga0495619_0017049 | |||
| 1385 | Ga0495619_0028638 | |||
| 1386 | Ga0495619_0245685 | |||
| 1387 | Ga0495619_0319839 | |||
| 1388 | Ga0495619_0694672 | |||
| 1389 | Ga0501084_0922246 | |||
| 1390 | Ga0501084_1402295 | |||
| 1391 | Ga0501082_0066999 | |||
| 1392 | Ga0466962_0002364 | |||
| 1393 | Ga0466962_0002404 | |||
| 1394 | Ga0466962_0003493 | |||
| 1395 | Ga0466962_0006158 | |||
| 1396 | Ga0466962_0008841 | |||
| 1397 | Ga0466962_0065297 | |||
| 1398 | Ga0466962_0596925 | |||
| 1399 | Ga0466962_0628993 | |||
| 1400 | Ga0530510_0035647 |