F476106

General Info

Members Datasets Scaffolds Average Seq Length
700 253 1400 38

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0591104|Ga0395900_0591104_836_964
Length 42
Sequence MAPFTDPELARKNVRLGWLLFGIFLLLFAGTFGVAFLYLAFD

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
3 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
4 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
10 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.71
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0591104 3300037418 Bacteria 1051
2 Ga0070710_11157663 3300005437 Bacteria 570
3 Ga0070664_100764184 3300005564 Bacteria 902
4 Ga0068857_100537848 3300005577 Bacteria 1100
5 Ga0068857_102348706 3300005577 Bacteria 524
6 Ga0068856_100065074 3300005614 Bacteria 3602
7 Ga0068856_100112187 3300005614 Bacteria 2724
8 Ga0068863_100445810 3300005841 Bacteria 1270
9 Ga0068860_102150714 3300005843 Unclassified 579
10 Ga0070717_10058314 3300006028 Bacteria 3192
11 Ga0070717_10107197 3300006028 Bacteria 2379
12 Ga0070717_10111880 3300006028 Bacteria 2330
13 Ga0070717_10293750 3300006028 Bacteria 1443
14 Ga0070717_10363685 3300006028 Bacteria 1295
15 Ga0070717_10784415 3300006028 Bacteria 867
16 Ga0070715_10000948 3300006163 Bacteria 8098
17 Ga0070715_10497960 3300006163 Bacteria 697
18 Ga0070715_11098406 3300006163 Bacteria 501
19 Ga0070716_100003355 3300006173 Bacteria 7529
20 Ga0070716_100463523 3300006173 Bacteria 927
21 Ga0070716_100805149 3300006173 Bacteria 728
22 Ga0070716_101430677 3300006173 Bacteria 563
23 Ga0070712_100054038 3300006175 Bacteria 2806
24 Ga0070712_100114735 3300006175 Bacteria 2017
25 Ga0070712_100232096 3300006175 Bacteria 1466
26 Ga0070712_100297695 3300006175 Bacteria 1305
27 Ga0070712_100639888 3300006175 Bacteria 903
28 Ga0097621_100708829 3300006237 Bacteria 927
29 Ga0097621_100709100 3300006237 Bacteria 927
30 Ga0068871_100935773 3300006358 Unclassified 804
31 Ga0075433_10144857 3300006852 Bacteria 2112
32 Ga0075433_11785915 3300006852 Unclassified 529
33 Ga0075434_100037607 3300006871 Bacteria 4792
34 Ga0075434_101510775 3300006871 Bacteria 681
35 Ga0075434_102472552 3300006871 Bacteria 521
36 Ga0075436_100383248 3300006914 Bacteria 1017
37 Ga0075436_100613548 3300006914 Bacteria 802
38 Ga0099794_10371337 3300007265 Bacteria 745
39 Ga0105240_11273755 3300009093 Unclassified 776
40 Ga0105245_10594946 3300009098 Bacteria 1132
41 Ga0105245_10611017 3300009098 Bacteria 1118
42 Ga0105245_10717380 3300009098 Unclassified 1034
43 Ga0105242_11656206 3300009176 Bacteria 675
44 Ga0105248_10162033 3300009177 Bacteria 2522
45 Ga0105238_10290448 3300009551 Bacteria 1617
46 Ga0099796_10124412 3300010159 Bacteria 994
47 Ga0105239_10427718 3300010375 Bacteria 1501
48 Ga0105239_13082614 3300010375 Bacteria 543
49 Ga0105246_10859752 3300011119 Bacteria 810
50 Ga0157373_10989757 3300013100 Unclassified 627
51 Ga0157371_11526391 3300013102 Bacteria 521
52 Ga0157370_10786736 3300013104 Bacteria 866
53 Ga0157370_10922208 3300013104 Bacteria 792
54 Ga0157370_11031751 3300013104 Bacteria 744
55 Ga0157369_10036406 3300013105 Bacteria 5392
56 Ga0157369_10384260 3300013105 Bacteria 1457
57 Ga0157369_10405568 3300013105 Bacteria 1414
58 Ga0157369_10571362 3300013105 Bacteria 1168
59 Ga0157369_10733626 3300013105 Bacteria 1017
60 Ga0157369_10929375 3300013105 Bacteria 892
61 Ga0157369_11125977 3300013105 Bacteria 802
62 Ga0157374_10043054 3300013296 Bacteria 4169
63 Ga0157374_10062924 3300013296 Bacteria 3479
64 Ga0157374_10739468 3300013296 Bacteria 998
65 Ga0157374_12979035 3300013296 Unclassified 500
66 Ga0163162_11289799 3300013306 Unclassified 830
67 Ga0157372_10070515 3300013307 Bacteria 3932
68 Ga0157372_10225721 3300013307 Unclassified 2171
69 Ga0157372_10452791 3300013307 Bacteria 1496
70 Ga0157372_12264480 3300013307 Unclassified 624
71 Ga0157375_10202136 3300013308 Bacteria 2143
72 Ga0163163_11728264 3300014325 Bacteria 686
73 Ga0182008_10487483 3300014497 Bacteria 676
74 Ga0157379_10059231 3300014968 Bacteria 3424
75 Ga0157376_10049834 3300014969 Bacteria 3471
76 Ga0206356_10044910 3300020070 Bacteria 1616
77 Ga0206354_11148611 3300020081 Bacteria 844
78 Ga0206353_10090081 3300020082 Bacteria 1722
79 Ga0206353_11737025 3300020082 Bacteria 725
80 Ga0213876_10760253 3300021384 Bacteria 516
81 Ga0207692_10011074 3300025898 Bacteria 3820
82 Ga0207692_10040028 3300025898 Bacteria 2310
83 Ga0207692_10637311 3300025898 Bacteria 688
84 Ga0207692_11058531 3300025898 Bacteria 537
85 Ga0207685_10002067 3300025905 Bacteria 4485
86 Ga0207685_10462154 3300025905 Bacteria 662
87 Ga0207699_10006523 3300025906 Bacteria 5656
88 Ga0207699_10147315 3300025906 Bacteria 1554
89 Ga0207699_11164078 3300025906 Bacteria 571
90 Ga0207705_10080573 3300025909 Bacteria 2372
91 Ga0207705_10268550 3300025909 Bacteria 1304
92 Ga0207684_10500306 3300025910 Bacteria 1042
93 Ga0207707_10107723 3300025912 Bacteria 2436
94 Ga0207707_10738238 3300025912 Bacteria 824
95 Ga0207707_10874882 3300025912 Bacteria 744
96 Ga0207693_10000745 3300025915 Bacteria 29290
97 Ga0207693_10007103 3300025915 Bacteria 9237
98 Ga0207693_10408870 3300025915 Bacteria 1061
99 Ga0207693_10451931 3300025915 Bacteria 1004
100 Ga0207693_10792254 3300025915 Bacteria 731
101 Ga0207663_10022898 3300025916 Bacteria 3576
102 Ga0207663_10077887 3300025916 Bacteria 2159
103 Ga0207663_10705648 3300025916 Bacteria 799
104 Ga0207663_11507861 3300025916 Bacteria 541
105 Ga0207663_11642654 3300025916 Bacteria 517
106 Ga0207660_10241427 3300025917 Bacteria 1423
107 Ga0207660_10480221 3300025917 Bacteria 1007
108 Ga0207660_10751692 3300025917 Bacteria 796
109 Ga0207657_10007302 3300025919 Bacteria 11331
110 Ga0207657_10049531 3300025919 Bacteria 3660
111 Ga0207657_10070725 3300025919 Bacteria 2956
112 Ga0207649_10147839 3300025920 Bacteria 1615
113 Ga0207649_10717597 3300025920 Bacteria 776
114 Ga0207649_11186658 3300025920 Bacteria 603
115 Ga0207652_10251379 3300025921 Bacteria 1594
116 Ga0207652_10478669 3300025921 Bacteria 1121
117 Ga0207652_10598223 3300025921 Bacteria 989
118 Ga0207646_10000785 3300025922 Bacteria 41163
119 Ga0207646_10260192 3300025922 Bacteria 1568
120 Ga0207687_10107096 3300025927 Bacteria 2068
121 Ga0207687_10708384 3300025927 Bacteria 855
122 Ga0207700_10002676 3300025928 Bacteria 10263
123 Ga0207700_10109462 3300025928 Bacteria 2220
124 Ga0207700_10196100 3300025928 Bacteria 1699
125 Ga0207700_10564345 3300025928 Bacteria 1011
126 Ga0207700_11241096 3300025928 Bacteria 665
127 Ga0207700_11934159 3300025928 Bacteria 516
128 Ga0207664_10021059 3300025929 Bacteria 4840
129 Ga0207664_10084127 3300025929 Bacteria 2594
130 Ga0207664_10106892 3300025929 Bacteria 2321
131 Ga0207664_10143967 3300025929 Bacteria 2019
132 Ga0207664_10145301 3300025929 Bacteria 2010
133 Ga0207664_10158498 3300025929 Bacteria 1929
134 Ga0207664_10180584 3300025929 Bacteria 1811
135 Ga0207664_10313299 3300025929 Bacteria 1383
136 Ga0207664_10415570 3300025929 Bacteria 1198
137 Ga0207664_10461744 3300025929 Bacteria 1134
138 Ga0207664_10639747 3300025929 Bacteria 956
139 Ga0207664_10815597 3300025929 Bacteria 839
140 Ga0207664_11210029 3300025929 Bacteria 674
141 Ga0207664_11613461 3300025929 Unclassified 571
142 Ga0207664_11888093 3300025929 Bacteria 520
143 Ga0207664_12006823 3300025929 Bacteria 501
144 Ga0207644_10385282 3300025931 Bacteria 1144
145 Ga0207690_10656146 3300025932 Bacteria 860
146 Ga0207690_10799905 3300025932 Bacteria 779
147 Ga0207686_10724047 3300025934 Bacteria 792
148 Ga0207665_10001126 3300025939 Bacteria 17976
149 Ga0207665_10109893 3300025939 Bacteria 1936
150 Ga0207665_11266956 3300025939 Bacteria 588
151 Ga0207711_10243885 3300025941 Bacteria 1648
152 Ga0207661_10654748 3300025944 Bacteria 965
153 Ga0207661_10998481 3300025944 Unclassified 771
154 Ga0207661_11352880 3300025944 Bacteria 654
155 Ga0207661_11952865 3300025944 Bacteria 533
156 Ga0207679_10315203 3300025945 Bacteria 1353
157 Ga0207679_10429779 3300025945 Bacteria 1167
158 Ga0207667_10205505 3300025949 Bacteria 2019
159 Ga0207667_11526324 3300025949 Bacteria 638
160 Ga0207639_10525801 3300026041 Bacteria 1084
161 Ga0207639_11151184 3300026041 Bacteria 728
162 Ga0207639_11196606 3300026041 Unclassified 713
163 Ga0207678_10287560 3300026067 Bacteria 1412
164 Ga0207702_10068409 3300026078 Bacteria 3051
165 Ga0207702_10098038 3300026078 Bacteria 2581
166 Ga0207702_10542929 3300026078 Bacteria 1136
167 Ga0207698_11482965 3300026142 Bacteria 694
168 Ga0207698_11808155 3300026142 Bacteria 626
169 Ga0207428_10287891 3300027907 Bacteria 1218
170 Ga0268264_12319667 3300028381 Unclassified 543
171 Ga0265326_10007165 3300028558 Bacteria 3428
172 Ga0265326_10025248 3300028558 Bacteria 1695
173 Ga0265319_1016183 3300028563 Bacteria 2864
174 Ga0265319_1052069 3300028563 Bacteria 1348
175 Ga0265319_1286504 3300028563 Unclassified 501
176 Ga0265334_10002601 3300028573 Bacteria 8412
177 Ga0265334_10157498 3300028573 Bacteria 799
178 Ga0265318_10000633 3300028577 Bacteria 24181
179 Ga0265318_10026077 3300028577 Bacteria 2304
180 Ga0265318_10061572 3300028577 Bacteria 1398
181 Ga0265318_10095995 3300028577 Bacteria 1091
182 Ga0265318_10211203 3300028577 Unclassified 709
183 Ga0265323_10201493 3300028653 Bacteria 626
184 Ga0265322_10015772 3300028654 Bacteria 2181
185 Ga0265322_10082578 3300028654 Unclassified 912
186 Ga0265322_10247027 3300028654 Bacteria 512
187 Ga0265338_10017133 3300028800 Bacteria 7830
188 Ga0265338_10018943 3300028800 Bacteria 7336
189 Ga0265338_10019624 3300028800 Bacteria 7158
190 Ga0265338_10401884 3300028800 Bacteria 976
191 Ga0265338_10580100 3300028800 Bacteria 782
192 Ga0265330_10002779 3300031235 Bacteria 9395
193 Ga0265330_10302312 3300031235 Bacteria 674
194 Ga0265332_10006125 3300031238 Bacteria 5490
195 Ga0265332_10394495 3300031238 Bacteria 572
196 Ga0265328_10008252 3300031239 Bacteria 4305
197 Ga0265320_10017649 3300031240 Bacteria 3955
198 Ga0265320_10034456 3300031240 Bacteria 2575
199 Ga0265320_10162881 3300031240 Bacteria 1004
200 Ga0265320_10181968 3300031240 Bacteria 942
201 Ga0265325_10008761 3300031241 Bacteria 5949
202 Ga0265325_10046388 3300031241 Bacteria 2254
203 Ga0265325_10129283 3300031241 Bacteria 1211
204 Ga0265329_10001093 3300031242 Bacteria 13312
205 Ga0265329_10194887 3300031242 Bacteria 665
206 Ga0265340_10003071 3300031247 Bacteria 9478
207 Ga0265340_10062773 3300031247 Bacteria 1774
208 Ga0265340_10149598 3300031247 Bacteria 1065
209 Ga0265339_10010742 3300031249 Bacteria 5670
210 Ga0265339_10084167 3300031249 Bacteria 1676
211 Ga0265339_10378755 3300031249 Bacteria 663
212 Ga0265331_10039278 3300031250 Bacteria 2308
213 Ga0265327_10054714 3300031251 Bacteria 2064
214 Ga0265327_10153798 3300031251 Bacteria 1067
215 Ga0265316_10013122 3300031344 Bacteria 7380
216 Ga0265316_10014571 3300031344 Bacteria 6913
217 Ga0265316_10160270 3300031344 Bacteria 1682
218 Ga0265313_10010591 3300031595 Bacteria 5809
219 Ga0265313_10013762 3300031595 Bacteria 4825
220 Ga0265313_10082263 3300031595 Bacteria 1460
221 Ga0265314_10012611 3300031711 Bacteria 6881
222 Ga0265314_10022648 3300031711 Bacteria 4810
223 Ga0265314_10028551 3300031711 Bacteria 4158
224 Ga0265342_10015434 3300031712 Bacteria 5022
225 Ga0265342_10102346 3300031712 Bacteria 1630
226 Ga0265342_10280908 3300031712 Bacteria 881
227 Ga0373948_0056106 3300034817 Bacteria 856
228 Ga0373934_0512907 3300035086 Bacteria 504
229 Ga0373940_0067924 3300035088 Bacteria 1032
230 Ga0373952_0050654 3300035092 Bacteria 989
231 Ga0373939_0388982 3300035114 Bacteria 575
232 Ga0373941_0062192 3300035115 Bacteria 1218
233 Ga0373953_0257906 3300035117 Bacteria 758
234 Ga0373953_0384074 3300035117 Bacteria 617
235 Ga0373954_0533084 3300035118 Bacteria 582
236 Ga0373956_0130267 3300035119 Bacteria 1177
237 Ga0373957_0307810 3300035120 Bacteria 673
238 Ga0373960_0300862 3300035121 Bacteria 596
239 Ga0373943_0919162 3300035170 Bacteria 523
240 Ga0373946_0230190 3300035171 Bacteria 898
241 Ga0373962_0058709 3300035242 Bacteria 1125
242 Ga0373924_0093813 3300035410 Bacteria 1286
243 Ga0373931_0014101 3300035691 Bacteria 3902
244 Ga0373935_0037735 3300035692 Bacteria 3024
245 Ga0373935_1504351 3300035692 Unclassified 504
246 Ga0373933_0195799 3300035724 Bacteria 1292
247 Ga0373947_0929308 3300035725 Bacteria 594
248 Ga0373937_0002033 3300036401 Bacteria 16891
249 Ga0373937_0186662 3300036401 Bacteria 1948
250 Ga0373937_0719603 3300036401 Bacteria 945
251 Ga0373925_1182254 3300037068 Bacteria 629
252 Ga0395899_0047446 3300037312 Bacteria 3198
253 Ga0395899_0057892 3300037312 Bacteria 2859
254 Ga0395899_0067585 3300037312 Bacteria 2622
255 Ga0395900_0030345 3300037418 Bacteria 5551
256 Ga0395900_0035416 3300037418 Bacteria 5141
257 Ga0395900_0098878 3300037418 Bacteria 2998
258 Ga0395900_0428741 3300037418 Bacteria 1282
259 Ga0395900_1709206 3300037418 Bacteria 540
260 Ga0395898_0020962 3300037466 Bacteria 6631
261 Ga0395898_0084361 3300037466 Bacteria 3062
262 Ga0395898_0383815 3300037466 Bacteria 1340
263 Ga0395898_0444001 3300037466 Bacteria 1236
264 Ga0395898_0623328 3300037466 Bacteria 1021
265 Ga0395898_0631911 3300037466 Bacteria 1013
266 Ga0395898_0938157 3300037466 Bacteria 803
267 Ga0395898_1123903 3300037466 Bacteria 718
268 Ga0395905_0089531 3300037471 Bacteria 2884
269 Ga0395905_0114155 3300037471 Bacteria 2538
270 Ga0395905_0916723 3300037471 Unclassified 779
271 Ga0395905_1558262 3300037471 Bacteria 565
272 Ga0395901_0009177 3300038443 Bacteria 10021
273 Ga0395901_0017820 3300038443 Bacteria 7248
274 Ga0395901_0273352 3300038443 Bacteria 1757
275 Ga0395901_0438043 3300038443 Bacteria 1338
276 Ga0395901_0526323 3300038443 Bacteria 1200
277 Ga0395901_1009372 3300038443 Bacteria 808
278 Ga0395901_1567046 3300038443 Bacteria 613
279 Ga0395901_1981058 3300038443 Bacteria 529
280 Ga0436365_1727373 3300039437 Bacteria 1222
281 Ga0436360_1250321 3300039438 Unclassified 907
282 Ga0436363_1652782 3300039450 Bacteria 732
283 Ga0466969_0001344 3300044656 Bacteria 13262
284 Ga0466969_0061412 3300044656 Bacteria 1825
285 Ga0466969_0288416 3300044656 Bacteria 743
286 Ga0466965_0050060 3300044683 Bacteria 2071
287 Ga0466965_0058393 3300044683 Bacteria 1924
288 Ga0466965_0091325 3300044683 Bacteria 1549
289 Ga0466965_0213444 3300044683 Bacteria 1027
290 Ga0466965_0419956 3300044683 Bacteria 741
291 Ga0466965_0574034 3300044683 Bacteria 639
292 Ga0466966_0002635 3300044684 Bacteria 11745
293 Ga0466966_0021639 3300044684 Bacteria 4222
294 Ga0466966_0145615 3300044684 Bacteria 1446
295 Ga0466966_0841067 3300044684 Bacteria 553
296 Ga0466961_0001489 3300044693 Bacteria 14537
297 Ga0466961_0003353 3300044693 Bacteria 9994
298 Ga0466961_0004912 3300044693 Bacteria 8407
299 Ga0466961_0022211 3300044693 Bacteria 4082
300 Ga0466961_0443854 3300044693 Bacteria 785
301 Ga0466963_0000049 3300044694 Bacteria 39571
302 Ga0466963_0006191 3300044694 Bacteria 7066
303 Ga0466963_0006435 3300044694 Bacteria 6948
304 Ga0466963_0006856 3300044694 Bacteria 6778
305 Ga0466963_0007471 3300044694 Bacteria 6520
306 Ga0466963_0011460 3300044694 Bacteria 5400
307 Ga0466963_0013668 3300044694 Bacteria 4991
308 Ga0466963_0014157 3300044694 Bacteria 4914
309 Ga0466963_0026461 3300044694 Bacteria 3710
310 Ga0466963_0032990 3300044694 Bacteria 3357
311 Ga0466963_0056345 3300044694 Bacteria 2615
312 Ga0466963_0079348 3300044694 Bacteria 2221
313 Ga0466963_0129902 3300044694 Unclassified 1739
314 Ga0466963_0243732 3300044694 Unclassified 1261
315 Ga0466963_0252400 3300044694 Bacteria 1238
316 Ga0466963_0412508 3300044694 Bacteria 952
317 Ga0466963_0457300 3300044694 Bacteria 901
318 Ga0466963_0506307 3300044694 Bacteria 852
319 Ga0466963_0787951 3300044694 Bacteria 670
320 Ga0466963_1007865 3300044694 Bacteria 586
321 Ga0466964_0003456 3300044706 Bacteria 5764
322 Ga0466964_0006319 3300044706 Bacteria 4411
323 Ga0466964_0011005 3300044706 Bacteria 3417
324 Ga0466964_0015458 3300044706 Bacteria 2905
325 Ga0466964_0023759 3300044706 Bacteria 2384
326 Ga0466964_0026335 3300044706 Bacteria 2276
327 Ga0466964_0161493 3300044706 Bacteria 1048
328 Ga0466964_0165578 3300044706 Bacteria 1037
329 Ga0466964_0438633 3300044706 Bacteria 690
330 Ga0466964_0494797 3300044706 Bacteria 656
331 Ga0466971_0002587 3300044719 Bacteria 7649
332 Ga0466971_0004215 3300044719 Bacteria 6194
333 Ga0466971_0013651 3300044719 Bacteria 3570
334 Ga0466971_0049426 3300044719 Bacteria 1892
335 Ga0466971_0091090 3300044719 Bacteria 1396
336 Ga0466971_0114499 3300044719 Bacteria 1246
337 Ga0466971_0459763 3300044719 Unclassified 625
338 Ga0466971_0461309 3300044719 Bacteria 624
339 Ga0466971_0620374 3300044719 Bacteria 540
340 Ga0466968_0002705 3300044735 Bacteria 6541
341 Ga0466968_0003546 3300044735 Bacteria 5773
342 Ga0466968_0011935 3300044735 Bacteria 3392
343 Ga0466968_0027753 3300044735 Bacteria 2330
344 Ga0466968_0081299 3300044735 Bacteria 1424
345 Ga0466968_0331365 3300044735 Bacteria 737
346 Ga0466968_0341425 3300044735 Bacteria 726
347 Ga0466968_0355164 3300044735 Bacteria 712
348 Ga0466970_0026021 3300044765 Bacteria 3066
349 Ga0466970_0086056 3300044765 Bacteria 1703
350 Ga0466970_0502160 3300044765 Bacteria 698
351 Ga0466970_0559742 3300044765 Bacteria 661
352 Ga0466957_0001599 3300044842 Bacteria 11892
353 Ga0466957_0002669 3300044842 Bacteria 9634
354 Ga0466957_0010319 3300044842 Bacteria 5356
355 Ga0466957_0010897 3300044842 Bacteria 5230
356 Ga0466957_0012961 3300044842 Bacteria 4830
357 Ga0466957_0012966 3300044842 Bacteria 4829
358 Ga0466957_0014939 3300044842 Bacteria 4530
359 Ga0466957_0024600 3300044842 Bacteria 3564
360 Ga0466957_0053930 3300044842 Bacteria 2452
361 Ga0466957_0094070 3300044842 Bacteria 1882
362 Ga0466957_0499160 3300044842 Bacteria 843
363 Ga0466957_0499662 3300044842 Bacteria 843
364 Ga0466960_0020062 3300044901 Bacteria 2955
365 Ga0466960_0216457 3300044901 Bacteria 1052
366 Ga0466960_0267123 3300044901 Bacteria 955
367 Ga0466960_0413337 3300044901 Bacteria 779
368 Ga0466959_0001570 3300045049 Bacteria 14073
369 Ga0466959_0009471 3300045049 Bacteria 6930
370 Ga0466959_0010896 3300045049 Bacteria 6518
371 Ga0466959_0026344 3300045049 Bacteria 4309
372 Ga0466959_0080504 3300045049 Bacteria 2348
373 Ga0466959_0202113 3300045049 Bacteria 1383
374 Ga0466959_0371608 3300045049 Bacteria 974
375 Ga0466959_0414258 3300045049 Bacteria 915
376 Ga0466959_0440214 3300045049 Bacteria 884
377 Ga0466958_0000746 3300045836 Bacteria 14259
378 Ga0466958_0002299 3300045836 Bacteria 9531
379 Ga0466958_0032097 3300045836 Bacteria 3122
380 Ga0466958_0078055 3300045836 Bacteria 2034
381 Ga0466958_0144162 3300045836 Bacteria 1500
382 Ga0466958_0153784 3300045836 Bacteria 1451
383 Ga0466958_0197253 3300045836 Bacteria 1280
384 Ga0466958_0223841 3300045836 Bacteria 1200
385 Ga0466958_0233326 3300045836 Bacteria 1175
386 Ga0466958_0707043 3300045836 Bacteria 656
387 Ga0466958_1008981 3300045836 Bacteria 543
388 Ga0466967_0003030 3300045976 Bacteria 10780
389 Ga0466967_0004223 3300045976 Bacteria 9637
390 Ga0466967_0025778 3300045976 Bacteria 4853
391 Ga0466967_0030338 3300045976 Bacteria 4536
392 Ga0466967_0044334 3300045976 Bacteria 3857
393 Ga0466967_0080101 3300045976 Bacteria 2946
394 Ga0466967_0120153 3300045976 Bacteria 2426
395 Ga0466967_0129164 3300045976 Bacteria 2344
396 Ga0466967_0137635 3300045976 Bacteria 2272
397 Ga0466967_0158017 3300045976 Bacteria 2126
398 Ga0466967_0174847 3300045976 Bacteria 2022
399 Ga0466967_0244552 3300045976 Bacteria 1712
400 Ga0466967_0277583 3300045976 Bacteria 1607
401 Ga0466967_0378792 3300045976 Bacteria 1373
402 Ga0466967_0412325 3300045976 Bacteria 1315
403 Ga0466967_0494661 3300045976 Bacteria 1199
404 Ga0466967_0509888 3300045976 Bacteria 1181
405 Ga0466967_0575219 3300045976 Bacteria 1110
406 Ga0466967_0996248 3300045976 Bacteria 834
407 Ga0466967_1578884 3300045976 Bacteria 653
408 Ga0466967_1796419 3300045976 Bacteria 610
409 Ga0466967_1902874 3300045976 Bacteria 592
410 Ga0495592_0001046 3300046454 Bacteria 19192
411 Ga0495592_0008205 3300046454 Bacteria 7842
412 Ga0495592_0174674 3300046454 Bacteria 1468
413 Ga0495603_0010214 3300046455 Bacteria 5682
414 Ga0495603_0179595 3300046455 Bacteria 1225
415 Ga0495603_0386708 3300046455 Bacteria 802
416 Ga0495629_0068732 3300046459 Bacteria 2472
417 Ga0495629_0150951 3300046459 Bacteria 1615
418 Ga0495629_0300714 3300046459 Bacteria 1099
419 Ga0495641_0009576 3300046461 Bacteria 5742
420 Ga0495641_0024307 3300046461 Bacteria 2993
421 Ga0495651_0000004 3300046462 Bacteria 177080
422 Ga0495651_0807427 3300046462 Unclassified 578
423 Ga0495653_0001654 3300046463 Bacteria 17517
424 Ga0495653_0054325 3300046463 Bacteria 3061
425 Ga0495653_0267316 3300046463 Bacteria 1128
426 Ga0495653_0392243 3300046463 Bacteria 884
427 Ga0495580_1043394 3300046472 Bacteria 519
428 Ga0495582_0077852 3300046473 Bacteria 1839
429 Ga0495582_0308016 3300046473 Bacteria 911
430 Ga0495582_0834374 3300046473 Unclassified 533
431 Ga0495582_0866677 3300046473 Bacteria 522
432 Ga0495605_0111191 3300046474 Bacteria 1250
433 Ga0495662_0054037 3300046476 Bacteria 1940
434 Ga0495664_0756680 3300046477 Unclassified 572
435 Ga0495584_0301474 3300046491 Bacteria 814
436 Ga0495585_0215797 3300046492 Bacteria 970
437 Ga0495594_0210073 3300046499 Bacteria 1110
438 Ga0495594_0224935 3300046499 Bacteria 1070
439 Ga0495596_0053855 3300046500 Bacteria 1574
440 Ga0495607_0451472 3300046501 Bacteria 577
441 Ga0495608_0000706 3300046511 Bacteria 23235
442 Ga0495608_0010721 3300046511 Bacteria 6394
443 Ga0495608_0048719 3300046511 Bacteria 2814
444 Ga0495608_0293412 3300046511 Bacteria 1008
445 Ga0495608_0343773 3300046511 Bacteria 919
446 Ga0495608_0397773 3300046511 Bacteria 843
447 Ga0495618_0004348 3300046514 Bacteria 8714
448 Ga0495618_0053834 3300046514 Bacteria 2545
449 Ga0495618_0664319 3300046514 Bacteria 615
450 Ga0495628_0002866 3300046516 Bacteria 15457
451 Ga0495628_0051574 3300046516 Bacteria 3252
452 Ga0495628_0484667 3300046516 Bacteria 894
453 Ga0495630_0021049 3300046517 Bacteria 4815
454 Ga0495630_0071822 3300046517 Bacteria 2605
455 Ga0495630_0399654 3300046517 Bacteria 1053
456 Ga0495630_0669412 3300046517 Bacteria 794
457 Ga0495631_0364444 3300046518 Bacteria 615
458 Ga0495644_0015647 3300046523 Bacteria 2908
459 Ga0495663_0028389 3300046525 Bacteria 1647
460 Ga0495652_0000047 3300046529 Bacteria 121525
461 Ga0495652_0019141 3300046529 Bacteria 6099
462 Ga0495652_0069035 3300046529 Bacteria 2959
463 Ga0495652_0598786 3300046529 Bacteria 752
464 Ga0495665_0184635 3300046531 Bacteria 1083
465 Ga0495640_0009269 3300046533 Bacteria 7673
466 Ga0495640_0194966 3300046533 Bacteria 1286
467 Ga0495640_0777708 3300046533 Bacteria 571
468 Ga0495586_0059721 3300046535 Bacteria 2072
469 Ga0495586_0394825 3300046535 Bacteria 796
470 Ga0495587_0000103 3300046536 Bacteria 64471
471 Ga0495587_0131102 3300046536 Bacteria 1433
472 Ga0495587_0164621 3300046536 Bacteria 1261
473 Ga0495587_0430071 3300046536 Bacteria 732
474 Ga0495598_0102528 3300046537 Bacteria 949
475 Ga0495645_0000028 3300046543 Bacteria 113461
476 Ga0495645_0205109 3300046543 Bacteria 1334
477 Ga0495645_0243258 3300046543 Bacteria 1199
478 Ga0495622_0280640 3300046557 Bacteria 728
479 Ga0495667_0076410 3300046559 Bacteria 2179
480 Ga0495667_0080928 3300046559 Bacteria 2111
481 Ga0495667_0295261 3300046559 Bacteria 1027
482 Ga0495667_0506610 3300046559 Bacteria 756
483 Ga0495656_0035756 3300046615 Bacteria 2042
484 Ga0495668_0640092 3300046616 Bacteria 588
485 Ga0495634_0049770 3300046642 Bacteria 2816
486 Ga0495634_0278764 3300046642 Bacteria 1016
487 Ga0495634_0395681 3300046642 Bacteria 821
488 Ga0495611_0015105 3300046648 Bacteria 3300
489 Ga0495635_0135638 3300046663 Bacteria 1678
490 Ga0495635_0158119 3300046663 Bacteria 1542
491 Ga0495659_0081627 3300046664 Bacteria 1228
492 Ga0495661_0324640 3300046665 Bacteria 764
493 Ga0495588_0417906 3300046674 Bacteria 704
494 Ga0495588_0484839 3300046674 Bacteria 648
495 Ga0495657_0005251 3300046675 Bacteria 10253
496 Ga0495657_0065585 3300046675 Bacteria 2387
497 Ga0495657_0330079 3300046675 Bacteria 905
498 Ga0495657_0591451 3300046675 Bacteria 642
499 Ga0495657_0713058 3300046675 Bacteria 576
500 Ga0495599_0000073 3300046678 Bacteria 70685
501 Ga0495599_0004413 3300046678 Bacteria 8322
502 Ga0495599_0249147 3300046678 Bacteria 1081
503 Ga0495623_0000105 3300046679 Bacteria 51809
504 Ga0495623_0027100 3300046679 Bacteria 3686
505 Ga0495646_0001581 3300046680 Bacteria 13581
506 Ga0495646_0031795 3300046680 Bacteria 3287
507 Ga0495646_0092281 3300046680 Bacteria 1747
508 Ga0495647_0544368 3300046681 Bacteria 542
509 Ga0495658_0151018 3300046683 Bacteria 1427
510 Ga0495658_0284828 3300046683 Bacteria 1043
511 Ga0495613_0008298 3300046689 Bacteria 7711
512 Ga0495624_0008700 3300046690 Bacteria 7069
513 Ga0495624_0112544 3300046690 Bacteria 1673
514 Ga0495624_0265932 3300046690 Bacteria 1036
515 Ga0495624_0587559 3300046690 Bacteria 664
516 Ga0495670_0246020 3300046691 Bacteria 953
517 Ga0495671_0237542 3300046692 Bacteria 881
518 Ga0495589_0354256 3300046794 Bacteria 676
519 Ga0495600_0013086 3300046809 Bacteria 5206
520 Ga0495600_0075320 3300046809 Bacteria 2204
521 Ga0495600_0920550 3300046809 Bacteria 515
522 Ga0495581_0036218 3300047315 Bacteria 2855
523 Ga0495604_0000027 3300047317 Bacteria 143025
524 Ga0495604_0095420 3300047317 Bacteria 2197
525 Ga0495604_0123131 3300047317 Bacteria 1874
526 Ga0495604_0291368 3300047317 Bacteria 1099
527 Ga0495636_0126327 3300047318 Bacteria 1135
528 Ga0495674_0015274 3300047319 Bacteria 7184
529 Ga0495674_0143541 3300047319 Bacteria 2005
530 Ga0495674_1075144 3300047319 Unclassified 613
531 Ga0495674_1444405 3300047319 Bacteria 511
532 Ga0495676_0163727 3300047321 Bacteria 1571
533 Ga0495676_0344945 3300047321 Bacteria 996
534 Ga0495676_0465074 3300047321 Bacteria 833
535 Ga0495676_0574067 3300047321 Bacteria 736
536 Ga0495680_0003487 3300047322 Bacteria 15443
537 Ga0495680_0011938 3300047322 Bacteria 7665
538 Ga0495680_0064102 3300047322 Bacteria 2819
539 Ga0495680_0078811 3300047322 Bacteria 2492
540 Ga0495680_1067043 3300047322 Bacteria 512
541 Ga0495675_0000273 3300047444 Bacteria 37403
542 Ga0495675_0291671 3300047444 Bacteria 971
543 Ga0495677_0242928 3300047445 Bacteria 703
544 Ga0495684_0003752 3300047471 Bacteria 11850
545 Ga0495684_0233848 3300047471 Bacteria 1343
546 Ga0495684_0648824 3300047471 Bacteria 706
547 Ga0495593_0351799 3300047673 Bacteria 736
548 Ga0495602_0000096 3300048088 Bacteria 82587
549 Ga0495602_0131998 3300048088 Bacteria 1990
550 Ga0495602_0162455 3300048088 Bacteria 1742
551 Ga0495602_0642461 3300048088 Bacteria 725
552 Ga0495614_0624501 3300048089 Bacteria 518
553 Ga0495614_0657285 3300048089 Bacteria 506
554 Ga0496100_0054122 3300048903 Bacteria 2616
555 Ga0496100_0094681 3300048903 Bacteria 2046
556 Ga0496100_0143429 3300048903 Bacteria 1695
557 Ga0496100_0550877 3300048903 Bacteria 892
558 Ga0496101_0016305 3300048904 Bacteria 5015
559 Ga0496101_0029371 3300048904 Bacteria 3845
560 Ga0496101_0092700 3300048904 Bacteria 2249
561 Ga0496101_0749753 3300048904 Bacteria 770
562 Ga0496102_0063837 3300048905 Bacteria 3372
563 Ga0496102_0174231 3300048905 Bacteria 2025
564 Ga0496102_1060036 3300048905 Bacteria 731
565 Ga0496102_1627251 3300048905 Bacteria 564
566 Ga0496103_0017305 3300048906 Bacteria 4313
567 Ga0496103_0402863 3300048906 Bacteria 879
568 Ga0496104_0002863 3300048907 Bacteria 14870
569 Ga0496104_0036455 3300048907 Bacteria 4598
570 Ga0496104_0091308 3300048907 Bacteria 2911
571 Ga0496104_0203134 3300048907 Bacteria 1893
572 Ga0496104_1406887 3300048907 Unclassified 600
573 Ga0496104_1533731 3300048907 Bacteria 569
574 Ga0496105_0001941 3300048908 Bacteria 14854
575 Ga0496105_0015342 3300048908 Bacteria 6103
576 Ga0496105_0262049 3300048908 Bacteria 1398
577 Ga0496105_0301676 3300048908 Bacteria 1287
578 Ga0496105_0818995 3300048908 Bacteria 707
579 Ga0496105_0995478 3300048908 Bacteria 627
580 Ga0496106_0186804 3300048909 Bacteria 1646
581 Ga0496106_1573951 3300048909 Bacteria 504
582 Ga0496107_0002689 3300048910 Bacteria 11655
583 Ga0496107_0065732 3300048910 Bacteria 2630
584 Ga0496107_0292599 3300048910 Bacteria 1212
585 Ga0496107_1230725 3300048910 Bacteria 537
586 Ga0496108_0004672 3300048911 Bacteria 11040
587 Ga0496108_0042821 3300048911 Bacteria 3780
588 Ga0496108_0065521 3300048911 Bacteria 3062
589 Ga0496108_0131396 3300048911 Bacteria 2152
590 Ga0496109_0017047 3300048912 Bacteria 6357
591 Ga0496109_0036221 3300048912 Bacteria 4453
592 Ga0496109_0122543 3300048912 Bacteria 2422
593 Ga0496109_1133115 3300048912 Unclassified 719
594 Ga0496110_0009448 3300048913 Bacteria 7897
595 Ga0496110_0044600 3300048913 Bacteria 3872
596 Ga0496110_0059592 3300048913 Bacteria 3366
597 Ga0496110_1606303 3300048913 Bacteria 560
598 Ga0496111_0004132 3300048914 Bacteria 9121
599 Ga0496111_0040544 3300048914 Bacteria 3340
600 Ga0496111_0790677 3300048914 Bacteria 687
601 Ga0496111_0934227 3300048914 Bacteria 624
602 Ga0496111_1003157 3300048914 Bacteria 598
603 Ga0496112_0135579 3300048915 Bacteria 2432
604 Ga0496112_0565632 3300048915 Bacteria 1070
605 Ga0496112_1074049 3300048915 Bacteria 723
606 Ga0496112_1455494 3300048915 Bacteria 599
607 Ga0496113_0030212 3300048916 Bacteria 3920
608 Ga0496113_0200751 3300048916 Bacteria 1585
609 Ga0496113_0882782 3300048916 Unclassified 708
610 Ga0496113_1451758 3300048916 Unclassified 530
611 Ga0496114_0013996 3300048917 Bacteria 6431
612 Ga0496114_0021553 3300048917 Bacteria 5242
613 Ga0496114_0074808 3300048917 Bacteria 2852
614 Ga0496114_0668535 3300048917 Bacteria 912
615 Ga0496115_0039348 3300048918 Bacteria 3755
616 Ga0496115_0043642 3300048918 Bacteria 3576
617 Ga0496115_0108648 3300048918 Bacteria 2277
618 Ga0496115_0170763 3300048918 Bacteria 1798
619 Ga0496115_0248274 3300048918 Bacteria 1466
620 Ga0496115_0771047 3300048918 Bacteria 750
621 Ga0496115_0923961 3300048918 Unclassified 671
622 Ga0501031_0065770 3300049568 Bacteria 2362
623 Ga0501031_0965455 3300049568 Unclassified 545
624 Ga0501034_0063157 3300049571 Bacteria 3717
625 Ga0501036_0224417 3300049572 Bacteria 1577
626 Ga0501037_0231786 3300049573 Bacteria 1296
627 Ga0501038_0200369 3300049574 Bacteria 1602
628 Ga0501039_0459801 3300049575 Bacteria 999
629 Ga0501040_0057669 3300049576 Bacteria 2666
630 Ga0501046_0067678 3300049580 Bacteria 2781
631 Ga0501046_0587576 3300049580 Bacteria 791
632 Ga0501047_0249352 3300049581 Bacteria 1624
633 Ga0501048_0160003 3300049582 Bacteria 1593
634 Ga0501067_0017348 3300049583 Bacteria 3979
635 Ga0501067_0058244 3300049583 Bacteria 2140
636 Ga0501067_0352416 3300049583 Bacteria 820
637 Ga0501068_0574480 3300049584 Unclassified 734
638 Ga0501069_0132452 3300049585 Bacteria 1428
639 Ga0501070_0001820 3300049586 Bacteria 18782
640 Ga0501070_0077782 3300049586 Bacteria 2745
641 Ga0501071_1332088 3300049587 Bacteria 554
642 Ga0501072_0040841 3300049588 Bacteria 3643
643 Ga0501072_0748954 3300049588 Bacteria 766
644 Ga0501072_1370217 3300049588 Bacteria 547
645 Ga0501073_0018504 3300049589 Bacteria 5036
646 Ga0501073_0324231 3300049589 Bacteria 1063
647 Ga0501073_0419322 3300049589 Bacteria 925
648 Ga0501074_0007159 3300049590 Bacteria 8056
649 Ga0501074_0116750 3300049590 Bacteria 1909
650 Ga0501075_0152661 3300049591 Bacteria 1760
651 Ga0501076_0686042 3300049592 Bacteria 845
652 Ga0501077_0075569 3300049593 Bacteria 2133
653 Ga0501079_0055171 3300049741 Bacteria 3066
654 Ga0501079_0372051 3300049741 Bacteria 1120
655 Ga0501079_0530475 3300049741 Bacteria 925
656 Ga0501080_0000309 3300049742 Bacteria 37361
657 Ga0501080_0238942 3300049742 Bacteria 1658
658 Ga0501080_0437500 3300049742 Bacteria 1173
659 Ga0501080_1327098 3300049742 Unclassified 615
660 Ga0501081_0043310 3300049743 Bacteria 3087
661 Ga0501081_1461432 3300049743 Bacteria 519
662 Ga0501083_0000241 3300049744 Bacteria 35214
663 Ga0501083_0357205 3300049744 Bacteria 950
664 Ga0501035_0286156 3300049822 Bacteria 1392
665 Ga0501044_0291569 3300049823 Bacteria 1563
666 Ga0501045_0046836 3300049824 Bacteria 3148
667 nmdc:mga0n895_1228613_c1 3300050512 Bacteria 722
668 nmdc:mga0n895_28075_c1 3300050512 Bacteria 5351
669 nmdc:mga0rr50_91259_c1 3300050513 Bacteria 2372
670 nmdc:mga0a205_1540006_c1 3300050515 Bacteria 513
671 nmdc:mga0a205_169928_c1 3300050515 Bacteria 2076
672 Ga0495601_0005767 3300053077 Bacteria 7224
673 Ga0495601_0028771 3300053077 Bacteria 3443
674 Ga0495601_0106044 3300053077 Bacteria 1817
675 Ga0495601_0838338 3300053077 Unclassified 582
676 Ga0495601_0921353 3300053077 Unclassified 551
677 Ga0495612_0024814 3300053078 Bacteria 2407
678 Ga0495612_0030133 3300053078 Bacteria 2186
679 Ga0495612_0465482 3300053078 Bacteria 578
680 Ga0495595_0002579 3300053084 Bacteria 7107
681 Ga0495595_0006279 3300053084 Bacteria 4839
682 Ga0495595_0032742 3300053084 Bacteria 2342
683 Ga0495595_0185732 3300053084 Bacteria 1032
684 Ga0495619_0017049 3300053085 Bacteria 4604
685 Ga0495619_0028638 3300053085 Bacteria 3594
686 Ga0495619_0245685 3300053085 Bacteria 1240
687 Ga0495619_0319839 3300053085 Bacteria 1074
688 Ga0495619_0694672 3300053085 Bacteria 692
689 Ga0501084_0922246 3300054114 Bacteria 734
690 Ga0501084_1402295 3300054114 Unclassified 585
691 Ga0501082_0066999 3300060353 Bacteria 3091
692 Ga0466962_0002364 3300061719 Bacteria 8937
693 Ga0466962_0002404 3300061719 Bacteria 8878
694 Ga0466962_0003493 3300061719 Bacteria 7490
695 Ga0466962_0006158 3300061719 Bacteria 5765
696 Ga0466962_0008841 3300061719 Bacteria 4827
697 Ga0466962_0065297 3300061719 Bacteria 1738
698 Ga0466962_0596925 3300061719 Bacteria 563
699 Ga0466962_0628993 3300061719 Bacteria 548
700 Ga0530510_0035647 3300061734 Bacteria 3585
701 Ga0395900_0591104
702 Ga0070710_11157663
703 Ga0070664_100764184
704 Ga0068857_100537848
705 Ga0068857_102348706
706 Ga0068856_100065074
707 Ga0068856_100112187
708 Ga0068863_100445810
709 Ga0068860_102150714
710 Ga0070717_10058314
711 Ga0070717_10107197
712 Ga0070717_10111880
713 Ga0070717_10293750
714 Ga0070717_10363685
715 Ga0070717_10784415
716 Ga0070715_10000948
717 Ga0070715_10497960
718 Ga0070715_11098406
719 Ga0070716_100003355
720 Ga0070716_100463523
721 Ga0070716_100805149
722 Ga0070716_101430677
723 Ga0070712_100054038
724 Ga0070712_100114735
725 Ga0070712_100232096
726 Ga0070712_100297695
727 Ga0070712_100639888
728 Ga0097621_100708829
729 Ga0097621_100709100
730 Ga0068871_100935773
731 Ga0075433_10144857
732 Ga0075433_11785915
733 Ga0075434_100037607
734 Ga0075434_101510775
735 Ga0075434_102472552
736 Ga0075436_100383248
737 Ga0075436_100613548
738 Ga0099794_10371337
739 Ga0105240_11273755
740 Ga0105245_10594946
741 Ga0105245_10611017
742 Ga0105245_10717380
743 Ga0105242_11656206
744 Ga0105248_10162033
745 Ga0105238_10290448
746 Ga0099796_10124412
747 Ga0105239_10427718
748 Ga0105239_13082614
749 Ga0105246_10859752
750 Ga0157373_10989757
751 Ga0157371_11526391
752 Ga0157370_10786736
753 Ga0157370_10922208
754 Ga0157370_11031751
755 Ga0157369_10036406
756 Ga0157369_10384260
757 Ga0157369_10405568
758 Ga0157369_10571362
759 Ga0157369_10733626
760 Ga0157369_10929375
761 Ga0157369_11125977
762 Ga0157374_10043054
763 Ga0157374_10062924
764 Ga0157374_10739468
765 Ga0157374_12979035
766 Ga0163162_11289799
767 Ga0157372_10070515
768 Ga0157372_10225721
769 Ga0157372_10452791
770 Ga0157372_12264480
771 Ga0157375_10202136
772 Ga0163163_11728264
773 Ga0182008_10487483
774 Ga0157379_10059231
775 Ga0157376_10049834
776 Ga0206356_10044910
777 Ga0206354_11148611
778 Ga0206353_10090081
779 Ga0206353_11737025
780 Ga0213876_10760253
781 Ga0207692_10011074
782 Ga0207692_10040028
783 Ga0207692_10637311
784 Ga0207692_11058531
785 Ga0207685_10002067
786 Ga0207685_10462154
787 Ga0207699_10006523
788 Ga0207699_10147315
789 Ga0207699_11164078
790 Ga0207705_10080573
791 Ga0207705_10268550
792 Ga0207684_10500306
793 Ga0207707_10107723
794 Ga0207707_10738238
795 Ga0207707_10874882
796 Ga0207693_10000745
797 Ga0207693_10007103
798 Ga0207693_10408870
799 Ga0207693_10451931
800 Ga0207693_10792254
801 Ga0207663_10022898
802 Ga0207663_10077887
803 Ga0207663_10705648
804 Ga0207663_11507861
805 Ga0207663_11642654
806 Ga0207660_10241427
807 Ga0207660_10480221
808 Ga0207660_10751692
809 Ga0207657_10007302
810 Ga0207657_10049531
811 Ga0207657_10070725
812 Ga0207649_10147839
813 Ga0207649_10717597
814 Ga0207649_11186658
815 Ga0207652_10251379
816 Ga0207652_10478669
817 Ga0207652_10598223
818 Ga0207646_10000785
819 Ga0207646_10260192
820 Ga0207687_10107096
821 Ga0207687_10708384
822 Ga0207700_10002676
823 Ga0207700_10109462
824 Ga0207700_10196100
825 Ga0207700_10564345
826 Ga0207700_11241096
827 Ga0207700_11934159
828 Ga0207664_10021059
829 Ga0207664_10084127
830 Ga0207664_10106892
831 Ga0207664_10143967
832 Ga0207664_10145301
833 Ga0207664_10158498
834 Ga0207664_10180584
835 Ga0207664_10313299
836 Ga0207664_10415570
837 Ga0207664_10461744
838 Ga0207664_10639747
839 Ga0207664_10815597
840 Ga0207664_11210029
841 Ga0207664_11613461
842 Ga0207664_11888093
843 Ga0207664_12006823
844 Ga0207644_10385282
845 Ga0207690_10656146
846 Ga0207690_10799905
847 Ga0207686_10724047
848 Ga0207665_10001126
849 Ga0207665_10109893
850 Ga0207665_11266956
851 Ga0207711_10243885
852 Ga0207661_10654748
853 Ga0207661_10998481
854 Ga0207661_11352880
855 Ga0207661_11952865
856 Ga0207679_10315203
857 Ga0207679_10429779
858 Ga0207667_10205505
859 Ga0207667_11526324
860 Ga0207639_10525801
861 Ga0207639_11151184
862 Ga0207639_11196606
863 Ga0207678_10287560
864 Ga0207702_10068409
865 Ga0207702_10098038
866 Ga0207702_10542929
867 Ga0207698_11482965
868 Ga0207698_11808155
869 Ga0207428_10287891
870 Ga0268264_12319667
871 Ga0265326_10007165
872 Ga0265326_10025248
873 Ga0265319_1016183
874 Ga0265319_1052069
875 Ga0265319_1286504
876 Ga0265334_10002601
877 Ga0265334_10157498
878 Ga0265318_10000633
879 Ga0265318_10026077
880 Ga0265318_10061572
881 Ga0265318_10095995
882 Ga0265318_10211203
883 Ga0265323_10201493
884 Ga0265322_10015772
885 Ga0265322_10082578
886 Ga0265322_10247027
887 Ga0265338_10017133
888 Ga0265338_10018943
889 Ga0265338_10019624
890 Ga0265338_10401884
891 Ga0265338_10580100
892 Ga0265330_10002779
893 Ga0265330_10302312
894 Ga0265332_10006125
895 Ga0265332_10394495
896 Ga0265328_10008252
897 Ga0265320_10017649
898 Ga0265320_10034456
899 Ga0265320_10162881
900 Ga0265320_10181968
901 Ga0265325_10008761
902 Ga0265325_10046388
903 Ga0265325_10129283
904 Ga0265329_10001093
905 Ga0265329_10194887
906 Ga0265340_10003071
907 Ga0265340_10062773
908 Ga0265340_10149598
909 Ga0265339_10010742
910 Ga0265339_10084167
911 Ga0265339_10378755
912 Ga0265331_10039278
913 Ga0265327_10054714
914 Ga0265327_10153798
915 Ga0265316_10013122
916 Ga0265316_10014571
917 Ga0265316_10160270
918 Ga0265313_10010591
919 Ga0265313_10013762
920 Ga0265313_10082263
921 Ga0265314_10012611
922 Ga0265314_10022648
923 Ga0265314_10028551
924 Ga0265342_10015434
925 Ga0265342_10102346
926 Ga0265342_10280908
927 Ga0373948_0056106
928 Ga0373934_0512907
929 Ga0373940_0067924
930 Ga0373952_0050654
931 Ga0373939_0388982
932 Ga0373941_0062192
933 Ga0373953_0257906
934 Ga0373953_0384074
935 Ga0373954_0533084
936 Ga0373956_0130267
937 Ga0373957_0307810
938 Ga0373960_0300862
939 Ga0373943_0919162
940 Ga0373946_0230190
941 Ga0373962_0058709
942 Ga0373924_0093813
943 Ga0373931_0014101
944 Ga0373935_0037735
945 Ga0373935_1504351
946 Ga0373933_0195799
947 Ga0373947_0929308
948 Ga0373937_0002033
949 Ga0373937_0186662
950 Ga0373937_0719603
951 Ga0373925_1182254
952 Ga0395899_0047446
953 Ga0395899_0057892
954 Ga0395899_0067585
955 Ga0395900_0030345
956 Ga0395900_0035416
957 Ga0395900_0098878
958 Ga0395900_0428741
959 Ga0395900_1709206
960 Ga0395898_0020962
961 Ga0395898_0084361
962 Ga0395898_0383815
963 Ga0395898_0444001
964 Ga0395898_0623328
965 Ga0395898_0631911
966 Ga0395898_0938157
967 Ga0395898_1123903
968 Ga0395905_0089531
969 Ga0395905_0114155
970 Ga0395905_0916723
971 Ga0395905_1558262
972 Ga0395901_0009177
973 Ga0395901_0017820
974 Ga0395901_0273352
975 Ga0395901_0438043
976 Ga0395901_0526323
977 Ga0395901_1009372
978 Ga0395901_1567046
979 Ga0395901_1981058
980 Ga0436365_1727373
981 Ga0436360_1250321
982 Ga0436363_1652782
983 Ga0466969_0001344
984 Ga0466969_0061412
985 Ga0466969_0288416
986 Ga0466965_0050060
987 Ga0466965_0058393
988 Ga0466965_0091325
989 Ga0466965_0213444
990 Ga0466965_0419956
991 Ga0466965_0574034
992 Ga0466966_0002635
993 Ga0466966_0021639
994 Ga0466966_0145615
995 Ga0466966_0841067
996 Ga0466961_0001489
997 Ga0466961_0003353
998 Ga0466961_0004912
999 Ga0466961_0022211
1000 Ga0466961_0443854
1001 Ga0466963_0000049
1002 Ga0466963_0006191
1003 Ga0466963_0006435
1004 Ga0466963_0006856
1005 Ga0466963_0007471
1006 Ga0466963_0011460
1007 Ga0466963_0013668
1008 Ga0466963_0014157
1009 Ga0466963_0026461
1010 Ga0466963_0032990
1011 Ga0466963_0056345
1012 Ga0466963_0079348
1013 Ga0466963_0129902
1014 Ga0466963_0243732
1015 Ga0466963_0252400
1016 Ga0466963_0412508
1017 Ga0466963_0457300
1018 Ga0466963_0506307
1019 Ga0466963_0787951
1020 Ga0466963_1007865
1021 Ga0466964_0003456
1022 Ga0466964_0006319
1023 Ga0466964_0011005
1024 Ga0466964_0015458
1025 Ga0466964_0023759
1026 Ga0466964_0026335
1027 Ga0466964_0161493
1028 Ga0466964_0165578
1029 Ga0466964_0438633
1030 Ga0466964_0494797
1031 Ga0466971_0002587
1032 Ga0466971_0004215
1033 Ga0466971_0013651
1034 Ga0466971_0049426
1035 Ga0466971_0091090
1036 Ga0466971_0114499
1037 Ga0466971_0459763
1038 Ga0466971_0461309
1039 Ga0466971_0620374
1040 Ga0466968_0002705
1041 Ga0466968_0003546
1042 Ga0466968_0011935
1043 Ga0466968_0027753
1044 Ga0466968_0081299
1045 Ga0466968_0331365
1046 Ga0466968_0341425
1047 Ga0466968_0355164
1048 Ga0466970_0026021
1049 Ga0466970_0086056
1050 Ga0466970_0502160
1051 Ga0466970_0559742
1052 Ga0466957_0001599
1053 Ga0466957_0002669
1054 Ga0466957_0010319
1055 Ga0466957_0010897
1056 Ga0466957_0012961
1057 Ga0466957_0012966
1058 Ga0466957_0014939
1059 Ga0466957_0024600
1060 Ga0466957_0053930
1061 Ga0466957_0094070
1062 Ga0466957_0499160
1063 Ga0466957_0499662
1064 Ga0466960_0020062
1065 Ga0466960_0216457
1066 Ga0466960_0267123
1067 Ga0466960_0413337
1068 Ga0466959_0001570
1069 Ga0466959_0009471
1070 Ga0466959_0010896
1071 Ga0466959_0026344
1072 Ga0466959_0080504
1073 Ga0466959_0202113
1074 Ga0466959_0371608
1075 Ga0466959_0414258
1076 Ga0466959_0440214
1077 Ga0466958_0000746
1078 Ga0466958_0002299
1079 Ga0466958_0032097
1080 Ga0466958_0078055
1081 Ga0466958_0144162
1082 Ga0466958_0153784
1083 Ga0466958_0197253
1084 Ga0466958_0223841
1085 Ga0466958_0233326
1086 Ga0466958_0707043
1087 Ga0466958_1008981
1088 Ga0466967_0003030
1089 Ga0466967_0004223
1090 Ga0466967_0025778
1091 Ga0466967_0030338
1092 Ga0466967_0044334
1093 Ga0466967_0080101
1094 Ga0466967_0120153
1095 Ga0466967_0129164
1096 Ga0466967_0137635
1097 Ga0466967_0158017
1098 Ga0466967_0174847
1099 Ga0466967_0244552
1100 Ga0466967_0277583
1101 Ga0466967_0378792
1102 Ga0466967_0412325
1103 Ga0466967_0494661
1104 Ga0466967_0509888
1105 Ga0466967_0575219
1106 Ga0466967_0996248
1107 Ga0466967_1578884
1108 Ga0466967_1796419
1109 Ga0466967_1902874
1110 Ga0495592_0001046
1111 Ga0495592_0008205
1112 Ga0495592_0174674
1113 Ga0495603_0010214
1114 Ga0495603_0179595
1115 Ga0495603_0386708
1116 Ga0495629_0068732
1117 Ga0495629_0150951
1118 Ga0495629_0300714
1119 Ga0495641_0009576
1120 Ga0495641_0024307
1121 Ga0495651_0000004
1122 Ga0495651_0807427
1123 Ga0495653_0001654
1124 Ga0495653_0054325
1125 Ga0495653_0267316
1126 Ga0495653_0392243
1127 Ga0495580_1043394
1128 Ga0495582_0077852
1129 Ga0495582_0308016
1130 Ga0495582_0834374
1131 Ga0495582_0866677
1132 Ga0495605_0111191
1133 Ga0495662_0054037
1134 Ga0495664_0756680
1135 Ga0495584_0301474
1136 Ga0495585_0215797
1137 Ga0495594_0210073
1138 Ga0495594_0224935
1139 Ga0495596_0053855
1140 Ga0495607_0451472
1141 Ga0495608_0000706
1142 Ga0495608_0010721
1143 Ga0495608_0048719
1144 Ga0495608_0293412
1145 Ga0495608_0343773
1146 Ga0495608_0397773
1147 Ga0495618_0004348
1148 Ga0495618_0053834
1149 Ga0495618_0664319
1150 Ga0495628_0002866
1151 Ga0495628_0051574
1152 Ga0495628_0484667
1153 Ga0495630_0021049
1154 Ga0495630_0071822
1155 Ga0495630_0399654
1156 Ga0495630_0669412
1157 Ga0495631_0364444
1158 Ga0495644_0015647
1159 Ga0495663_0028389
1160 Ga0495652_0000047
1161 Ga0495652_0019141
1162 Ga0495652_0069035
1163 Ga0495652_0598786
1164 Ga0495665_0184635
1165 Ga0495640_0009269
1166 Ga0495640_0194966
1167 Ga0495640_0777708
1168 Ga0495586_0059721
1169 Ga0495586_0394825
1170 Ga0495587_0000103
1171 Ga0495587_0131102
1172 Ga0495587_0164621
1173 Ga0495587_0430071
1174 Ga0495598_0102528
1175 Ga0495645_0000028
1176 Ga0495645_0205109
1177 Ga0495645_0243258
1178 Ga0495622_0280640
1179 Ga0495667_0076410
1180 Ga0495667_0080928
1181 Ga0495667_0295261
1182 Ga0495667_0506610
1183 Ga0495656_0035756
1184 Ga0495668_0640092
1185 Ga0495634_0049770
1186 Ga0495634_0278764
1187 Ga0495634_0395681
1188 Ga0495611_0015105
1189 Ga0495635_0135638
1190 Ga0495635_0158119
1191 Ga0495659_0081627
1192 Ga0495661_0324640
1193 Ga0495588_0417906
1194 Ga0495588_0484839
1195 Ga0495657_0005251
1196 Ga0495657_0065585
1197 Ga0495657_0330079
1198 Ga0495657_0591451
1199 Ga0495657_0713058
1200 Ga0495599_0000073
1201 Ga0495599_0004413
1202 Ga0495599_0249147
1203 Ga0495623_0000105
1204 Ga0495623_0027100
1205 Ga0495646_0001581
1206 Ga0495646_0031795
1207 Ga0495646_0092281
1208 Ga0495647_0544368
1209 Ga0495658_0151018
1210 Ga0495658_0284828
1211 Ga0495613_0008298
1212 Ga0495624_0008700
1213 Ga0495624_0112544
1214 Ga0495624_0265932
1215 Ga0495624_0587559
1216 Ga0495670_0246020
1217 Ga0495671_0237542
1218 Ga0495589_0354256
1219 Ga0495600_0013086
1220 Ga0495600_0075320
1221 Ga0495600_0920550
1222 Ga0495581_0036218
1223 Ga0495604_0000027
1224 Ga0495604_0095420
1225 Ga0495604_0123131
1226 Ga0495604_0291368
1227 Ga0495636_0126327
1228 Ga0495674_0015274
1229 Ga0495674_0143541
1230 Ga0495674_1075144
1231 Ga0495674_1444405
1232 Ga0495676_0163727
1233 Ga0495676_0344945
1234 Ga0495676_0465074
1235 Ga0495676_0574067
1236 Ga0495680_0003487
1237 Ga0495680_0011938
1238 Ga0495680_0064102
1239 Ga0495680_0078811
1240 Ga0495680_1067043
1241 Ga0495675_0000273
1242 Ga0495675_0291671
1243 Ga0495677_0242928
1244 Ga0495684_0003752
1245 Ga0495684_0233848
1246 Ga0495684_0648824
1247 Ga0495593_0351799
1248 Ga0495602_0000096
1249 Ga0495602_0131998
1250 Ga0495602_0162455
1251 Ga0495602_0642461
1252 Ga0495614_0624501
1253 Ga0495614_0657285
1254 Ga0496100_0054122
1255 Ga0496100_0094681
1256 Ga0496100_0143429
1257 Ga0496100_0550877
1258 Ga0496101_0016305
1259 Ga0496101_0029371
1260 Ga0496101_0092700
1261 Ga0496101_0749753
1262 Ga0496102_0063837
1263 Ga0496102_0174231
1264 Ga0496102_1060036
1265 Ga0496102_1627251
1266 Ga0496103_0017305
1267 Ga0496103_0402863
1268 Ga0496104_0002863
1269 Ga0496104_0036455
1270 Ga0496104_0091308
1271 Ga0496104_0203134
1272 Ga0496104_1406887
1273 Ga0496104_1533731
1274 Ga0496105_0001941
1275 Ga0496105_0015342
1276 Ga0496105_0262049
1277 Ga0496105_0301676
1278 Ga0496105_0818995
1279 Ga0496105_0995478
1280 Ga0496106_0186804
1281 Ga0496106_1573951
1282 Ga0496107_0002689
1283 Ga0496107_0065732
1284 Ga0496107_0292599
1285 Ga0496107_1230725
1286 Ga0496108_0004672
1287 Ga0496108_0042821
1288 Ga0496108_0065521
1289 Ga0496108_0131396
1290 Ga0496109_0017047
1291 Ga0496109_0036221
1292 Ga0496109_0122543
1293 Ga0496109_1133115
1294 Ga0496110_0009448
1295 Ga0496110_0044600
1296 Ga0496110_0059592
1297 Ga0496110_1606303
1298 Ga0496111_0004132
1299 Ga0496111_0040544
1300 Ga0496111_0790677
1301 Ga0496111_0934227
1302 Ga0496111_1003157
1303 Ga0496112_0135579
1304 Ga0496112_0565632
1305 Ga0496112_1074049
1306 Ga0496112_1455494
1307 Ga0496113_0030212
1308 Ga0496113_0200751
1309 Ga0496113_0882782
1310 Ga0496113_1451758
1311 Ga0496114_0013996
1312 Ga0496114_0021553
1313 Ga0496114_0074808
1314 Ga0496114_0668535
1315 Ga0496115_0039348
1316 Ga0496115_0043642
1317 Ga0496115_0108648
1318 Ga0496115_0170763
1319 Ga0496115_0248274
1320 Ga0496115_0771047
1321 Ga0496115_0923961
1322 Ga0501031_0065770
1323 Ga0501031_0965455
1324 Ga0501034_0063157
1325 Ga0501036_0224417
1326 Ga0501037_0231786
1327 Ga0501038_0200369
1328 Ga0501039_0459801
1329 Ga0501040_0057669
1330 Ga0501046_0067678
1331 Ga0501046_0587576
1332 Ga0501047_0249352
1333 Ga0501048_0160003
1334 Ga0501067_0017348
1335 Ga0501067_0058244
1336 Ga0501067_0352416
1337 Ga0501068_0574480
1338 Ga0501069_0132452
1339 Ga0501070_0001820
1340 Ga0501070_0077782
1341 Ga0501071_1332088
1342 Ga0501072_0040841
1343 Ga0501072_0748954
1344 Ga0501072_1370217
1345 Ga0501073_0018504
1346 Ga0501073_0324231
1347 Ga0501073_0419322
1348 Ga0501074_0007159
1349 Ga0501074_0116750
1350 Ga0501075_0152661
1351 Ga0501076_0686042
1352 Ga0501077_0075569
1353 Ga0501079_0055171
1354 Ga0501079_0372051
1355 Ga0501079_0530475
1356 Ga0501080_0000309
1357 Ga0501080_0238942
1358 Ga0501080_0437500
1359 Ga0501080_1327098
1360 Ga0501081_0043310
1361 Ga0501081_1461432
1362 Ga0501083_0000241
1363 Ga0501083_0357205
1364 Ga0501035_0286156
1365 Ga0501044_0291569
1366 Ga0501045_0046836
1367 nmdc:mga0n895_1228613_c1
1368 nmdc:mga0n895_28075_c1
1369 nmdc:mga0rr50_91259_c1
1370 nmdc:mga0a205_1540006_c1
1371 nmdc:mga0a205_169928_c1
1372 Ga0495601_0005767
1373 Ga0495601_0028771
1374 Ga0495601_0106044
1375 Ga0495601_0838338
1376 Ga0495601_0921353
1377 Ga0495612_0024814
1378 Ga0495612_0030133
1379 Ga0495612_0465482
1380 Ga0495595_0002579
1381 Ga0495595_0006279
1382 Ga0495595_0032742
1383 Ga0495595_0185732
1384 Ga0495619_0017049
1385 Ga0495619_0028638
1386 Ga0495619_0245685
1387 Ga0495619_0319839
1388 Ga0495619_0694672
1389 Ga0501084_0922246
1390 Ga0501084_1402295
1391 Ga0501082_0066999
1392 Ga0466962_0002364
1393 Ga0466962_0002404
1394 Ga0466962_0003493
1395 Ga0466962_0006158
1396 Ga0466962_0008841
1397 Ga0466962_0065297
1398 Ga0466962_0596925
1399 Ga0466962_0628993
1400 Ga0530510_0035647

MSA Aligner

Family Sequences

Map