F476049

General Info

Members Datasets Scaffolds Average Seq Length
699 290 1398 203

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0450067|Ga0495630_0450067_306_911
Length 201
Sequence MTVRKSSYRSLASLARDLSRCRACVEAGYPLESLPVHAPGAGQKAYLFGQAPGVIEGEERLPWRGDAGRRLRRWLELEDETEFYATFHCASVTRCYPGRAPSGRGDRTPAPREQELCRFWRDWELELLRPGLIVTVGGLALQGLLGVAPLTAYVGERCELDGTPVVPLPHSSGASGWLNVPDNRERLAAALELVRAELVKL

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.87
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 17.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0450067 3300046517 Bacteria 987
2 Ga0070680_100045841 3300005336 Bacteria 3555
3 Ga0070680_100470762 3300005336 Unclassified 1074
4 Ga0070682_100026704 3300005337 Bacteria 3459
5 Ga0070682_100027607 3300005337 Bacteria 3407
6 Ga0070682_100505915 3300005337 Viruses 937
7 Ga0068868_100042341 3300005338 Unclassified 3553
8 Ga0070660_100002731 3300005339 Bacteria 12123
9 Ga0070689_100010547 3300005340 Bacteria 6585
10 Ga0070661_100050544 3300005344 Bacteria 3042
11 Ga0070661_100498891 3300005344 Unclassified 974
12 Ga0070668_100010845 3300005347 Bacteria 6780
13 Ga0070675_100047064 3300005354 Bacteria 3533
14 Ga0070671_100089760 3300005355 Bacteria 2573
15 Ga0070673_100070100 3300005364 Unclassified 2812
16 Ga0070659_100086305 3300005366 Bacteria 2511
17 Ga0070659_100119919 3300005366 Unclassified 2129
18 Ga0070659_100578949 3300005366 Bacteria 963
19 Ga0070709_10014800 3300005434 Bacteria 4421
20 Ga0070709_10181123 3300005434 Bacteria 1479
21 Ga0070714_100021674 3300005435 Bacteria 5258
22 Ga0070714_100030456 3300005435 Bacteria 4491
23 Ga0070714_100046425 3300005435 Bacteria 3685
24 Ga0070714_100096481 3300005435 Bacteria 2597
25 Ga0070714_100531628 3300005435 Bacteria 1124
26 Ga0070713_100037211 3300005436 Bacteria 3934
27 Ga0070713_100121662 3300005436 Bacteria 2290
28 Ga0070713_100367502 3300005436 Unclassified 1338
29 Ga0070713_100376567 3300005436 Bacteria 1322
30 Ga0070710_10006176 3300005437 Bacteria 5734
31 Ga0070710_10006205 3300005437 Bacteria 5721
32 Ga0070710_10020745 3300005437 Bacteria 3413
33 Ga0070711_100051181 3300005439 Bacteria 2835
34 Ga0070711_100071032 3300005439 Bacteria 2452
35 Ga0070711_100151947 3300005439 Bacteria 1747
36 Ga0070705_100033210 3300005440 Bacteria 2874
37 Ga0070705_100129862 3300005440 Bacteria 1642
38 Ga0070700_100061729 3300005441 Unclassified 2365
39 Ga0070708_100283504 3300005445 Bacteria 1559
40 Ga0070663_100011892 3300005455 Bacteria 5487
41 Ga0070678_100456954 3300005456 Unclassified 1119
42 Ga0070678_100910156 3300005456 Bacteria 804
43 Ga0070681_10003387 3300005458 Bacteria 14915
44 Ga0070681_10048080 3300005458 Bacteria 4263
45 Ga0070681_10062785 3300005458 Bacteria 3688
46 Ga0070681_10070828 3300005458 Bacteria 3451
47 Ga0070681_10119792 3300005458 Bacteria 2568
48 Ga0070681_10659722 3300005458 Unclassified 961
49 Ga0070681_10766387 3300005458 Bacteria 881
50 Ga0070685_10009736 3300005466 Bacteria 4979
51 Ga0070685_10296743 3300005466 Bacteria 1088
52 Ga0070706_100316161 3300005467 Unclassified 1456
53 Ga0070706_100322262 3300005467 Unclassified 1441
54 Ga0070706_101164168 3300005467 Unclassified 709
55 Ga0070707_100001723 3300005468 Bacteria 21101
56 Ga0070707_100012654 3300005468 Bacteria 7880
57 Ga0070707_100045223 3300005468 Bacteria 4214
58 Ga0070707_100158474 3300005468 Bacteria 2205
59 Ga0070707_100179480 3300005468 Unclassified 2064
60 Ga0070698_100011547 3300005471 Bacteria 9369
61 Ga0070699_100929373 3300005518 Unclassified 797
62 Ga0070679_100036609 3300005530 Bacteria 4870
63 Ga0070679_100101496 3300005530 Bacteria 2864
64 Ga0070679_100118527 3300005530 Bacteria 2632
65 Ga0070679_100163272 3300005530 Unclassified 2201
66 Ga0070679_100205717 3300005530 Bacteria 1933
67 Ga0070679_100211335 3300005530 Bacteria 1904
68 Ga0070679_100339736 3300005530 Unclassified 1450
69 Ga0070684_100085923 3300005535 Bacteria 2791
70 Ga0070684_100260621 3300005535 Bacteria 1586
71 Ga0070684_100273849 3300005535 Bacteria 1546
72 Ga0070684_100429133 3300005535 Bacteria 1220
73 Ga0070684_100564210 3300005535 Bacteria 1057
74 Ga0070697_100289493 3300005536 Bacteria 1407
75 Ga0070697_100372098 3300005536 Bacteria 1236
76 Ga0068853_100022608 3300005539 Bacteria 5253
77 Ga0070686_100053614 3300005544 Bacteria 2576
78 Ga0070695_100000510 3300005545 Bacteria 20376
79 Ga0070696_100098604 3300005546 Bacteria 2090
80 Ga0070696_100165315 3300005546 Bacteria 1633
81 Ga0070696_100357354 3300005546 Bacteria 1133
82 Ga0070693_100015557 3300005547 Bacteria 3918
83 Ga0070693_100031268 3300005547 Bacteria 2916
84 Ga0068855_100637388 3300005563 Bacteria 1146
85 Ga0068855_100790065 3300005563 Bacteria 1010
86 Ga0070664_100539748 3300005564 Bacteria 1078
87 Ga0068857_100289423 3300005577 Bacteria 1508
88 Ga0068857_100485337 3300005577 Unclassified 1158
89 Ga0068856_100097222 3300005614 Bacteria 2933
90 Ga0068856_100305164 3300005614 Bacteria 1610
91 Ga0068856_100344906 3300005614 Bacteria 1508
92 Ga0068856_100899572 3300005614 Bacteria 904
93 Ga0070702_100054942 3300005615 Bacteria 2294
94 Ga0070702_100059120 3300005615 Unclassified 2223
95 Ga0068852_100103245 3300005616 Bacteria 2578
96 Ga0068864_100272068 3300005618 Unclassified 1579
97 Ga0068861_100509812 3300005719 Bacteria 1089
98 Ga0068870_10118214 3300005840 Bacteria 1523
99 Ga0068863_100218055 3300005841 Bacteria 1838
100 Ga0068858_101003048 3300005842 Bacteria 818
101 Ga0068860_100752838 3300005843 Unclassified 986
102 Ga0081455_10421551 3300005937 Bacteria 920
103 Ga0081538_10063513 3300005981 Bacteria 2096
104 Ga0081540_1002106 3300005983 Bacteria 16574
105 Ga0081539_10000639 3300005985 Bacteria 70847
106 Ga0070717_10001374 3300006028 Bacteria 16755
107 Ga0070717_10006435 3300006028 Bacteria 8639
108 Ga0070717_10272377 3300006028 Unclassified 1500
109 Ga0070715_10003125 3300006163 Bacteria 5202
110 Ga0070715_10034171 3300006163 Bacteria 2082
111 Ga0070716_100017636 3300006173 Bacteria 3705
112 Ga0070716_100123826 3300006173 Bacteria 1623
113 Ga0070716_100254056 3300006173 Bacteria 1199
114 Ga0070712_100183458 3300006175 Bacteria 1632
115 Ga0070712_100196679 3300006175 Bacteria 1581
116 Ga0070712_100608539 3300006175 Bacteria 925
117 Ga0068871_100057730 3300006358 Bacteria 3158
118 Ga0068871_100615959 3300006358 Bacteria 988
119 Ga0075428_100278008 3300006844 Unclassified 1801
120 Ga0075433_10254982 3300006852 Bacteria 1556
121 Ga0075434_100000658 3300006871 Bacteria 26789
122 Ga0075434_100201965 3300006871 Bacteria 2008
123 Ga0075434_100495472 3300006871 Unclassified 1243
124 Ga0075434_101112011 3300006871 Unclassified 803
125 Ga0075436_100160242 3300006914 Bacteria 1586
126 Ga0105240_10006035 3300009093 Bacteria 17912
127 Ga0105245_10143374 3300009098 Bacteria 2252
128 Ga0105245_10157227 3300009098 Bacteria 2154
129 Ga0114129_10855248 3300009147 Bacteria 1156
130 Ga0105243_10011056 3300009148 Bacteria 6828
131 Ga0105242_10587955 3300009176 Bacteria 1073
132 Ga0105248_10356780 3300009177 Bacteria 1646
133 Ga0105237_10016697 3300009545 Bacteria 7621
134 Ga0105238_10472575 3300009551 Bacteria 1252
135 Ga0105249_10322392 3300009553 Bacteria 1556
136 Ga0105249_10676973 3300009553 Bacteria 1090
137 Ga0105239_10124886 3300010375 Bacteria 2859
138 Ga0105246_10042597 3300011119 Bacteria 3075
139 Ga0105246_10182556 3300011119 Bacteria 1617
140 Ga0157373_10554331 3300013100 Bacteria 834
141 Ga0157370_10578297 3300013104 Bacteria 1029
142 Ga0157369_10029019 3300013105 Bacteria 6117
143 Ga0157369_10175518 3300013105 Bacteria 2256
144 Ga0157369_10217169 3300013105 Bacteria 2002
145 Ga0157369_10432501 3300013105 Bacteria 1364
146 Ga0157374_10021299 3300013296 Bacteria 5766
147 Ga0157378_10011683 3300013297 Bacteria 7685
148 Ga0157372_10225924 3300013307 Bacteria 2170
149 Ga0157372_10303640 3300013307 Bacteria 1857
150 Ga0157372_10946851 3300013307 Unclassified 998
151 Ga0157375_11134315 3300013308 Bacteria 916
152 Ga0157380_10627141 3300014326 Bacteria 1068
153 Ga0182008_10004855 3300014497 Bacteria 7768
154 Ga0182008_10066804 3300014497 Bacteria 1770
155 Ga0182008_10108297 3300014497 Unclassified 1376
156 Ga0157377_10069732 3300014745 Bacteria 2029
157 Ga0157379_10461722 3300014968 Bacteria 1174
158 Ga0157376_10001857 3300014969 Bacteria 14081
159 Ga0157376_10015637 3300014969 Bacteria 5738
160 Ga0157376_10095119 3300014969 Bacteria 2590
161 Ga0157376_11211206 3300014969 Bacteria 783
162 Ga0182006_1039198 3300015261 Bacteria 1871
163 Ga0182007_10013646 3300015262 Bacteria 3090
164 Ga0206356_11073177 3300020070 Bacteria 1845
165 Ga0206354_11313913 3300020081 Unclassified 975
166 Ga0206353_10203683 3300020082 Bacteria 8091
167 Ga0206353_10539657 3300020082 Bacteria 3187
168 Ga0207692_10005416 3300025898 Bacteria 5111
169 Ga0207692_10292983 3300025898 Unclassified 988
170 Ga0207685_10006844 3300025905 Unclassified 3136
171 Ga0207685_10009841 3300025905 Bacteria 2794
172 Ga0207699_10006819 3300025906 Bacteria 5555
173 Ga0207699_10131461 3300025906 Unclassified 1633
174 Ga0207643_10227739 3300025908 Bacteria 1143
175 Ga0207684_10215282 3300025910 Unclassified 1657
176 Ga0207684_10227393 3300025910 Bacteria 1610
177 Ga0207684_10275995 3300025910 Unclassified 1450
178 Ga0207654_10060369 3300025911 Bacteria 2215
179 Ga0207707_10002423 3300025912 Bacteria 16786
180 Ga0207707_10014128 3300025912 Bacteria 6957
181 Ga0207707_10049387 3300025912 Bacteria 3665
182 Ga0207707_10081162 3300025912 Bacteria 2831
183 Ga0207707_10102898 3300025912 Bacteria 2496
184 Ga0207707_10250095 3300025912 Bacteria 1540
185 Ga0207695_10419020 3300025913 Unclassified 1223
186 Ga0207671_10020140 3300025914 Bacteria 5084
187 Ga0207693_10000198 3300025915 Bacteria 54576
188 Ga0207693_10001236 3300025915 Bacteria 22780
189 Ga0207693_10081754 3300025915 Bacteria 2529
190 Ga0207693_10175060 3300025915 Bacteria 1689
191 Ga0207663_10008665 3300025916 Bacteria 5336
192 Ga0207663_10012556 3300025916 Bacteria 4583
193 Ga0207663_10138818 3300025916 Bacteria 1690
194 Ga0207660_10065950 3300025917 Bacteria 2618
195 Ga0207660_10094426 3300025917 Bacteria 2223
196 Ga0207660_10642047 3300025917 Unclassified 865
197 Ga0207657_10002416 3300025919 Bacteria 20175
198 Ga0207657_10002425 3300025919 Bacteria 20137
199 Ga0207657_10015657 3300025919 Bacteria 7335
200 Ga0207649_10260809 3300025920 Unclassified 1252
201 Ga0207652_10009209 3300025921 Bacteria 7947
202 Ga0207652_10028268 3300025921 Bacteria 4678
203 Ga0207652_10072944 3300025921 Bacteria 2985
204 Ga0207652_10095193 3300025921 Bacteria 2623
205 Ga0207652_10130543 3300025921 Bacteria 2241
206 Ga0207652_10293177 3300025921 Bacteria 1468
207 Ga0207646_10002942 3300025922 Bacteria 19740
208 Ga0207646_10005159 3300025922 Bacteria 13834
209 Ga0207646_10271622 3300025922 Unclassified 1532
210 Ga0207659_10204944 3300025926 Unclassified 1577
211 Ga0207687_10120342 3300025927 Bacteria 1962
212 Ga0207687_10166137 3300025927 Bacteria 1698
213 Ga0207700_10028147 3300025928 Bacteria 3946
214 Ga0207700_10228312 3300025928 Bacteria 1581
215 Ga0207700_10269414 3300025928 Unclassified 1461
216 Ga0207664_10012608 3300025929 Bacteria 6047
217 Ga0207664_10061000 3300025929 Bacteria 3007
218 Ga0207664_10175951 3300025929 Bacteria 1835
219 Ga0207664_10324610 3300025929 Bacteria 1358
220 Ga0207664_10727149 3300025929 Unclassified 893
221 Ga0207665_10001160 3300025939 Bacteria 17714
222 Ga0207665_10027836 3300025939 Bacteria 3734
223 Ga0207665_10376950 3300025939 Unclassified 1076
224 Ga0207711_10234488 3300025941 Bacteria 1681
225 Ga0207661_10024051 3300025944 Bacteria 4610
226 Ga0207661_10091258 3300025944 Bacteria 2538
227 Ga0207661_10115742 3300025944 Bacteria 2275
228 Ga0207679_10333907 3300025945 Unclassified 1316
229 Ga0207667_10668351 3300025949 Bacteria 1043
230 Ga0207667_10803499 3300025949 Bacteria 937
231 Ga0207712_10243391 3300025961 Bacteria 1450
232 Ga0207677_10173331 3300026023 Unclassified 1689
233 Ga0207677_10245920 3300026023 Bacteria 1450
234 Ga0207677_10422840 3300026023 Bacteria 1135
235 Ga0207677_10730514 3300026023 Bacteria 881
236 Ga0207678_10019548 3300026067 Bacteria 5952
237 Ga0207708_10045321 3300026075 Bacteria 3351
238 Ga0207641_10107033 3300026088 Bacteria 2473
239 Ga0207648_10618603 3300026089 Bacteria 999
240 Ga0207674_10232015 3300026116 Bacteria 1793
241 Ga0207675_100378271 3300026118 Bacteria 1392
242 Ga0207683_10000547 3300026121 Bacteria 34798
243 Ga0207683_10032295 3300026121 Bacteria 4548
244 Ga0207683_10170799 3300026121 Bacteria 1969
245 Ga0268264_10379114 3300028381 Unclassified 1354
246 Ga0265326_10008921 3300028558 Bacteria 3006
247 Ga0265319_1002712 3300028563 Bacteria 9500
248 Ga0265334_10002234 3300028573 Bacteria 9106
249 Ga0265318_10001544 3300028577 Bacteria 13404
250 Ga0265322_10006014 3300028654 Bacteria 3575
251 Ga0265338_10004407 3300028800 Bacteria 19038
252 Ga0265338_10008221 3300028800 Bacteria 12707
253 Ga0265338_10012815 3300028800 Bacteria 9531
254 Ga0265338_10055700 3300028800 Bacteria 3515
255 Ga0265330_10001866 3300031235 Bacteria 11734
256 Ga0265332_10003779 3300031238 Bacteria 7241
257 Ga0265328_10003180 3300031239 Bacteria 7291
258 Ga0265320_10007986 3300031240 Bacteria 6516
259 Ga0265325_10009499 3300031241 Bacteria 5672
260 Ga0265325_10023137 3300031241 Bacteria 3398
261 Ga0265329_10001035 3300031242 Bacteria 13840
262 Ga0265340_10004059 3300031247 Bacteria 8222
263 Ga0265339_10009114 3300031249 Bacteria 6268
264 Ga0265331_10008163 3300031250 Bacteria 5976
265 Ga0265327_10006990 3300031251 Bacteria 8851
266 Ga0265316_10010133 3300031344 Bacteria 8605
267 Ga0265316_10322399 3300031344 Bacteria 1122
268 Ga0265313_10005752 3300031595 Bacteria 9022
269 Ga0265314_10007362 3300031711 Bacteria 9556
270 Ga0265314_10102010 3300031711 Bacteria 1842
271 Ga0265342_10004699 3300031712 Bacteria 10632
272 Ga0307407_10200220 3300031903 Bacteria 1338
273 Ga0307409_100380942 3300031995 Bacteria 1341
274 Ga0307409_100440942 3300031995 Unclassified 1254
275 Ga0307409_100904595 3300031995 Archaea 896
276 Ga0307416_100020746 3300032002 Bacteria 4698
277 Ga0307416_100032934 3300032002 Bacteria 3923
278 Ga0307415_100022120 3300032126 Bacteria 3920
279 Ga0307415_100984643 3300032126 Bacteria 783
280 Ga0373950_0041180 3300034818 Unclassified 885
281 Ga0373952_0008766 3300035092 Unclassified 1924
282 Ga0373953_0307674 3300035117 Archaea 692
283 Ga0373931_0044670 3300035691 Bacteria 2337
284 Ga0373931_0114539 3300035691 Bacteria 1534
285 Ga0373931_0568724 3300035691 Bacteria 738
286 Ga0373927_0190470 3300035695 Bacteria 1346
287 Ga0373947_0007729 3300035725 Bacteria 6212
288 Ga0373947_0254543 3300035725 Bacteria 1162
289 Ga0373937_0002702 3300036401 Bacteria 14815
290 Ga0373937_0028480 3300036401 Bacteria 5055
291 Ga0373937_0295640 3300036401 Bacteria 1530
292 Ga0373925_0000887 3300037068 Bacteria 27335
293 Ga0395899_0006269 3300037312 Bacteria 9207
294 Ga0395899_0034792 3300037312 Bacteria 3784
295 Ga0395899_0103849 3300037312 Bacteria 2049
296 Ga0395900_0003567 3300037418 Bacteria 16738
297 Ga0395900_0008695 3300037418 Bacteria 10432
298 Ga0395900_0083645 3300037418 Unclassified 3278
299 Ga0395900_0091641 3300037418 Bacteria 3123
300 Ga0395900_0261897 3300037418 Bacteria 1726
301 Ga0395900_0598698 3300037418 Bacteria 1043
302 Ga0395898_0003871 3300037466 Bacteria 16535
303 Ga0395898_0006288 3300037466 Bacteria 12694
304 Ga0395898_0007490 3300037466 Bacteria 11594
305 Ga0395898_0009281 3300037466 Bacteria 10344
306 Ga0395898_0177994 3300037466 Bacteria 2032
307 Ga0395905_0007967 3300037471 Bacteria 10473
308 Ga0395905_0018017 3300037471 Bacteria 6705
309 Ga0395905_0055618 3300037471 Bacteria 3703
310 Ga0395905_0071096 3300037471 Bacteria 3262
311 Ga0395905_0148278 3300037471 Bacteria 2207
312 Ga0395905_0192381 3300037471 Unclassified 1913
313 Ga0395901_0009578 3300038443 Bacteria 9830
314 Ga0395901_0043951 3300038443 Bacteria 4633
315 Ga0395901_0052280 3300038443 Bacteria 4245
316 Ga0395901_0066955 3300038443 Bacteria 3740
317 Ga0395901_0078551 3300038443 Bacteria 3446
318 Ga0395901_0278186 3300038443 Bacteria 1739
319 Ga0395901_0332770 3300038443 Unclassified 1570
320 Ga0395901_0667205 3300038443 Unclassified 1041
321 Ga0395901_0678461 3300038443 Unclassified 1030
322 Ga0395901_1208199 3300038443 Unclassified 722
323 Ga0436360_0147319 3300039438 Unclassified 1744
324 Ga0439465_0140391 3300041413 Bacteria 858
325 Ga0439445_0047446 3300042004 Bacteria 1154
326 Ga0439448_0000767 3300042005 Bacteria 7801
327 Ga0439455_0004717 3300042012 Bacteria 2719
328 Ga0439446_0020120 3300042156 Unclassified 1878
329 Ga0466969_0025650 3300044656 Bacteria 3029
330 Ga0466969_0073259 3300044656 Unclassified 1644
331 Ga0466972_0030506 3300044658 Bacteria 2653
332 Ga0466965_0033614 3300044683 Bacteria 2507
333 Ga0466965_0068964 3300044683 Unclassified 1776
334 Ga0466966_0001983 3300044684 Bacteria 13266
335 Ga0466966_0284296 3300044684 Bacteria 995
336 Ga0466961_0005297 3300044693 Bacteria 8116
337 Ga0466961_0056955 3300044693 Bacteria 2489
338 Ga0466961_0094880 3300044693 Unclassified 1882
339 Ga0466961_0167980 3300044693 Bacteria 1365
340 Ga0466961_0217040 3300044693 Bacteria 1179
341 Ga0466961_0538827 3300044693 Unclassified 703
342 Ga0466963_0000263 3300044694 Bacteria 23137
343 Ga0466963_0000765 3300044694 Bacteria 15911
344 Ga0466963_0006931 3300044694 Bacteria 6742
345 Ga0466963_0007646 3300044694 Bacteria 6453
346 Ga0466963_0008632 3300044694 Bacteria 6115
347 Ga0466963_0010452 3300044694 Bacteria 5618
348 Ga0466963_0020715 3300044694 Bacteria 4138
349 Ga0466963_0030651 3300044694 Bacteria 3472
350 Ga0466963_0032571 3300044694 Bacteria 3377
351 Ga0466963_0041587 3300044694 Bacteria 3015
352 Ga0466963_0095998 3300044694 Unclassified 2024
353 Ga0466963_0134588 3300044694 Unclassified 1709
354 Ga0466963_0343285 3300044694 Bacteria 1051
355 Ga0466964_0006723 3300044706 Bacteria 4286
356 Ga0466964_0015615 3300044706 Bacteria 2891
357 Ga0466964_0034626 3300044706 Unclassified 2016
358 Ga0466964_0045312 3300044706 Unclassified 1790
359 Ga0466971_0076149 3300044719 Bacteria 1526
360 Ga0466971_0147939 3300044719 Bacteria 1096
361 Ga0466968_0003004 3300044735 Bacteria 6234
362 Ga0466968_0005657 3300044735 Bacteria 4682
363 Ga0466968_0034121 3300044735 Bacteria 2122
364 Ga0466968_0041944 3300044735 Bacteria 1933
365 Ga0466968_0246605 3300044735 Bacteria 847
366 Ga0466970_0026018 3300044765 Bacteria 3066
367 Ga0466957_0010565 3300044842 Bacteria 5305
368 Ga0466957_0016733 3300044842 Bacteria 4290
369 Ga0466957_0034159 3300044842 Bacteria 3051
370 Ga0466957_0045872 3300044842 Bacteria 2651
371 Ga0466957_0060222 3300044842 Unclassified 2328
372 Ga0466957_0166841 3300044842 Bacteria 1432
373 Ga0466957_0190359 3300044842 Bacteria 1344
374 Ga0466960_0198271 3300044901 Bacteria 1095
375 Ga0466960_0214465 3300044901 Bacteria 1057
376 Ga0466960_0559974 3300044901 Unclassified 675
377 Ga0466959_0001526 3300045049 Bacteria 14224
378 Ga0466959_0008342 3300045049 Bacteria 7320
379 Ga0466959_0043115 3300045049 Bacteria 3327
380 Ga0466959_0402916 3300045049 Unclassified 930
381 Ga0466958_0004302 3300045836 Bacteria 7500
382 Ga0466958_0030007 3300045836 Bacteria 3226
383 Ga0466958_0035418 3300045836 Bacteria 2982
384 Ga0466958_0070974 3300045836 Bacteria 2132
385 Ga0466958_0128753 3300045836 Bacteria 1588
386 Ga0466958_0336099 3300045836 Bacteria 971
387 Ga0466958_0414182 3300045836 Unclassified 871
388 Ga0466967_0004788 3300045976 Bacteria 9217
389 Ga0466967_0005119 3300045976 Bacteria 9010
390 Ga0466967_0018144 3300045976 Bacteria 5614
391 Ga0466967_0021993 3300045976 Bacteria 5193
392 Ga0466967_0024946 3300045976 Bacteria 4923
393 Ga0466967_0025022 3300045976 Bacteria 4916
394 Ga0466967_0027167 3300045976 Bacteria 4757
395 Ga0466967_0035234 3300045976 Bacteria 4258
396 Ga0466967_0035398 3300045976 Bacteria 4250
397 Ga0466967_0055424 3300045976 Bacteria 3491
398 Ga0466967_0056092 3300045976 Bacteria 3472
399 Ga0466967_0060645 3300045976 Bacteria 3353
400 Ga0466967_0068277 3300045976 Bacteria 3174
401 Ga0466967_0074603 3300045976 Unclassified 3047
402 Ga0466967_0096649 3300045976 Bacteria 2694
403 Ga0466967_0121175 3300045976 Bacteria 2417
404 Ga0466967_0137560 3300045976 Unclassified 2272
405 Ga0466967_0148017 3300045976 Bacteria 2192
406 Ga0466967_0176206 3300045976 Unclassified 2014
407 Ga0466967_0180674 3300045976 Bacteria 1990
408 Ga0466967_0298323 3300045976 Unclassified 1550
409 Ga0466967_0567874 3300045976 Bacteria 1117
410 Ga0495592_0000708 3300046454 Bacteria 23320
411 Ga0495592_0076909 3300046454 Bacteria 2421
412 Ga0495629_0062362 3300046459 Bacteria 2604
413 Ga0495641_0002032 3300046461 Bacteria 16400
414 Ga0495641_0026466 3300046461 Bacteria 2830
415 Ga0495641_0155397 3300046461 Unclassified 1023
416 Ga0495641_0157838 3300046461 Bacteria 1014
417 Ga0495641_0333225 3300046461 Bacteria 685
418 Ga0495651_0000885 3300046462 Bacteria 23327
419 Ga0495651_0074101 3300046462 Bacteria 2583
420 Ga0495653_0001808 3300046463 Bacteria 16847
421 Ga0495653_0070043 3300046463 Bacteria 2626
422 Ga0495653_0092604 3300046463 Bacteria 2206
423 Ga0495653_0235802 3300046463 Unclassified 1222
424 Ga0495653_0448898 3300046463 Bacteria 811
425 Ga0495582_0003738 3300046473 Bacteria 8575
426 Ga0495605_0135524 3300046474 Unclassified 1107
427 Ga0495639_0000458 3300046475 Bacteria 19373
428 Ga0495662_0000722 3300046476 Bacteria 15787
429 Ga0495662_0189357 3300046476 Bacteria 1014
430 Ga0495664_0375146 3300046477 Bacteria 855
431 Ga0495584_0222678 3300046491 Unclassified 959
432 Ga0495596_0017276 3300046500 Bacteria 2991
433 Ga0495596_0058064 3300046500 Bacteria 1509
434 Ga0495607_0149108 3300046501 Bacteria 1199
435 Ga0495607_0251348 3300046501 Bacteria 851
436 Ga0495608_0002754 3300046511 Bacteria 12632
437 Ga0495608_0014276 3300046511 Bacteria 5511
438 Ga0495608_0158698 3300046511 Unclassified 1439
439 Ga0495618_0025634 3300046514 Bacteria 3660
440 Ga0495618_0192554 3300046514 Bacteria 1292
441 Ga0495628_0001243 3300046516 Bacteria 23312
442 Ga0495628_0047594 3300046516 Bacteria 3401
443 Ga0495630_0001392 3300046517 Bacteria 16705
444 Ga0495630_0073121 3300046517 Unclassified 2581
445 Ga0495630_0402012 3300046517 Bacteria 1049
446 Ga0495631_0131856 3300046518 Unclassified 1074
447 Ga0495666_0000065 3300046526 Bacteria 40921
448 Ga0495642_0052294 3300046528 Bacteria 1682
449 Ga0495652_0003720 3300046529 Bacteria 14931
450 Ga0495652_0051952 3300046529 Bacteria 3497
451 Ga0495652_0156929 3300046529 Bacteria 1771
452 Ga0495652_0230813 3300046529 Bacteria 1384
453 Ga0495665_0006872 3300046531 Bacteria 6140
454 Ga0495640_0002040 3300046533 Bacteria 16099
455 Ga0495640_0153750 3300046533 Bacteria 1477
456 Ga0495640_0334548 3300046533 Bacteria 936
457 Ga0495586_0028621 3300046535 Unclassified 2981
458 Ga0495586_0033020 3300046535 Bacteria 2776
459 Ga0495587_0000675 3300046536 Bacteria 22859
460 Ga0495587_0080742 3300046536 Unclassified 1884
461 Ga0495587_0124913 3300046536 Bacteria 1473
462 Ga0495587_0222156 3300046536 Bacteria 1065
463 Ga0495609_0077826 3300046538 Bacteria 1452
464 Ga0495645_0000684 3300046543 Bacteria 23313
465 Ga0495667_0040047 3300046559 Bacteria 3113
466 Ga0495667_0083909 3300046559 Bacteria 2069
467 Ga0495667_0166773 3300046559 Unclassified 1416
468 Ga0495656_0188933 3300046615 Unclassified 1016
469 Ga0495634_0015172 3300046642 Bacteria 5539
470 Ga0495634_0052284 3300046642 Unclassified 2738
471 Ga0495634_0083509 3300046642 Bacteria 2084
472 Ga0495635_0004316 3300046663 Bacteria 9843
473 Ga0495635_0053968 3300046663 Bacteria 2768
474 Ga0495661_0120468 3300046665 Bacteria 1450
475 Ga0495588_0289643 3300046674 Bacteria 863
476 Ga0495657_0019820 3300046675 Bacteria 4849
477 Ga0495657_0126959 3300046675 Bacteria 1601
478 Ga0495657_0402418 3300046675 Bacteria 805
479 Ga0495599_0000455 3300046678 Bacteria 23331
480 Ga0495599_0009532 3300046678 Bacteria 5937
481 Ga0495599_0221946 3300046678 Bacteria 1156
482 Ga0495599_0331447 3300046678 Unclassified 915
483 Ga0495623_0001619 3300046679 Bacteria 15128
484 Ga0495623_0335254 3300046679 Unclassified 827
485 Ga0495646_0010255 3300046680 Bacteria 5959
486 Ga0495646_0088612 3300046680 Unclassified 1792
487 Ga0495646_0140123 3300046680 Bacteria 1353
488 Ga0495646_0195360 3300046680 Bacteria 1104
489 Ga0495647_0000075 3300046681 Bacteria 23932
490 Ga0495647_0030715 3300046681 Bacteria 1995
491 Ga0495647_0117602 3300046681 Unclassified 1115
492 Ga0495658_0000743 3300046683 Bacteria 17574
493 Ga0495613_0051507 3300046689 Bacteria 3033
494 Ga0495613_0532529 3300046689 Bacteria 788
495 Ga0495624_0011560 3300046690 Bacteria 6064
496 Ga0495624_0120210 3300046690 Bacteria 1613
497 Ga0495600_0159910 3300046809 Bacteria 1456
498 Ga0495600_0270596 3300046809 Unclassified 1078
499 Ga0495581_0001695 3300047315 Bacteria 12267
500 Ga0495604_0001028 3300047317 Bacteria 23261
501 Ga0495604_0374527 3300047317 Bacteria 942
502 Ga0495674_0064942 3300047319 Bacteria 3171
503 Ga0495674_0110524 3300047319 Bacteria 2330
504 Ga0495674_0145359 3300047319 Unclassified 1991
505 Ga0495674_0379315 3300047319 Unclassified 1144
506 Ga0495676_0004569 3300047321 Bacteria 12665
507 Ga0495676_0160040 3300047321 Unclassified 1594
508 Ga0495676_0390288 3300047321 Bacteria 925
509 Ga0495680_0001991 3300047322 Bacteria 21455
510 Ga0495680_0028290 3300047322 Bacteria 4597
511 Ga0495680_0029511 3300047322 Bacteria 4491
512 Ga0495680_0119293 3300047322 Bacteria 1949
513 Ga0495680_0358606 3300047322 Unclassified 1014
514 Ga0495675_0000592 3300047444 Bacteria 23327
515 Ga0495677_0073977 3300047445 Unclassified 1272
516 Ga0495684_0016402 3300047471 Bacteria 5704
517 Ga0495684_0018772 3300047471 Bacteria 5328
518 Ga0495684_0061136 3300047471 Bacteria 2866
519 Ga0495684_0070941 3300047471 Unclassified 2647
520 Ga0495684_0194867 3300047471 Unclassified 1496
521 Ga0495593_0012606 3300047673 Bacteria 4827
522 Ga0495593_0110807 3300047673 Bacteria 1402
523 Ga0495602_0001484 3300048088 Bacteria 23328
524 Ga0495602_0261104 3300048088 Bacteria 1285
525 Ga0495614_0003232 3300048089 Bacteria 7277
526 Ga0496100_0022631 3300048903 Bacteria 3804
527 Ga0496100_0024315 3300048903 Bacteria 3695
528 Ga0496100_0088889 3300048903 Unclassified 2103
529 Ga0496100_0152508 3300048903 Unclassified 1649
530 Ga0496100_0209177 3300048903 Bacteria 1426
531 Ga0496100_0735781 3300048903 Unclassified 771
532 Ga0496101_0087196 3300048904 Bacteria 2316
533 Ga0496101_0199711 3300048904 Bacteria 1545
534 Ga0496101_0285969 3300048904 Bacteria 1289
535 Ga0496102_0019852 3300048905 Bacteria 5925
536 Ga0496102_0028957 3300048905 Bacteria 4951
537 Ga0496102_0053477 3300048905 Bacteria 3680
538 Ga0496102_0276797 3300048905 Unclassified 1582
539 Ga0496102_0312205 3300048905 Bacteria 1482
540 Ga0496102_0769070 3300048905 Bacteria 886
541 Ga0496102_0865912 3300048905 Unclassified 825
542 Ga0496103_0009819 3300048906 Bacteria 5668
543 Ga0496103_0020360 3300048906 Bacteria 3984
544 Ga0496103_0224071 3300048906 Bacteria 1209
545 Ga0496104_0002589 3300048907 Bacteria 15603
546 Ga0496104_0056729 3300048907 Bacteria 3705
547 Ga0496104_0173940 3300048907 Bacteria 2064
548 Ga0496104_0591932 3300048907 Bacteria 1019
549 Ga0496104_0730574 3300048907 Unclassified 897
550 Ga0496105_0001826 3300048908 Bacteria 15246
551 Ga0496105_0005511 3300048908 Bacteria 9604
552 Ga0496105_0103670 3300048908 Bacteria 2349
553 Ga0496105_0104050 3300048908 Bacteria 2344
554 Ga0496105_0121950 3300048908 Bacteria 2149
555 Ga0496105_0208068 3300048908 Bacteria 1595
556 Ga0496105_0583420 3300048908 Bacteria 869
557 Ga0496106_0003519 3300048909 Bacteria 11674
558 Ga0496106_0003660 3300048909 Bacteria 11460
559 Ga0496106_0250705 3300048909 Unclassified 1415
560 Ga0496106_0373975 3300048909 Bacteria 1145
561 Ga0496107_0002817 3300048910 Bacteria 11468
562 Ga0496107_0004074 3300048910 Bacteria 9841
563 Ga0496107_0107162 3300048910 Bacteria 2053
564 Ga0496107_0153992 3300048910 Unclassified 1701
565 Ga0496107_0252564 3300048910 Bacteria 1312
566 Ga0496108_0004163 3300048911 Bacteria 11639
567 Ga0496108_0133656 3300048911 Bacteria 2133
568 Ga0496108_0368889 3300048911 Bacteria 1253
569 Ga0496108_0636831 3300048911 Bacteria 927
570 Ga0496109_0004035 3300048912 Bacteria 12262
571 Ga0496109_0006873 3300048912 Bacteria 9593
572 Ga0496109_0014997 3300048912 Bacteria 6744
573 Ga0496109_0085652 3300048912 Bacteria 2909
574 Ga0496109_0650066 3300048912 Bacteria 991
575 Ga0496110_0024591 3300048913 Bacteria 5135
576 Ga0496110_0026080 3300048913 Bacteria 4997
577 Ga0496110_0061381 3300048913 Bacteria 3317
578 Ga0496110_0115182 3300048913 Bacteria 2419
579 Ga0496110_0185922 3300048913 Bacteria 1887
580 Ga0496110_0445428 3300048913 Bacteria 1180
581 Ga0496111_0001138 3300048914 Bacteria 14761
582 Ga0496111_0049169 3300048914 Bacteria 3040
583 Ga0496111_0099089 3300048914 Bacteria 2140
584 Ga0496111_0165951 3300048914 Bacteria 1640
585 Ga0496111_0231720 3300048914 Bacteria 1372
586 Ga0496112_0001992 3300048915 Bacteria 16159
587 Ga0496112_0025481 3300048915 Bacteria 5679
588 Ga0496112_0026491 3300048915 Bacteria 5579
589 Ga0496112_0087411 3300048915 Bacteria 3084
590 Ga0496112_0110808 3300048915 Bacteria 2715
591 Ga0496112_0170002 3300048915 Bacteria 2145
592 Ga0496112_0213176 3300048915 Bacteria 1888
593 Ga0496112_0213293 3300048915 Bacteria 1887
594 Ga0496112_0340412 3300048915 Bacteria 1443
595 Ga0496112_0384416 3300048915 Unclassified 1344
596 Ga0496113_0041106 3300048916 Bacteria 3409
597 Ga0496113_0175154 3300048916 Bacteria 1700
598 Ga0496113_0200944 3300048916 Bacteria 1584
599 Ga0496113_0300468 3300048916 Bacteria 1285
600 Ga0496113_0728766 3300048916 Unclassified 790
601 Ga0496114_0044347 3300048917 Bacteria 3689
602 Ga0496114_0170883 3300048917 Bacteria 1894
603 Ga0496114_0239110 3300048917 Bacteria 1597
604 Ga0496114_0320919 3300048917 Bacteria 1368
605 Ga0496115_0009633 3300048918 Bacteria 7188
606 Ga0496115_0057971 3300048918 Unclassified 3115
607 Ga0496115_0162757 3300048918 Bacteria 1844
608 Ga0496115_0477194 3300048918 Bacteria 1005
609 Ga0501031_0002877 3300049568 Bacteria 11003
610 Ga0501034_0390720 3300049571 Unclassified 1315
611 Ga0501036_0010229 3300049572 Bacteria 7736
612 Ga0501036_0014420 3300049572 Bacteria 6582
613 Ga0501037_0026419 3300049573 Bacteria 4292
614 Ga0501038_0111645 3300049574 Unclassified 2264
615 Ga0501039_0034537 3300049575 Bacteria 3902
616 Ga0501041_0006676 3300049577 Bacteria 6760
617 Ga0501042_0004105 3300049578 Bacteria 9248
618 Ga0501042_0143077 3300049578 Unclassified 1724
619 Ga0501042_0496285 3300049578 Bacteria 886
620 Ga0501046_0005156 3300049580 Bacteria 11712
621 Ga0501046_0351763 3300049580 Bacteria 1070
622 Ga0501046_0794110 3300049580 Unclassified 663
623 Ga0501047_0101229 3300049581 Bacteria 2761
624 Ga0501048_0007923 3300049582 Bacteria 8046
625 Ga0501067_0016770 3300049583 Bacteria 4048
626 Ga0501067_0017090 3300049583 Bacteria 4008
627 Ga0501067_0017101 3300049583 Bacteria 4007
628 Ga0501067_0037764 3300049583 Bacteria 2682
629 Ga0501067_0097891 3300049583 Unclassified 1629
630 Ga0501068_0571595 3300049584 Bacteria 736
631 Ga0501069_0028072 3300049585 Unclassified 3085
632 Ga0501069_0038618 3300049585 Bacteria 2636
633 Ga0501069_0104223 3300049585 Unclassified 1612
634 Ga0501069_0460756 3300049585 Unclassified 756
635 Ga0501070_0007274 3300049586 Bacteria 9398
636 Ga0501070_0018543 3300049586 Bacteria 5838
637 Ga0501070_0191466 3300049586 Unclassified 1681
638 Ga0501070_0431002 3300049586 Unclassified 1064
639 Ga0501070_0695794 3300049586 Bacteria 804
640 Ga0501071_0005995 3300049587 Bacteria 7874
641 Ga0501071_0036160 3300049587 Bacteria 3521
642 Ga0501071_0071004 3300049587 Bacteria 2538
643 Ga0501072_0001083 3300049588 Bacteria 20212
644 Ga0501072_0028816 3300049588 Bacteria 4334
645 Ga0501072_0037987 3300049588 Bacteria 3778
646 Ga0501073_0168460 3300049589 Bacteria 1516
647 Ga0501074_0008072 3300049590 Bacteria 7625
648 Ga0501074_0024304 3300049590 Bacteria 4404
649 Ga0501074_0042636 3300049590 Bacteria 3283
650 Ga0501074_0474183 3300049590 Unclassified 887
651 Ga0501075_0005192 3300049591 Bacteria 8908
652 Ga0501075_0010412 3300049591 Bacteria 6535
653 Ga0501076_0008422 3300049592 Bacteria 7556
654 Ga0501076_0702517 3300049592 Bacteria 835
655 Ga0501076_0863811 3300049592 Unclassified 746
656 Ga0501077_0002003 3300049593 Bacteria 12295
657 Ga0501077_0003802 3300049593 Bacteria 9091
658 Ga0501079_0104413 3300049741 Unclassified 2198
659 Ga0501079_0270032 3300049741 Bacteria 1329
660 Ga0501080_0029157 3300049742 Bacteria 5137
661 Ga0501080_0257994 3300049742 Bacteria 1588
662 Ga0501083_0000145 3300049744 Bacteria 48483
663 Ga0501045_0002722 3300049824 Bacteria 12064
664 Ga0501045_0110199 3300049824 Unclassified 2041
665 nmdc:mga05p37_175983_c1 3300050507 Unclassified 2607
666 nmdc:mga0n895_3054_c1 3300050512 Bacteria 13313
667 nmdc:mga0n895_80505_c1 3300050512 Bacteria 3245
668 nmdc:mga0n895_863256_c1 3300050512 Bacteria 892
669 nmdc:mga0rr50_143437_c1 3300050513 Bacteria 1923
670 nmdc:mga08x19_233683_c1 3300050514 Bacteria 1266
671 nmdc:mga0a205_253981_c1 3300050515 Bacteria 1637
672 Ga0495601_0002343 3300053077 Bacteria 10719
673 Ga0495601_0006404 3300053077 Bacteria 6884
674 Ga0495601_0027298 3300053077 Bacteria 3529
675 Ga0495601_0058761 3300053077 Bacteria 2437
676 Ga0495601_0089197 3300053077 Bacteria 1983
677 Ga0495601_0094326 3300053077 Bacteria 1928
678 Ga0495601_0174094 3300053077 Bacteria 1407
679 Ga0495601_0227559 3300053077 Unclassified 1218
680 Ga0495612_0049796 3300053078 Bacteria 1719
681 Ga0495612_0113733 3300053078 Bacteria 1160
682 Ga0495612_0114922 3300053078 Unclassified 1155
683 Ga0495595_0003477 3300053084 Bacteria 6255
684 Ga0495595_0011315 3300053084 Bacteria 3726
685 Ga0495619_0007501 3300053085 Bacteria 6908
686 Ga0495619_0010159 3300053085 Bacteria 5929
687 Ga0495619_0027368 3300053085 Bacteria 3671
688 Ga0495619_0030547 3300053085 Bacteria 3488
689 Ga0501084_0097305 3300054114 Bacteria 2471
690 Ga0590075_033560 3300059424 Bacteria 1303
691 Ga0501082_0004794 3300060353 Bacteria 11797
692 Ga0501082_0040567 3300060353 Bacteria 4015
693 Ga0501082_0286303 3300060353 Unclassified 1434
694 Ga0466962_0008496 3300061719 Bacteria 4920
695 Ga0466962_0153248 3300061719 Bacteria 1118
696 Ga0466962_0166601 3300061719 Bacteria 1072
697 Ga0530510_0002901 3300061734 Bacteria 11755
698 Ga0530510_0064610 3300061734 Unclassified 2650
699 Ga0530510_0101356 3300061734 Bacteria 2105
700 Ga0495630_0450067
701 Ga0070680_100045841
702 Ga0070680_100470762
703 Ga0070682_100026704
704 Ga0070682_100027607
705 Ga0070682_100505915
706 Ga0068868_100042341
707 Ga0070660_100002731
708 Ga0070689_100010547
709 Ga0070661_100050544
710 Ga0070661_100498891
711 Ga0070668_100010845
712 Ga0070675_100047064
713 Ga0070671_100089760
714 Ga0070673_100070100
715 Ga0070659_100086305
716 Ga0070659_100119919
717 Ga0070659_100578949
718 Ga0070709_10014800
719 Ga0070709_10181123
720 Ga0070714_100021674
721 Ga0070714_100030456
722 Ga0070714_100046425
723 Ga0070714_100096481
724 Ga0070714_100531628
725 Ga0070713_100037211
726 Ga0070713_100121662
727 Ga0070713_100367502
728 Ga0070713_100376567
729 Ga0070710_10006176
730 Ga0070710_10006205
731 Ga0070710_10020745
732 Ga0070711_100051181
733 Ga0070711_100071032
734 Ga0070711_100151947
735 Ga0070705_100033210
736 Ga0070705_100129862
737 Ga0070700_100061729
738 Ga0070708_100283504
739 Ga0070663_100011892
740 Ga0070678_100456954
741 Ga0070678_100910156
742 Ga0070681_10003387
743 Ga0070681_10048080
744 Ga0070681_10062785
745 Ga0070681_10070828
746 Ga0070681_10119792
747 Ga0070681_10659722
748 Ga0070681_10766387
749 Ga0070685_10009736
750 Ga0070685_10296743
751 Ga0070706_100316161
752 Ga0070706_100322262
753 Ga0070706_101164168
754 Ga0070707_100001723
755 Ga0070707_100012654
756 Ga0070707_100045223
757 Ga0070707_100158474
758 Ga0070707_100179480
759 Ga0070698_100011547
760 Ga0070699_100929373
761 Ga0070679_100036609
762 Ga0070679_100101496
763 Ga0070679_100118527
764 Ga0070679_100163272
765 Ga0070679_100205717
766 Ga0070679_100211335
767 Ga0070679_100339736
768 Ga0070684_100085923
769 Ga0070684_100260621
770 Ga0070684_100273849
771 Ga0070684_100429133
772 Ga0070684_100564210
773 Ga0070697_100289493
774 Ga0070697_100372098
775 Ga0068853_100022608
776 Ga0070686_100053614
777 Ga0070695_100000510
778 Ga0070696_100098604
779 Ga0070696_100165315
780 Ga0070696_100357354
781 Ga0070693_100015557
782 Ga0070693_100031268
783 Ga0068855_100637388
784 Ga0068855_100790065
785 Ga0070664_100539748
786 Ga0068857_100289423
787 Ga0068857_100485337
788 Ga0068856_100097222
789 Ga0068856_100305164
790 Ga0068856_100344906
791 Ga0068856_100899572
792 Ga0070702_100054942
793 Ga0070702_100059120
794 Ga0068852_100103245
795 Ga0068864_100272068
796 Ga0068861_100509812
797 Ga0068870_10118214
798 Ga0068863_100218055
799 Ga0068858_101003048
800 Ga0068860_100752838
801 Ga0081455_10421551
802 Ga0081538_10063513
803 Ga0081540_1002106
804 Ga0081539_10000639
805 Ga0070717_10001374
806 Ga0070717_10006435
807 Ga0070717_10272377
808 Ga0070715_10003125
809 Ga0070715_10034171
810 Ga0070716_100017636
811 Ga0070716_100123826
812 Ga0070716_100254056
813 Ga0070712_100183458
814 Ga0070712_100196679
815 Ga0070712_100608539
816 Ga0068871_100057730
817 Ga0068871_100615959
818 Ga0075428_100278008
819 Ga0075433_10254982
820 Ga0075434_100000658
821 Ga0075434_100201965
822 Ga0075434_100495472
823 Ga0075434_101112011
824 Ga0075436_100160242
825 Ga0105240_10006035
826 Ga0105245_10143374
827 Ga0105245_10157227
828 Ga0114129_10855248
829 Ga0105243_10011056
830 Ga0105242_10587955
831 Ga0105248_10356780
832 Ga0105237_10016697
833 Ga0105238_10472575
834 Ga0105249_10322392
835 Ga0105249_10676973
836 Ga0105239_10124886
837 Ga0105246_10042597
838 Ga0105246_10182556
839 Ga0157373_10554331
840 Ga0157370_10578297
841 Ga0157369_10029019
842 Ga0157369_10175518
843 Ga0157369_10217169
844 Ga0157369_10432501
845 Ga0157374_10021299
846 Ga0157378_10011683
847 Ga0157372_10225924
848 Ga0157372_10303640
849 Ga0157372_10946851
850 Ga0157375_11134315
851 Ga0157380_10627141
852 Ga0182008_10004855
853 Ga0182008_10066804
854 Ga0182008_10108297
855 Ga0157377_10069732
856 Ga0157379_10461722
857 Ga0157376_10001857
858 Ga0157376_10015637
859 Ga0157376_10095119
860 Ga0157376_11211206
861 Ga0182006_1039198
862 Ga0182007_10013646
863 Ga0206356_11073177
864 Ga0206354_11313913
865 Ga0206353_10203683
866 Ga0206353_10539657
867 Ga0207692_10005416
868 Ga0207692_10292983
869 Ga0207685_10006844
870 Ga0207685_10009841
871 Ga0207699_10006819
872 Ga0207699_10131461
873 Ga0207643_10227739
874 Ga0207684_10215282
875 Ga0207684_10227393
876 Ga0207684_10275995
877 Ga0207654_10060369
878 Ga0207707_10002423
879 Ga0207707_10014128
880 Ga0207707_10049387
881 Ga0207707_10081162
882 Ga0207707_10102898
883 Ga0207707_10250095
884 Ga0207695_10419020
885 Ga0207671_10020140
886 Ga0207693_10000198
887 Ga0207693_10001236
888 Ga0207693_10081754
889 Ga0207693_10175060
890 Ga0207663_10008665
891 Ga0207663_10012556
892 Ga0207663_10138818
893 Ga0207660_10065950
894 Ga0207660_10094426
895 Ga0207660_10642047
896 Ga0207657_10002416
897 Ga0207657_10002425
898 Ga0207657_10015657
899 Ga0207649_10260809
900 Ga0207652_10009209
901 Ga0207652_10028268
902 Ga0207652_10072944
903 Ga0207652_10095193
904 Ga0207652_10130543
905 Ga0207652_10293177
906 Ga0207646_10002942
907 Ga0207646_10005159
908 Ga0207646_10271622
909 Ga0207659_10204944
910 Ga0207687_10120342
911 Ga0207687_10166137
912 Ga0207700_10028147
913 Ga0207700_10228312
914 Ga0207700_10269414
915 Ga0207664_10012608
916 Ga0207664_10061000
917 Ga0207664_10175951
918 Ga0207664_10324610
919 Ga0207664_10727149
920 Ga0207665_10001160
921 Ga0207665_10027836
922 Ga0207665_10376950
923 Ga0207711_10234488
924 Ga0207661_10024051
925 Ga0207661_10091258
926 Ga0207661_10115742
927 Ga0207679_10333907
928 Ga0207667_10668351
929 Ga0207667_10803499
930 Ga0207712_10243391
931 Ga0207677_10173331
932 Ga0207677_10245920
933 Ga0207677_10422840
934 Ga0207677_10730514
935 Ga0207678_10019548
936 Ga0207708_10045321
937 Ga0207641_10107033
938 Ga0207648_10618603
939 Ga0207674_10232015
940 Ga0207675_100378271
941 Ga0207683_10000547
942 Ga0207683_10032295
943 Ga0207683_10170799
944 Ga0268264_10379114
945 Ga0265326_10008921
946 Ga0265319_1002712
947 Ga0265334_10002234
948 Ga0265318_10001544
949 Ga0265322_10006014
950 Ga0265338_10004407
951 Ga0265338_10008221
952 Ga0265338_10012815
953 Ga0265338_10055700
954 Ga0265330_10001866
955 Ga0265332_10003779
956 Ga0265328_10003180
957 Ga0265320_10007986
958 Ga0265325_10009499
959 Ga0265325_10023137
960 Ga0265329_10001035
961 Ga0265340_10004059
962 Ga0265339_10009114
963 Ga0265331_10008163
964 Ga0265327_10006990
965 Ga0265316_10010133
966 Ga0265316_10322399
967 Ga0265313_10005752
968 Ga0265314_10007362
969 Ga0265314_10102010
970 Ga0265342_10004699
971 Ga0307407_10200220
972 Ga0307409_100380942
973 Ga0307409_100440942
974 Ga0307409_100904595
975 Ga0307416_100020746
976 Ga0307416_100032934
977 Ga0307415_100022120
978 Ga0307415_100984643
979 Ga0373950_0041180
980 Ga0373952_0008766
981 Ga0373953_0307674
982 Ga0373931_0044670
983 Ga0373931_0114539
984 Ga0373931_0568724
985 Ga0373927_0190470
986 Ga0373947_0007729
987 Ga0373947_0254543
988 Ga0373937_0002702
989 Ga0373937_0028480
990 Ga0373937_0295640
991 Ga0373925_0000887
992 Ga0395899_0006269
993 Ga0395899_0034792
994 Ga0395899_0103849
995 Ga0395900_0003567
996 Ga0395900_0008695
997 Ga0395900_0083645
998 Ga0395900_0091641
999 Ga0395900_0261897
1000 Ga0395900_0598698
1001 Ga0395898_0003871
1002 Ga0395898_0006288
1003 Ga0395898_0007490
1004 Ga0395898_0009281
1005 Ga0395898_0177994
1006 Ga0395905_0007967
1007 Ga0395905_0018017
1008 Ga0395905_0055618
1009 Ga0395905_0071096
1010 Ga0395905_0148278
1011 Ga0395905_0192381
1012 Ga0395901_0009578
1013 Ga0395901_0043951
1014 Ga0395901_0052280
1015 Ga0395901_0066955
1016 Ga0395901_0078551
1017 Ga0395901_0278186
1018 Ga0395901_0332770
1019 Ga0395901_0667205
1020 Ga0395901_0678461
1021 Ga0395901_1208199
1022 Ga0436360_0147319
1023 Ga0439465_0140391
1024 Ga0439445_0047446
1025 Ga0439448_0000767
1026 Ga0439455_0004717
1027 Ga0439446_0020120
1028 Ga0466969_0025650
1029 Ga0466969_0073259
1030 Ga0466972_0030506
1031 Ga0466965_0033614
1032 Ga0466965_0068964
1033 Ga0466966_0001983
1034 Ga0466966_0284296
1035 Ga0466961_0005297
1036 Ga0466961_0056955
1037 Ga0466961_0094880
1038 Ga0466961_0167980
1039 Ga0466961_0217040
1040 Ga0466961_0538827
1041 Ga0466963_0000263
1042 Ga0466963_0000765
1043 Ga0466963_0006931
1044 Ga0466963_0007646
1045 Ga0466963_0008632
1046 Ga0466963_0010452
1047 Ga0466963_0020715
1048 Ga0466963_0030651
1049 Ga0466963_0032571
1050 Ga0466963_0041587
1051 Ga0466963_0095998
1052 Ga0466963_0134588
1053 Ga0466963_0343285
1054 Ga0466964_0006723
1055 Ga0466964_0015615
1056 Ga0466964_0034626
1057 Ga0466964_0045312
1058 Ga0466971_0076149
1059 Ga0466971_0147939
1060 Ga0466968_0003004
1061 Ga0466968_0005657
1062 Ga0466968_0034121
1063 Ga0466968_0041944
1064 Ga0466968_0246605
1065 Ga0466970_0026018
1066 Ga0466957_0010565
1067 Ga0466957_0016733
1068 Ga0466957_0034159
1069 Ga0466957_0045872
1070 Ga0466957_0060222
1071 Ga0466957_0166841
1072 Ga0466957_0190359
1073 Ga0466960_0198271
1074 Ga0466960_0214465
1075 Ga0466960_0559974
1076 Ga0466959_0001526
1077 Ga0466959_0008342
1078 Ga0466959_0043115
1079 Ga0466959_0402916
1080 Ga0466958_0004302
1081 Ga0466958_0030007
1082 Ga0466958_0035418
1083 Ga0466958_0070974
1084 Ga0466958_0128753
1085 Ga0466958_0336099
1086 Ga0466958_0414182
1087 Ga0466967_0004788
1088 Ga0466967_0005119
1089 Ga0466967_0018144
1090 Ga0466967_0021993
1091 Ga0466967_0024946
1092 Ga0466967_0025022
1093 Ga0466967_0027167
1094 Ga0466967_0035234
1095 Ga0466967_0035398
1096 Ga0466967_0055424
1097 Ga0466967_0056092
1098 Ga0466967_0060645
1099 Ga0466967_0068277
1100 Ga0466967_0074603
1101 Ga0466967_0096649
1102 Ga0466967_0121175
1103 Ga0466967_0137560
1104 Ga0466967_0148017
1105 Ga0466967_0176206
1106 Ga0466967_0180674
1107 Ga0466967_0298323
1108 Ga0466967_0567874
1109 Ga0495592_0000708
1110 Ga0495592_0076909
1111 Ga0495629_0062362
1112 Ga0495641_0002032
1113 Ga0495641_0026466
1114 Ga0495641_0155397
1115 Ga0495641_0157838
1116 Ga0495641_0333225
1117 Ga0495651_0000885
1118 Ga0495651_0074101
1119 Ga0495653_0001808
1120 Ga0495653_0070043
1121 Ga0495653_0092604
1122 Ga0495653_0235802
1123 Ga0495653_0448898
1124 Ga0495582_0003738
1125 Ga0495605_0135524
1126 Ga0495639_0000458
1127 Ga0495662_0000722
1128 Ga0495662_0189357
1129 Ga0495664_0375146
1130 Ga0495584_0222678
1131 Ga0495596_0017276
1132 Ga0495596_0058064
1133 Ga0495607_0149108
1134 Ga0495607_0251348
1135 Ga0495608_0002754
1136 Ga0495608_0014276
1137 Ga0495608_0158698
1138 Ga0495618_0025634
1139 Ga0495618_0192554
1140 Ga0495628_0001243
1141 Ga0495628_0047594
1142 Ga0495630_0001392
1143 Ga0495630_0073121
1144 Ga0495630_0402012
1145 Ga0495631_0131856
1146 Ga0495666_0000065
1147 Ga0495642_0052294
1148 Ga0495652_0003720
1149 Ga0495652_0051952
1150 Ga0495652_0156929
1151 Ga0495652_0230813
1152 Ga0495665_0006872
1153 Ga0495640_0002040
1154 Ga0495640_0153750
1155 Ga0495640_0334548
1156 Ga0495586_0028621
1157 Ga0495586_0033020
1158 Ga0495587_0000675
1159 Ga0495587_0080742
1160 Ga0495587_0124913
1161 Ga0495587_0222156
1162 Ga0495609_0077826
1163 Ga0495645_0000684
1164 Ga0495667_0040047
1165 Ga0495667_0083909
1166 Ga0495667_0166773
1167 Ga0495656_0188933
1168 Ga0495634_0015172
1169 Ga0495634_0052284
1170 Ga0495634_0083509
1171 Ga0495635_0004316
1172 Ga0495635_0053968
1173 Ga0495661_0120468
1174 Ga0495588_0289643
1175 Ga0495657_0019820
1176 Ga0495657_0126959
1177 Ga0495657_0402418
1178 Ga0495599_0000455
1179 Ga0495599_0009532
1180 Ga0495599_0221946
1181 Ga0495599_0331447
1182 Ga0495623_0001619
1183 Ga0495623_0335254
1184 Ga0495646_0010255
1185 Ga0495646_0088612
1186 Ga0495646_0140123
1187 Ga0495646_0195360
1188 Ga0495647_0000075
1189 Ga0495647_0030715
1190 Ga0495647_0117602
1191 Ga0495658_0000743
1192 Ga0495613_0051507
1193 Ga0495613_0532529
1194 Ga0495624_0011560
1195 Ga0495624_0120210
1196 Ga0495600_0159910
1197 Ga0495600_0270596
1198 Ga0495581_0001695
1199 Ga0495604_0001028
1200 Ga0495604_0374527
1201 Ga0495674_0064942
1202 Ga0495674_0110524
1203 Ga0495674_0145359
1204 Ga0495674_0379315
1205 Ga0495676_0004569
1206 Ga0495676_0160040
1207 Ga0495676_0390288
1208 Ga0495680_0001991
1209 Ga0495680_0028290
1210 Ga0495680_0029511
1211 Ga0495680_0119293
1212 Ga0495680_0358606
1213 Ga0495675_0000592
1214 Ga0495677_0073977
1215 Ga0495684_0016402
1216 Ga0495684_0018772
1217 Ga0495684_0061136
1218 Ga0495684_0070941
1219 Ga0495684_0194867
1220 Ga0495593_0012606
1221 Ga0495593_0110807
1222 Ga0495602_0001484
1223 Ga0495602_0261104
1224 Ga0495614_0003232
1225 Ga0496100_0022631
1226 Ga0496100_0024315
1227 Ga0496100_0088889
1228 Ga0496100_0152508
1229 Ga0496100_0209177
1230 Ga0496100_0735781
1231 Ga0496101_0087196
1232 Ga0496101_0199711
1233 Ga0496101_0285969
1234 Ga0496102_0019852
1235 Ga0496102_0028957
1236 Ga0496102_0053477
1237 Ga0496102_0276797
1238 Ga0496102_0312205
1239 Ga0496102_0769070
1240 Ga0496102_0865912
1241 Ga0496103_0009819
1242 Ga0496103_0020360
1243 Ga0496103_0224071
1244 Ga0496104_0002589
1245 Ga0496104_0056729
1246 Ga0496104_0173940
1247 Ga0496104_0591932
1248 Ga0496104_0730574
1249 Ga0496105_0001826
1250 Ga0496105_0005511
1251 Ga0496105_0103670
1252 Ga0496105_0104050
1253 Ga0496105_0121950
1254 Ga0496105_0208068
1255 Ga0496105_0583420
1256 Ga0496106_0003519
1257 Ga0496106_0003660
1258 Ga0496106_0250705
1259 Ga0496106_0373975
1260 Ga0496107_0002817
1261 Ga0496107_0004074
1262 Ga0496107_0107162
1263 Ga0496107_0153992
1264 Ga0496107_0252564
1265 Ga0496108_0004163
1266 Ga0496108_0133656
1267 Ga0496108_0368889
1268 Ga0496108_0636831
1269 Ga0496109_0004035
1270 Ga0496109_0006873
1271 Ga0496109_0014997
1272 Ga0496109_0085652
1273 Ga0496109_0650066
1274 Ga0496110_0024591
1275 Ga0496110_0026080
1276 Ga0496110_0061381
1277 Ga0496110_0115182
1278 Ga0496110_0185922
1279 Ga0496110_0445428
1280 Ga0496111_0001138
1281 Ga0496111_0049169
1282 Ga0496111_0099089
1283 Ga0496111_0165951
1284 Ga0496111_0231720
1285 Ga0496112_0001992
1286 Ga0496112_0025481
1287 Ga0496112_0026491
1288 Ga0496112_0087411
1289 Ga0496112_0110808
1290 Ga0496112_0170002
1291 Ga0496112_0213176
1292 Ga0496112_0213293
1293 Ga0496112_0340412
1294 Ga0496112_0384416
1295 Ga0496113_0041106
1296 Ga0496113_0175154
1297 Ga0496113_0200944
1298 Ga0496113_0300468
1299 Ga0496113_0728766
1300 Ga0496114_0044347
1301 Ga0496114_0170883
1302 Ga0496114_0239110
1303 Ga0496114_0320919
1304 Ga0496115_0009633
1305 Ga0496115_0057971
1306 Ga0496115_0162757
1307 Ga0496115_0477194
1308 Ga0501031_0002877
1309 Ga0501034_0390720
1310 Ga0501036_0010229
1311 Ga0501036_0014420
1312 Ga0501037_0026419
1313 Ga0501038_0111645
1314 Ga0501039_0034537
1315 Ga0501041_0006676
1316 Ga0501042_0004105
1317 Ga0501042_0143077
1318 Ga0501042_0496285
1319 Ga0501046_0005156
1320 Ga0501046_0351763
1321 Ga0501046_0794110
1322 Ga0501047_0101229
1323 Ga0501048_0007923
1324 Ga0501067_0016770
1325 Ga0501067_0017090
1326 Ga0501067_0017101
1327 Ga0501067_0037764
1328 Ga0501067_0097891
1329 Ga0501068_0571595
1330 Ga0501069_0028072
1331 Ga0501069_0038618
1332 Ga0501069_0104223
1333 Ga0501069_0460756
1334 Ga0501070_0007274
1335 Ga0501070_0018543
1336 Ga0501070_0191466
1337 Ga0501070_0431002
1338 Ga0501070_0695794
1339 Ga0501071_0005995
1340 Ga0501071_0036160
1341 Ga0501071_0071004
1342 Ga0501072_0001083
1343 Ga0501072_0028816
1344 Ga0501072_0037987
1345 Ga0501073_0168460
1346 Ga0501074_0008072
1347 Ga0501074_0024304
1348 Ga0501074_0042636
1349 Ga0501074_0474183
1350 Ga0501075_0005192
1351 Ga0501075_0010412
1352 Ga0501076_0008422
1353 Ga0501076_0702517
1354 Ga0501076_0863811
1355 Ga0501077_0002003
1356 Ga0501077_0003802
1357 Ga0501079_0104413
1358 Ga0501079_0270032
1359 Ga0501080_0029157
1360 Ga0501080_0257994
1361 Ga0501083_0000145
1362 Ga0501045_0002722
1363 Ga0501045_0110199
1364 nmdc:mga05p37_175983_c1
1365 nmdc:mga0n895_3054_c1
1366 nmdc:mga0n895_80505_c1
1367 nmdc:mga0n895_863256_c1
1368 nmdc:mga0rr50_143437_c1
1369 nmdc:mga08x19_233683_c1
1370 nmdc:mga0a205_253981_c1
1371 Ga0495601_0002343
1372 Ga0495601_0006404
1373 Ga0495601_0027298
1374 Ga0495601_0058761
1375 Ga0495601_0089197
1376 Ga0495601_0094326
1377 Ga0495601_0174094
1378 Ga0495601_0227559
1379 Ga0495612_0049796
1380 Ga0495612_0113733
1381 Ga0495612_0114922
1382 Ga0495595_0003477
1383 Ga0495595_0011315
1384 Ga0495619_0007501
1385 Ga0495619_0010159
1386 Ga0495619_0027368
1387 Ga0495619_0030547
1388 Ga0501084_0097305
1389 Ga0590075_033560
1390 Ga0501082_0004794
1391 Ga0501082_0040567
1392 Ga0501082_0286303
1393 Ga0466962_0008496
1394 Ga0466962_0153248
1395 Ga0466962_0166601
1396 Ga0530510_0002901
1397 Ga0530510_0064610
1398 Ga0530510_0101356

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

38

195

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.8021 14 207
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7945 14 207
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7847 12 200
6ajq-assembly1.cif.gz_A e52q mutant form of uracil dna glycosylase x from mycobacterium smegmatis. 0.7841 14 195
8iiq-assembly1.cif.gz_A msmudgx h109s/e52n double mutant 0.778 15 205
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8081 14 207 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7852 14 207 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7787 12 200 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7601 12 200 3.40.470.10
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7468 14 207 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A538IF52-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.984 5 201 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V9KYX2-F1-model_v4 Uracil-DNA glycosylase family protein 0.9745 6 204 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V9JI02-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.971 2 206 GO:0006281
GO:0046677
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W0PZB9-F1-model_v4 Uracil-DNA glycosylase 0.9693 37 201 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A538HFQ1-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.969 1 206 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map