F476049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 290 | 1398 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300046517|Ga0495630_0450067|Ga0495630_0450067_306_911 |
| Length | 201 |
| Sequence | MTVRKSSYRSLASLARDLSRCRACVEAGYPLESLPVHAPGAGQKAYLFGQAPGVIEGEERLPWRGDAGRRLRRWLELEDETEFYATFHCASVTRCYPGRAPSGRGDRTPAPREQELCRFWRDWELELLRPGLIVTVGGLALQGLLGVAPLTAYVGERCELDGTPVVPLPHSSGASGWLNVPDNRERLAAALELVRAELVKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 163 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 164 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 165 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 166 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 167 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 170 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 175 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 176 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 177 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.87 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495630_0450067 | 3300046517 | Bacteria | 987 |
| 2 | Ga0070680_100045841 | 3300005336 | Bacteria | 3555 |
| 3 | Ga0070680_100470762 | 3300005336 | Unclassified | 1074 |
| 4 | Ga0070682_100026704 | 3300005337 | Bacteria | 3459 |
| 5 | Ga0070682_100027607 | 3300005337 | Bacteria | 3407 |
| 6 | Ga0070682_100505915 | 3300005337 | Viruses | 937 |
| 7 | Ga0068868_100042341 | 3300005338 | Unclassified | 3553 |
| 8 | Ga0070660_100002731 | 3300005339 | Bacteria | 12123 |
| 9 | Ga0070689_100010547 | 3300005340 | Bacteria | 6585 |
| 10 | Ga0070661_100050544 | 3300005344 | Bacteria | 3042 |
| 11 | Ga0070661_100498891 | 3300005344 | Unclassified | 974 |
| 12 | Ga0070668_100010845 | 3300005347 | Bacteria | 6780 |
| 13 | Ga0070675_100047064 | 3300005354 | Bacteria | 3533 |
| 14 | Ga0070671_100089760 | 3300005355 | Bacteria | 2573 |
| 15 | Ga0070673_100070100 | 3300005364 | Unclassified | 2812 |
| 16 | Ga0070659_100086305 | 3300005366 | Bacteria | 2511 |
| 17 | Ga0070659_100119919 | 3300005366 | Unclassified | 2129 |
| 18 | Ga0070659_100578949 | 3300005366 | Bacteria | 963 |
| 19 | Ga0070709_10014800 | 3300005434 | Bacteria | 4421 |
| 20 | Ga0070709_10181123 | 3300005434 | Bacteria | 1479 |
| 21 | Ga0070714_100021674 | 3300005435 | Bacteria | 5258 |
| 22 | Ga0070714_100030456 | 3300005435 | Bacteria | 4491 |
| 23 | Ga0070714_100046425 | 3300005435 | Bacteria | 3685 |
| 24 | Ga0070714_100096481 | 3300005435 | Bacteria | 2597 |
| 25 | Ga0070714_100531628 | 3300005435 | Bacteria | 1124 |
| 26 | Ga0070713_100037211 | 3300005436 | Bacteria | 3934 |
| 27 | Ga0070713_100121662 | 3300005436 | Bacteria | 2290 |
| 28 | Ga0070713_100367502 | 3300005436 | Unclassified | 1338 |
| 29 | Ga0070713_100376567 | 3300005436 | Bacteria | 1322 |
| 30 | Ga0070710_10006176 | 3300005437 | Bacteria | 5734 |
| 31 | Ga0070710_10006205 | 3300005437 | Bacteria | 5721 |
| 32 | Ga0070710_10020745 | 3300005437 | Bacteria | 3413 |
| 33 | Ga0070711_100051181 | 3300005439 | Bacteria | 2835 |
| 34 | Ga0070711_100071032 | 3300005439 | Bacteria | 2452 |
| 35 | Ga0070711_100151947 | 3300005439 | Bacteria | 1747 |
| 36 | Ga0070705_100033210 | 3300005440 | Bacteria | 2874 |
| 37 | Ga0070705_100129862 | 3300005440 | Bacteria | 1642 |
| 38 | Ga0070700_100061729 | 3300005441 | Unclassified | 2365 |
| 39 | Ga0070708_100283504 | 3300005445 | Bacteria | 1559 |
| 40 | Ga0070663_100011892 | 3300005455 | Bacteria | 5487 |
| 41 | Ga0070678_100456954 | 3300005456 | Unclassified | 1119 |
| 42 | Ga0070678_100910156 | 3300005456 | Bacteria | 804 |
| 43 | Ga0070681_10003387 | 3300005458 | Bacteria | 14915 |
| 44 | Ga0070681_10048080 | 3300005458 | Bacteria | 4263 |
| 45 | Ga0070681_10062785 | 3300005458 | Bacteria | 3688 |
| 46 | Ga0070681_10070828 | 3300005458 | Bacteria | 3451 |
| 47 | Ga0070681_10119792 | 3300005458 | Bacteria | 2568 |
| 48 | Ga0070681_10659722 | 3300005458 | Unclassified | 961 |
| 49 | Ga0070681_10766387 | 3300005458 | Bacteria | 881 |
| 50 | Ga0070685_10009736 | 3300005466 | Bacteria | 4979 |
| 51 | Ga0070685_10296743 | 3300005466 | Bacteria | 1088 |
| 52 | Ga0070706_100316161 | 3300005467 | Unclassified | 1456 |
| 53 | Ga0070706_100322262 | 3300005467 | Unclassified | 1441 |
| 54 | Ga0070706_101164168 | 3300005467 | Unclassified | 709 |
| 55 | Ga0070707_100001723 | 3300005468 | Bacteria | 21101 |
| 56 | Ga0070707_100012654 | 3300005468 | Bacteria | 7880 |
| 57 | Ga0070707_100045223 | 3300005468 | Bacteria | 4214 |
| 58 | Ga0070707_100158474 | 3300005468 | Bacteria | 2205 |
| 59 | Ga0070707_100179480 | 3300005468 | Unclassified | 2064 |
| 60 | Ga0070698_100011547 | 3300005471 | Bacteria | 9369 |
| 61 | Ga0070699_100929373 | 3300005518 | Unclassified | 797 |
| 62 | Ga0070679_100036609 | 3300005530 | Bacteria | 4870 |
| 63 | Ga0070679_100101496 | 3300005530 | Bacteria | 2864 |
| 64 | Ga0070679_100118527 | 3300005530 | Bacteria | 2632 |
| 65 | Ga0070679_100163272 | 3300005530 | Unclassified | 2201 |
| 66 | Ga0070679_100205717 | 3300005530 | Bacteria | 1933 |
| 67 | Ga0070679_100211335 | 3300005530 | Bacteria | 1904 |
| 68 | Ga0070679_100339736 | 3300005530 | Unclassified | 1450 |
| 69 | Ga0070684_100085923 | 3300005535 | Bacteria | 2791 |
| 70 | Ga0070684_100260621 | 3300005535 | Bacteria | 1586 |
| 71 | Ga0070684_100273849 | 3300005535 | Bacteria | 1546 |
| 72 | Ga0070684_100429133 | 3300005535 | Bacteria | 1220 |
| 73 | Ga0070684_100564210 | 3300005535 | Bacteria | 1057 |
| 74 | Ga0070697_100289493 | 3300005536 | Bacteria | 1407 |
| 75 | Ga0070697_100372098 | 3300005536 | Bacteria | 1236 |
| 76 | Ga0068853_100022608 | 3300005539 | Bacteria | 5253 |
| 77 | Ga0070686_100053614 | 3300005544 | Bacteria | 2576 |
| 78 | Ga0070695_100000510 | 3300005545 | Bacteria | 20376 |
| 79 | Ga0070696_100098604 | 3300005546 | Bacteria | 2090 |
| 80 | Ga0070696_100165315 | 3300005546 | Bacteria | 1633 |
| 81 | Ga0070696_100357354 | 3300005546 | Bacteria | 1133 |
| 82 | Ga0070693_100015557 | 3300005547 | Bacteria | 3918 |
| 83 | Ga0070693_100031268 | 3300005547 | Bacteria | 2916 |
| 84 | Ga0068855_100637388 | 3300005563 | Bacteria | 1146 |
| 85 | Ga0068855_100790065 | 3300005563 | Bacteria | 1010 |
| 86 | Ga0070664_100539748 | 3300005564 | Bacteria | 1078 |
| 87 | Ga0068857_100289423 | 3300005577 | Bacteria | 1508 |
| 88 | Ga0068857_100485337 | 3300005577 | Unclassified | 1158 |
| 89 | Ga0068856_100097222 | 3300005614 | Bacteria | 2933 |
| 90 | Ga0068856_100305164 | 3300005614 | Bacteria | 1610 |
| 91 | Ga0068856_100344906 | 3300005614 | Bacteria | 1508 |
| 92 | Ga0068856_100899572 | 3300005614 | Bacteria | 904 |
| 93 | Ga0070702_100054942 | 3300005615 | Bacteria | 2294 |
| 94 | Ga0070702_100059120 | 3300005615 | Unclassified | 2223 |
| 95 | Ga0068852_100103245 | 3300005616 | Bacteria | 2578 |
| 96 | Ga0068864_100272068 | 3300005618 | Unclassified | 1579 |
| 97 | Ga0068861_100509812 | 3300005719 | Bacteria | 1089 |
| 98 | Ga0068870_10118214 | 3300005840 | Bacteria | 1523 |
| 99 | Ga0068863_100218055 | 3300005841 | Bacteria | 1838 |
| 100 | Ga0068858_101003048 | 3300005842 | Bacteria | 818 |
| 101 | Ga0068860_100752838 | 3300005843 | Unclassified | 986 |
| 102 | Ga0081455_10421551 | 3300005937 | Bacteria | 920 |
| 103 | Ga0081538_10063513 | 3300005981 | Bacteria | 2096 |
| 104 | Ga0081540_1002106 | 3300005983 | Bacteria | 16574 |
| 105 | Ga0081539_10000639 | 3300005985 | Bacteria | 70847 |
| 106 | Ga0070717_10001374 | 3300006028 | Bacteria | 16755 |
| 107 | Ga0070717_10006435 | 3300006028 | Bacteria | 8639 |
| 108 | Ga0070717_10272377 | 3300006028 | Unclassified | 1500 |
| 109 | Ga0070715_10003125 | 3300006163 | Bacteria | 5202 |
| 110 | Ga0070715_10034171 | 3300006163 | Bacteria | 2082 |
| 111 | Ga0070716_100017636 | 3300006173 | Bacteria | 3705 |
| 112 | Ga0070716_100123826 | 3300006173 | Bacteria | 1623 |
| 113 | Ga0070716_100254056 | 3300006173 | Bacteria | 1199 |
| 114 | Ga0070712_100183458 | 3300006175 | Bacteria | 1632 |
| 115 | Ga0070712_100196679 | 3300006175 | Bacteria | 1581 |
| 116 | Ga0070712_100608539 | 3300006175 | Bacteria | 925 |
| 117 | Ga0068871_100057730 | 3300006358 | Bacteria | 3158 |
| 118 | Ga0068871_100615959 | 3300006358 | Bacteria | 988 |
| 119 | Ga0075428_100278008 | 3300006844 | Unclassified | 1801 |
| 120 | Ga0075433_10254982 | 3300006852 | Bacteria | 1556 |
| 121 | Ga0075434_100000658 | 3300006871 | Bacteria | 26789 |
| 122 | Ga0075434_100201965 | 3300006871 | Bacteria | 2008 |
| 123 | Ga0075434_100495472 | 3300006871 | Unclassified | 1243 |
| 124 | Ga0075434_101112011 | 3300006871 | Unclassified | 803 |
| 125 | Ga0075436_100160242 | 3300006914 | Bacteria | 1586 |
| 126 | Ga0105240_10006035 | 3300009093 | Bacteria | 17912 |
| 127 | Ga0105245_10143374 | 3300009098 | Bacteria | 2252 |
| 128 | Ga0105245_10157227 | 3300009098 | Bacteria | 2154 |
| 129 | Ga0114129_10855248 | 3300009147 | Bacteria | 1156 |
| 130 | Ga0105243_10011056 | 3300009148 | Bacteria | 6828 |
| 131 | Ga0105242_10587955 | 3300009176 | Bacteria | 1073 |
| 132 | Ga0105248_10356780 | 3300009177 | Bacteria | 1646 |
| 133 | Ga0105237_10016697 | 3300009545 | Bacteria | 7621 |
| 134 | Ga0105238_10472575 | 3300009551 | Bacteria | 1252 |
| 135 | Ga0105249_10322392 | 3300009553 | Bacteria | 1556 |
| 136 | Ga0105249_10676973 | 3300009553 | Bacteria | 1090 |
| 137 | Ga0105239_10124886 | 3300010375 | Bacteria | 2859 |
| 138 | Ga0105246_10042597 | 3300011119 | Bacteria | 3075 |
| 139 | Ga0105246_10182556 | 3300011119 | Bacteria | 1617 |
| 140 | Ga0157373_10554331 | 3300013100 | Bacteria | 834 |
| 141 | Ga0157370_10578297 | 3300013104 | Bacteria | 1029 |
| 142 | Ga0157369_10029019 | 3300013105 | Bacteria | 6117 |
| 143 | Ga0157369_10175518 | 3300013105 | Bacteria | 2256 |
| 144 | Ga0157369_10217169 | 3300013105 | Bacteria | 2002 |
| 145 | Ga0157369_10432501 | 3300013105 | Bacteria | 1364 |
| 146 | Ga0157374_10021299 | 3300013296 | Bacteria | 5766 |
| 147 | Ga0157378_10011683 | 3300013297 | Bacteria | 7685 |
| 148 | Ga0157372_10225924 | 3300013307 | Bacteria | 2170 |
| 149 | Ga0157372_10303640 | 3300013307 | Bacteria | 1857 |
| 150 | Ga0157372_10946851 | 3300013307 | Unclassified | 998 |
| 151 | Ga0157375_11134315 | 3300013308 | Bacteria | 916 |
| 152 | Ga0157380_10627141 | 3300014326 | Bacteria | 1068 |
| 153 | Ga0182008_10004855 | 3300014497 | Bacteria | 7768 |
| 154 | Ga0182008_10066804 | 3300014497 | Bacteria | 1770 |
| 155 | Ga0182008_10108297 | 3300014497 | Unclassified | 1376 |
| 156 | Ga0157377_10069732 | 3300014745 | Bacteria | 2029 |
| 157 | Ga0157379_10461722 | 3300014968 | Bacteria | 1174 |
| 158 | Ga0157376_10001857 | 3300014969 | Bacteria | 14081 |
| 159 | Ga0157376_10015637 | 3300014969 | Bacteria | 5738 |
| 160 | Ga0157376_10095119 | 3300014969 | Bacteria | 2590 |
| 161 | Ga0157376_11211206 | 3300014969 | Bacteria | 783 |
| 162 | Ga0182006_1039198 | 3300015261 | Bacteria | 1871 |
| 163 | Ga0182007_10013646 | 3300015262 | Bacteria | 3090 |
| 164 | Ga0206356_11073177 | 3300020070 | Bacteria | 1845 |
| 165 | Ga0206354_11313913 | 3300020081 | Unclassified | 975 |
| 166 | Ga0206353_10203683 | 3300020082 | Bacteria | 8091 |
| 167 | Ga0206353_10539657 | 3300020082 | Bacteria | 3187 |
| 168 | Ga0207692_10005416 | 3300025898 | Bacteria | 5111 |
| 169 | Ga0207692_10292983 | 3300025898 | Unclassified | 988 |
| 170 | Ga0207685_10006844 | 3300025905 | Unclassified | 3136 |
| 171 | Ga0207685_10009841 | 3300025905 | Bacteria | 2794 |
| 172 | Ga0207699_10006819 | 3300025906 | Bacteria | 5555 |
| 173 | Ga0207699_10131461 | 3300025906 | Unclassified | 1633 |
| 174 | Ga0207643_10227739 | 3300025908 | Bacteria | 1143 |
| 175 | Ga0207684_10215282 | 3300025910 | Unclassified | 1657 |
| 176 | Ga0207684_10227393 | 3300025910 | Bacteria | 1610 |
| 177 | Ga0207684_10275995 | 3300025910 | Unclassified | 1450 |
| 178 | Ga0207654_10060369 | 3300025911 | Bacteria | 2215 |
| 179 | Ga0207707_10002423 | 3300025912 | Bacteria | 16786 |
| 180 | Ga0207707_10014128 | 3300025912 | Bacteria | 6957 |
| 181 | Ga0207707_10049387 | 3300025912 | Bacteria | 3665 |
| 182 | Ga0207707_10081162 | 3300025912 | Bacteria | 2831 |
| 183 | Ga0207707_10102898 | 3300025912 | Bacteria | 2496 |
| 184 | Ga0207707_10250095 | 3300025912 | Bacteria | 1540 |
| 185 | Ga0207695_10419020 | 3300025913 | Unclassified | 1223 |
| 186 | Ga0207671_10020140 | 3300025914 | Bacteria | 5084 |
| 187 | Ga0207693_10000198 | 3300025915 | Bacteria | 54576 |
| 188 | Ga0207693_10001236 | 3300025915 | Bacteria | 22780 |
| 189 | Ga0207693_10081754 | 3300025915 | Bacteria | 2529 |
| 190 | Ga0207693_10175060 | 3300025915 | Bacteria | 1689 |
| 191 | Ga0207663_10008665 | 3300025916 | Bacteria | 5336 |
| 192 | Ga0207663_10012556 | 3300025916 | Bacteria | 4583 |
| 193 | Ga0207663_10138818 | 3300025916 | Bacteria | 1690 |
| 194 | Ga0207660_10065950 | 3300025917 | Bacteria | 2618 |
| 195 | Ga0207660_10094426 | 3300025917 | Bacteria | 2223 |
| 196 | Ga0207660_10642047 | 3300025917 | Unclassified | 865 |
| 197 | Ga0207657_10002416 | 3300025919 | Bacteria | 20175 |
| 198 | Ga0207657_10002425 | 3300025919 | Bacteria | 20137 |
| 199 | Ga0207657_10015657 | 3300025919 | Bacteria | 7335 |
| 200 | Ga0207649_10260809 | 3300025920 | Unclassified | 1252 |
| 201 | Ga0207652_10009209 | 3300025921 | Bacteria | 7947 |
| 202 | Ga0207652_10028268 | 3300025921 | Bacteria | 4678 |
| 203 | Ga0207652_10072944 | 3300025921 | Bacteria | 2985 |
| 204 | Ga0207652_10095193 | 3300025921 | Bacteria | 2623 |
| 205 | Ga0207652_10130543 | 3300025921 | Bacteria | 2241 |
| 206 | Ga0207652_10293177 | 3300025921 | Bacteria | 1468 |
| 207 | Ga0207646_10002942 | 3300025922 | Bacteria | 19740 |
| 208 | Ga0207646_10005159 | 3300025922 | Bacteria | 13834 |
| 209 | Ga0207646_10271622 | 3300025922 | Unclassified | 1532 |
| 210 | Ga0207659_10204944 | 3300025926 | Unclassified | 1577 |
| 211 | Ga0207687_10120342 | 3300025927 | Bacteria | 1962 |
| 212 | Ga0207687_10166137 | 3300025927 | Bacteria | 1698 |
| 213 | Ga0207700_10028147 | 3300025928 | Bacteria | 3946 |
| 214 | Ga0207700_10228312 | 3300025928 | Bacteria | 1581 |
| 215 | Ga0207700_10269414 | 3300025928 | Unclassified | 1461 |
| 216 | Ga0207664_10012608 | 3300025929 | Bacteria | 6047 |
| 217 | Ga0207664_10061000 | 3300025929 | Bacteria | 3007 |
| 218 | Ga0207664_10175951 | 3300025929 | Bacteria | 1835 |
| 219 | Ga0207664_10324610 | 3300025929 | Bacteria | 1358 |
| 220 | Ga0207664_10727149 | 3300025929 | Unclassified | 893 |
| 221 | Ga0207665_10001160 | 3300025939 | Bacteria | 17714 |
| 222 | Ga0207665_10027836 | 3300025939 | Bacteria | 3734 |
| 223 | Ga0207665_10376950 | 3300025939 | Unclassified | 1076 |
| 224 | Ga0207711_10234488 | 3300025941 | Bacteria | 1681 |
| 225 | Ga0207661_10024051 | 3300025944 | Bacteria | 4610 |
| 226 | Ga0207661_10091258 | 3300025944 | Bacteria | 2538 |
| 227 | Ga0207661_10115742 | 3300025944 | Bacteria | 2275 |
| 228 | Ga0207679_10333907 | 3300025945 | Unclassified | 1316 |
| 229 | Ga0207667_10668351 | 3300025949 | Bacteria | 1043 |
| 230 | Ga0207667_10803499 | 3300025949 | Bacteria | 937 |
| 231 | Ga0207712_10243391 | 3300025961 | Bacteria | 1450 |
| 232 | Ga0207677_10173331 | 3300026023 | Unclassified | 1689 |
| 233 | Ga0207677_10245920 | 3300026023 | Bacteria | 1450 |
| 234 | Ga0207677_10422840 | 3300026023 | Bacteria | 1135 |
| 235 | Ga0207677_10730514 | 3300026023 | Bacteria | 881 |
| 236 | Ga0207678_10019548 | 3300026067 | Bacteria | 5952 |
| 237 | Ga0207708_10045321 | 3300026075 | Bacteria | 3351 |
| 238 | Ga0207641_10107033 | 3300026088 | Bacteria | 2473 |
| 239 | Ga0207648_10618603 | 3300026089 | Bacteria | 999 |
| 240 | Ga0207674_10232015 | 3300026116 | Bacteria | 1793 |
| 241 | Ga0207675_100378271 | 3300026118 | Bacteria | 1392 |
| 242 | Ga0207683_10000547 | 3300026121 | Bacteria | 34798 |
| 243 | Ga0207683_10032295 | 3300026121 | Bacteria | 4548 |
| 244 | Ga0207683_10170799 | 3300026121 | Bacteria | 1969 |
| 245 | Ga0268264_10379114 | 3300028381 | Unclassified | 1354 |
| 246 | Ga0265326_10008921 | 3300028558 | Bacteria | 3006 |
| 247 | Ga0265319_1002712 | 3300028563 | Bacteria | 9500 |
| 248 | Ga0265334_10002234 | 3300028573 | Bacteria | 9106 |
| 249 | Ga0265318_10001544 | 3300028577 | Bacteria | 13404 |
| 250 | Ga0265322_10006014 | 3300028654 | Bacteria | 3575 |
| 251 | Ga0265338_10004407 | 3300028800 | Bacteria | 19038 |
| 252 | Ga0265338_10008221 | 3300028800 | Bacteria | 12707 |
| 253 | Ga0265338_10012815 | 3300028800 | Bacteria | 9531 |
| 254 | Ga0265338_10055700 | 3300028800 | Bacteria | 3515 |
| 255 | Ga0265330_10001866 | 3300031235 | Bacteria | 11734 |
| 256 | Ga0265332_10003779 | 3300031238 | Bacteria | 7241 |
| 257 | Ga0265328_10003180 | 3300031239 | Bacteria | 7291 |
| 258 | Ga0265320_10007986 | 3300031240 | Bacteria | 6516 |
| 259 | Ga0265325_10009499 | 3300031241 | Bacteria | 5672 |
| 260 | Ga0265325_10023137 | 3300031241 | Bacteria | 3398 |
| 261 | Ga0265329_10001035 | 3300031242 | Bacteria | 13840 |
| 262 | Ga0265340_10004059 | 3300031247 | Bacteria | 8222 |
| 263 | Ga0265339_10009114 | 3300031249 | Bacteria | 6268 |
| 264 | Ga0265331_10008163 | 3300031250 | Bacteria | 5976 |
| 265 | Ga0265327_10006990 | 3300031251 | Bacteria | 8851 |
| 266 | Ga0265316_10010133 | 3300031344 | Bacteria | 8605 |
| 267 | Ga0265316_10322399 | 3300031344 | Bacteria | 1122 |
| 268 | Ga0265313_10005752 | 3300031595 | Bacteria | 9022 |
| 269 | Ga0265314_10007362 | 3300031711 | Bacteria | 9556 |
| 270 | Ga0265314_10102010 | 3300031711 | Bacteria | 1842 |
| 271 | Ga0265342_10004699 | 3300031712 | Bacteria | 10632 |
| 272 | Ga0307407_10200220 | 3300031903 | Bacteria | 1338 |
| 273 | Ga0307409_100380942 | 3300031995 | Bacteria | 1341 |
| 274 | Ga0307409_100440942 | 3300031995 | Unclassified | 1254 |
| 275 | Ga0307409_100904595 | 3300031995 | Archaea | 896 |
| 276 | Ga0307416_100020746 | 3300032002 | Bacteria | 4698 |
| 277 | Ga0307416_100032934 | 3300032002 | Bacteria | 3923 |
| 278 | Ga0307415_100022120 | 3300032126 | Bacteria | 3920 |
| 279 | Ga0307415_100984643 | 3300032126 | Bacteria | 783 |
| 280 | Ga0373950_0041180 | 3300034818 | Unclassified | 885 |
| 281 | Ga0373952_0008766 | 3300035092 | Unclassified | 1924 |
| 282 | Ga0373953_0307674 | 3300035117 | Archaea | 692 |
| 283 | Ga0373931_0044670 | 3300035691 | Bacteria | 2337 |
| 284 | Ga0373931_0114539 | 3300035691 | Bacteria | 1534 |
| 285 | Ga0373931_0568724 | 3300035691 | Bacteria | 738 |
| 286 | Ga0373927_0190470 | 3300035695 | Bacteria | 1346 |
| 287 | Ga0373947_0007729 | 3300035725 | Bacteria | 6212 |
| 288 | Ga0373947_0254543 | 3300035725 | Bacteria | 1162 |
| 289 | Ga0373937_0002702 | 3300036401 | Bacteria | 14815 |
| 290 | Ga0373937_0028480 | 3300036401 | Bacteria | 5055 |
| 291 | Ga0373937_0295640 | 3300036401 | Bacteria | 1530 |
| 292 | Ga0373925_0000887 | 3300037068 | Bacteria | 27335 |
| 293 | Ga0395899_0006269 | 3300037312 | Bacteria | 9207 |
| 294 | Ga0395899_0034792 | 3300037312 | Bacteria | 3784 |
| 295 | Ga0395899_0103849 | 3300037312 | Bacteria | 2049 |
| 296 | Ga0395900_0003567 | 3300037418 | Bacteria | 16738 |
| 297 | Ga0395900_0008695 | 3300037418 | Bacteria | 10432 |
| 298 | Ga0395900_0083645 | 3300037418 | Unclassified | 3278 |
| 299 | Ga0395900_0091641 | 3300037418 | Bacteria | 3123 |
| 300 | Ga0395900_0261897 | 3300037418 | Bacteria | 1726 |
| 301 | Ga0395900_0598698 | 3300037418 | Bacteria | 1043 |
| 302 | Ga0395898_0003871 | 3300037466 | Bacteria | 16535 |
| 303 | Ga0395898_0006288 | 3300037466 | Bacteria | 12694 |
| 304 | Ga0395898_0007490 | 3300037466 | Bacteria | 11594 |
| 305 | Ga0395898_0009281 | 3300037466 | Bacteria | 10344 |
| 306 | Ga0395898_0177994 | 3300037466 | Bacteria | 2032 |
| 307 | Ga0395905_0007967 | 3300037471 | Bacteria | 10473 |
| 308 | Ga0395905_0018017 | 3300037471 | Bacteria | 6705 |
| 309 | Ga0395905_0055618 | 3300037471 | Bacteria | 3703 |
| 310 | Ga0395905_0071096 | 3300037471 | Bacteria | 3262 |
| 311 | Ga0395905_0148278 | 3300037471 | Bacteria | 2207 |
| 312 | Ga0395905_0192381 | 3300037471 | Unclassified | 1913 |
| 313 | Ga0395901_0009578 | 3300038443 | Bacteria | 9830 |
| 314 | Ga0395901_0043951 | 3300038443 | Bacteria | 4633 |
| 315 | Ga0395901_0052280 | 3300038443 | Bacteria | 4245 |
| 316 | Ga0395901_0066955 | 3300038443 | Bacteria | 3740 |
| 317 | Ga0395901_0078551 | 3300038443 | Bacteria | 3446 |
| 318 | Ga0395901_0278186 | 3300038443 | Bacteria | 1739 |
| 319 | Ga0395901_0332770 | 3300038443 | Unclassified | 1570 |
| 320 | Ga0395901_0667205 | 3300038443 | Unclassified | 1041 |
| 321 | Ga0395901_0678461 | 3300038443 | Unclassified | 1030 |
| 322 | Ga0395901_1208199 | 3300038443 | Unclassified | 722 |
| 323 | Ga0436360_0147319 | 3300039438 | Unclassified | 1744 |
| 324 | Ga0439465_0140391 | 3300041413 | Bacteria | 858 |
| 325 | Ga0439445_0047446 | 3300042004 | Bacteria | 1154 |
| 326 | Ga0439448_0000767 | 3300042005 | Bacteria | 7801 |
| 327 | Ga0439455_0004717 | 3300042012 | Bacteria | 2719 |
| 328 | Ga0439446_0020120 | 3300042156 | Unclassified | 1878 |
| 329 | Ga0466969_0025650 | 3300044656 | Bacteria | 3029 |
| 330 | Ga0466969_0073259 | 3300044656 | Unclassified | 1644 |
| 331 | Ga0466972_0030506 | 3300044658 | Bacteria | 2653 |
| 332 | Ga0466965_0033614 | 3300044683 | Bacteria | 2507 |
| 333 | Ga0466965_0068964 | 3300044683 | Unclassified | 1776 |
| 334 | Ga0466966_0001983 | 3300044684 | Bacteria | 13266 |
| 335 | Ga0466966_0284296 | 3300044684 | Bacteria | 995 |
| 336 | Ga0466961_0005297 | 3300044693 | Bacteria | 8116 |
| 337 | Ga0466961_0056955 | 3300044693 | Bacteria | 2489 |
| 338 | Ga0466961_0094880 | 3300044693 | Unclassified | 1882 |
| 339 | Ga0466961_0167980 | 3300044693 | Bacteria | 1365 |
| 340 | Ga0466961_0217040 | 3300044693 | Bacteria | 1179 |
| 341 | Ga0466961_0538827 | 3300044693 | Unclassified | 703 |
| 342 | Ga0466963_0000263 | 3300044694 | Bacteria | 23137 |
| 343 | Ga0466963_0000765 | 3300044694 | Bacteria | 15911 |
| 344 | Ga0466963_0006931 | 3300044694 | Bacteria | 6742 |
| 345 | Ga0466963_0007646 | 3300044694 | Bacteria | 6453 |
| 346 | Ga0466963_0008632 | 3300044694 | Bacteria | 6115 |
| 347 | Ga0466963_0010452 | 3300044694 | Bacteria | 5618 |
| 348 | Ga0466963_0020715 | 3300044694 | Bacteria | 4138 |
| 349 | Ga0466963_0030651 | 3300044694 | Bacteria | 3472 |
| 350 | Ga0466963_0032571 | 3300044694 | Bacteria | 3377 |
| 351 | Ga0466963_0041587 | 3300044694 | Bacteria | 3015 |
| 352 | Ga0466963_0095998 | 3300044694 | Unclassified | 2024 |
| 353 | Ga0466963_0134588 | 3300044694 | Unclassified | 1709 |
| 354 | Ga0466963_0343285 | 3300044694 | Bacteria | 1051 |
| 355 | Ga0466964_0006723 | 3300044706 | Bacteria | 4286 |
| 356 | Ga0466964_0015615 | 3300044706 | Bacteria | 2891 |
| 357 | Ga0466964_0034626 | 3300044706 | Unclassified | 2016 |
| 358 | Ga0466964_0045312 | 3300044706 | Unclassified | 1790 |
| 359 | Ga0466971_0076149 | 3300044719 | Bacteria | 1526 |
| 360 | Ga0466971_0147939 | 3300044719 | Bacteria | 1096 |
| 361 | Ga0466968_0003004 | 3300044735 | Bacteria | 6234 |
| 362 | Ga0466968_0005657 | 3300044735 | Bacteria | 4682 |
| 363 | Ga0466968_0034121 | 3300044735 | Bacteria | 2122 |
| 364 | Ga0466968_0041944 | 3300044735 | Bacteria | 1933 |
| 365 | Ga0466968_0246605 | 3300044735 | Bacteria | 847 |
| 366 | Ga0466970_0026018 | 3300044765 | Bacteria | 3066 |
| 367 | Ga0466957_0010565 | 3300044842 | Bacteria | 5305 |
| 368 | Ga0466957_0016733 | 3300044842 | Bacteria | 4290 |
| 369 | Ga0466957_0034159 | 3300044842 | Bacteria | 3051 |
| 370 | Ga0466957_0045872 | 3300044842 | Bacteria | 2651 |
| 371 | Ga0466957_0060222 | 3300044842 | Unclassified | 2328 |
| 372 | Ga0466957_0166841 | 3300044842 | Bacteria | 1432 |
| 373 | Ga0466957_0190359 | 3300044842 | Bacteria | 1344 |
| 374 | Ga0466960_0198271 | 3300044901 | Bacteria | 1095 |
| 375 | Ga0466960_0214465 | 3300044901 | Bacteria | 1057 |
| 376 | Ga0466960_0559974 | 3300044901 | Unclassified | 675 |
| 377 | Ga0466959_0001526 | 3300045049 | Bacteria | 14224 |
| 378 | Ga0466959_0008342 | 3300045049 | Bacteria | 7320 |
| 379 | Ga0466959_0043115 | 3300045049 | Bacteria | 3327 |
| 380 | Ga0466959_0402916 | 3300045049 | Unclassified | 930 |
| 381 | Ga0466958_0004302 | 3300045836 | Bacteria | 7500 |
| 382 | Ga0466958_0030007 | 3300045836 | Bacteria | 3226 |
| 383 | Ga0466958_0035418 | 3300045836 | Bacteria | 2982 |
| 384 | Ga0466958_0070974 | 3300045836 | Bacteria | 2132 |
| 385 | Ga0466958_0128753 | 3300045836 | Bacteria | 1588 |
| 386 | Ga0466958_0336099 | 3300045836 | Bacteria | 971 |
| 387 | Ga0466958_0414182 | 3300045836 | Unclassified | 871 |
| 388 | Ga0466967_0004788 | 3300045976 | Bacteria | 9217 |
| 389 | Ga0466967_0005119 | 3300045976 | Bacteria | 9010 |
| 390 | Ga0466967_0018144 | 3300045976 | Bacteria | 5614 |
| 391 | Ga0466967_0021993 | 3300045976 | Bacteria | 5193 |
| 392 | Ga0466967_0024946 | 3300045976 | Bacteria | 4923 |
| 393 | Ga0466967_0025022 | 3300045976 | Bacteria | 4916 |
| 394 | Ga0466967_0027167 | 3300045976 | Bacteria | 4757 |
| 395 | Ga0466967_0035234 | 3300045976 | Bacteria | 4258 |
| 396 | Ga0466967_0035398 | 3300045976 | Bacteria | 4250 |
| 397 | Ga0466967_0055424 | 3300045976 | Bacteria | 3491 |
| 398 | Ga0466967_0056092 | 3300045976 | Bacteria | 3472 |
| 399 | Ga0466967_0060645 | 3300045976 | Bacteria | 3353 |
| 400 | Ga0466967_0068277 | 3300045976 | Bacteria | 3174 |
| 401 | Ga0466967_0074603 | 3300045976 | Unclassified | 3047 |
| 402 | Ga0466967_0096649 | 3300045976 | Bacteria | 2694 |
| 403 | Ga0466967_0121175 | 3300045976 | Bacteria | 2417 |
| 404 | Ga0466967_0137560 | 3300045976 | Unclassified | 2272 |
| 405 | Ga0466967_0148017 | 3300045976 | Bacteria | 2192 |
| 406 | Ga0466967_0176206 | 3300045976 | Unclassified | 2014 |
| 407 | Ga0466967_0180674 | 3300045976 | Bacteria | 1990 |
| 408 | Ga0466967_0298323 | 3300045976 | Unclassified | 1550 |
| 409 | Ga0466967_0567874 | 3300045976 | Bacteria | 1117 |
| 410 | Ga0495592_0000708 | 3300046454 | Bacteria | 23320 |
| 411 | Ga0495592_0076909 | 3300046454 | Bacteria | 2421 |
| 412 | Ga0495629_0062362 | 3300046459 | Bacteria | 2604 |
| 413 | Ga0495641_0002032 | 3300046461 | Bacteria | 16400 |
| 414 | Ga0495641_0026466 | 3300046461 | Bacteria | 2830 |
| 415 | Ga0495641_0155397 | 3300046461 | Unclassified | 1023 |
| 416 | Ga0495641_0157838 | 3300046461 | Bacteria | 1014 |
| 417 | Ga0495641_0333225 | 3300046461 | Bacteria | 685 |
| 418 | Ga0495651_0000885 | 3300046462 | Bacteria | 23327 |
| 419 | Ga0495651_0074101 | 3300046462 | Bacteria | 2583 |
| 420 | Ga0495653_0001808 | 3300046463 | Bacteria | 16847 |
| 421 | Ga0495653_0070043 | 3300046463 | Bacteria | 2626 |
| 422 | Ga0495653_0092604 | 3300046463 | Bacteria | 2206 |
| 423 | Ga0495653_0235802 | 3300046463 | Unclassified | 1222 |
| 424 | Ga0495653_0448898 | 3300046463 | Bacteria | 811 |
| 425 | Ga0495582_0003738 | 3300046473 | Bacteria | 8575 |
| 426 | Ga0495605_0135524 | 3300046474 | Unclassified | 1107 |
| 427 | Ga0495639_0000458 | 3300046475 | Bacteria | 19373 |
| 428 | Ga0495662_0000722 | 3300046476 | Bacteria | 15787 |
| 429 | Ga0495662_0189357 | 3300046476 | Bacteria | 1014 |
| 430 | Ga0495664_0375146 | 3300046477 | Bacteria | 855 |
| 431 | Ga0495584_0222678 | 3300046491 | Unclassified | 959 |
| 432 | Ga0495596_0017276 | 3300046500 | Bacteria | 2991 |
| 433 | Ga0495596_0058064 | 3300046500 | Bacteria | 1509 |
| 434 | Ga0495607_0149108 | 3300046501 | Bacteria | 1199 |
| 435 | Ga0495607_0251348 | 3300046501 | Bacteria | 851 |
| 436 | Ga0495608_0002754 | 3300046511 | Bacteria | 12632 |
| 437 | Ga0495608_0014276 | 3300046511 | Bacteria | 5511 |
| 438 | Ga0495608_0158698 | 3300046511 | Unclassified | 1439 |
| 439 | Ga0495618_0025634 | 3300046514 | Bacteria | 3660 |
| 440 | Ga0495618_0192554 | 3300046514 | Bacteria | 1292 |
| 441 | Ga0495628_0001243 | 3300046516 | Bacteria | 23312 |
| 442 | Ga0495628_0047594 | 3300046516 | Bacteria | 3401 |
| 443 | Ga0495630_0001392 | 3300046517 | Bacteria | 16705 |
| 444 | Ga0495630_0073121 | 3300046517 | Unclassified | 2581 |
| 445 | Ga0495630_0402012 | 3300046517 | Bacteria | 1049 |
| 446 | Ga0495631_0131856 | 3300046518 | Unclassified | 1074 |
| 447 | Ga0495666_0000065 | 3300046526 | Bacteria | 40921 |
| 448 | Ga0495642_0052294 | 3300046528 | Bacteria | 1682 |
| 449 | Ga0495652_0003720 | 3300046529 | Bacteria | 14931 |
| 450 | Ga0495652_0051952 | 3300046529 | Bacteria | 3497 |
| 451 | Ga0495652_0156929 | 3300046529 | Bacteria | 1771 |
| 452 | Ga0495652_0230813 | 3300046529 | Bacteria | 1384 |
| 453 | Ga0495665_0006872 | 3300046531 | Bacteria | 6140 |
| 454 | Ga0495640_0002040 | 3300046533 | Bacteria | 16099 |
| 455 | Ga0495640_0153750 | 3300046533 | Bacteria | 1477 |
| 456 | Ga0495640_0334548 | 3300046533 | Bacteria | 936 |
| 457 | Ga0495586_0028621 | 3300046535 | Unclassified | 2981 |
| 458 | Ga0495586_0033020 | 3300046535 | Bacteria | 2776 |
| 459 | Ga0495587_0000675 | 3300046536 | Bacteria | 22859 |
| 460 | Ga0495587_0080742 | 3300046536 | Unclassified | 1884 |
| 461 | Ga0495587_0124913 | 3300046536 | Bacteria | 1473 |
| 462 | Ga0495587_0222156 | 3300046536 | Bacteria | 1065 |
| 463 | Ga0495609_0077826 | 3300046538 | Bacteria | 1452 |
| 464 | Ga0495645_0000684 | 3300046543 | Bacteria | 23313 |
| 465 | Ga0495667_0040047 | 3300046559 | Bacteria | 3113 |
| 466 | Ga0495667_0083909 | 3300046559 | Bacteria | 2069 |
| 467 | Ga0495667_0166773 | 3300046559 | Unclassified | 1416 |
| 468 | Ga0495656_0188933 | 3300046615 | Unclassified | 1016 |
| 469 | Ga0495634_0015172 | 3300046642 | Bacteria | 5539 |
| 470 | Ga0495634_0052284 | 3300046642 | Unclassified | 2738 |
| 471 | Ga0495634_0083509 | 3300046642 | Bacteria | 2084 |
| 472 | Ga0495635_0004316 | 3300046663 | Bacteria | 9843 |
| 473 | Ga0495635_0053968 | 3300046663 | Bacteria | 2768 |
| 474 | Ga0495661_0120468 | 3300046665 | Bacteria | 1450 |
| 475 | Ga0495588_0289643 | 3300046674 | Bacteria | 863 |
| 476 | Ga0495657_0019820 | 3300046675 | Bacteria | 4849 |
| 477 | Ga0495657_0126959 | 3300046675 | Bacteria | 1601 |
| 478 | Ga0495657_0402418 | 3300046675 | Bacteria | 805 |
| 479 | Ga0495599_0000455 | 3300046678 | Bacteria | 23331 |
| 480 | Ga0495599_0009532 | 3300046678 | Bacteria | 5937 |
| 481 | Ga0495599_0221946 | 3300046678 | Bacteria | 1156 |
| 482 | Ga0495599_0331447 | 3300046678 | Unclassified | 915 |
| 483 | Ga0495623_0001619 | 3300046679 | Bacteria | 15128 |
| 484 | Ga0495623_0335254 | 3300046679 | Unclassified | 827 |
| 485 | Ga0495646_0010255 | 3300046680 | Bacteria | 5959 |
| 486 | Ga0495646_0088612 | 3300046680 | Unclassified | 1792 |
| 487 | Ga0495646_0140123 | 3300046680 | Bacteria | 1353 |
| 488 | Ga0495646_0195360 | 3300046680 | Bacteria | 1104 |
| 489 | Ga0495647_0000075 | 3300046681 | Bacteria | 23932 |
| 490 | Ga0495647_0030715 | 3300046681 | Bacteria | 1995 |
| 491 | Ga0495647_0117602 | 3300046681 | Unclassified | 1115 |
| 492 | Ga0495658_0000743 | 3300046683 | Bacteria | 17574 |
| 493 | Ga0495613_0051507 | 3300046689 | Bacteria | 3033 |
| 494 | Ga0495613_0532529 | 3300046689 | Bacteria | 788 |
| 495 | Ga0495624_0011560 | 3300046690 | Bacteria | 6064 |
| 496 | Ga0495624_0120210 | 3300046690 | Bacteria | 1613 |
| 497 | Ga0495600_0159910 | 3300046809 | Bacteria | 1456 |
| 498 | Ga0495600_0270596 | 3300046809 | Unclassified | 1078 |
| 499 | Ga0495581_0001695 | 3300047315 | Bacteria | 12267 |
| 500 | Ga0495604_0001028 | 3300047317 | Bacteria | 23261 |
| 501 | Ga0495604_0374527 | 3300047317 | Bacteria | 942 |
| 502 | Ga0495674_0064942 | 3300047319 | Bacteria | 3171 |
| 503 | Ga0495674_0110524 | 3300047319 | Bacteria | 2330 |
| 504 | Ga0495674_0145359 | 3300047319 | Unclassified | 1991 |
| 505 | Ga0495674_0379315 | 3300047319 | Unclassified | 1144 |
| 506 | Ga0495676_0004569 | 3300047321 | Bacteria | 12665 |
| 507 | Ga0495676_0160040 | 3300047321 | Unclassified | 1594 |
| 508 | Ga0495676_0390288 | 3300047321 | Bacteria | 925 |
| 509 | Ga0495680_0001991 | 3300047322 | Bacteria | 21455 |
| 510 | Ga0495680_0028290 | 3300047322 | Bacteria | 4597 |
| 511 | Ga0495680_0029511 | 3300047322 | Bacteria | 4491 |
| 512 | Ga0495680_0119293 | 3300047322 | Bacteria | 1949 |
| 513 | Ga0495680_0358606 | 3300047322 | Unclassified | 1014 |
| 514 | Ga0495675_0000592 | 3300047444 | Bacteria | 23327 |
| 515 | Ga0495677_0073977 | 3300047445 | Unclassified | 1272 |
| 516 | Ga0495684_0016402 | 3300047471 | Bacteria | 5704 |
| 517 | Ga0495684_0018772 | 3300047471 | Bacteria | 5328 |
| 518 | Ga0495684_0061136 | 3300047471 | Bacteria | 2866 |
| 519 | Ga0495684_0070941 | 3300047471 | Unclassified | 2647 |
| 520 | Ga0495684_0194867 | 3300047471 | Unclassified | 1496 |
| 521 | Ga0495593_0012606 | 3300047673 | Bacteria | 4827 |
| 522 | Ga0495593_0110807 | 3300047673 | Bacteria | 1402 |
| 523 | Ga0495602_0001484 | 3300048088 | Bacteria | 23328 |
| 524 | Ga0495602_0261104 | 3300048088 | Bacteria | 1285 |
| 525 | Ga0495614_0003232 | 3300048089 | Bacteria | 7277 |
| 526 | Ga0496100_0022631 | 3300048903 | Bacteria | 3804 |
| 527 | Ga0496100_0024315 | 3300048903 | Bacteria | 3695 |
| 528 | Ga0496100_0088889 | 3300048903 | Unclassified | 2103 |
| 529 | Ga0496100_0152508 | 3300048903 | Unclassified | 1649 |
| 530 | Ga0496100_0209177 | 3300048903 | Bacteria | 1426 |
| 531 | Ga0496100_0735781 | 3300048903 | Unclassified | 771 |
| 532 | Ga0496101_0087196 | 3300048904 | Bacteria | 2316 |
| 533 | Ga0496101_0199711 | 3300048904 | Bacteria | 1545 |
| 534 | Ga0496101_0285969 | 3300048904 | Bacteria | 1289 |
| 535 | Ga0496102_0019852 | 3300048905 | Bacteria | 5925 |
| 536 | Ga0496102_0028957 | 3300048905 | Bacteria | 4951 |
| 537 | Ga0496102_0053477 | 3300048905 | Bacteria | 3680 |
| 538 | Ga0496102_0276797 | 3300048905 | Unclassified | 1582 |
| 539 | Ga0496102_0312205 | 3300048905 | Bacteria | 1482 |
| 540 | Ga0496102_0769070 | 3300048905 | Bacteria | 886 |
| 541 | Ga0496102_0865912 | 3300048905 | Unclassified | 825 |
| 542 | Ga0496103_0009819 | 3300048906 | Bacteria | 5668 |
| 543 | Ga0496103_0020360 | 3300048906 | Bacteria | 3984 |
| 544 | Ga0496103_0224071 | 3300048906 | Bacteria | 1209 |
| 545 | Ga0496104_0002589 | 3300048907 | Bacteria | 15603 |
| 546 | Ga0496104_0056729 | 3300048907 | Bacteria | 3705 |
| 547 | Ga0496104_0173940 | 3300048907 | Bacteria | 2064 |
| 548 | Ga0496104_0591932 | 3300048907 | Bacteria | 1019 |
| 549 | Ga0496104_0730574 | 3300048907 | Unclassified | 897 |
| 550 | Ga0496105_0001826 | 3300048908 | Bacteria | 15246 |
| 551 | Ga0496105_0005511 | 3300048908 | Bacteria | 9604 |
| 552 | Ga0496105_0103670 | 3300048908 | Bacteria | 2349 |
| 553 | Ga0496105_0104050 | 3300048908 | Bacteria | 2344 |
| 554 | Ga0496105_0121950 | 3300048908 | Bacteria | 2149 |
| 555 | Ga0496105_0208068 | 3300048908 | Bacteria | 1595 |
| 556 | Ga0496105_0583420 | 3300048908 | Bacteria | 869 |
| 557 | Ga0496106_0003519 | 3300048909 | Bacteria | 11674 |
| 558 | Ga0496106_0003660 | 3300048909 | Bacteria | 11460 |
| 559 | Ga0496106_0250705 | 3300048909 | Unclassified | 1415 |
| 560 | Ga0496106_0373975 | 3300048909 | Bacteria | 1145 |
| 561 | Ga0496107_0002817 | 3300048910 | Bacteria | 11468 |
| 562 | Ga0496107_0004074 | 3300048910 | Bacteria | 9841 |
| 563 | Ga0496107_0107162 | 3300048910 | Bacteria | 2053 |
| 564 | Ga0496107_0153992 | 3300048910 | Unclassified | 1701 |
| 565 | Ga0496107_0252564 | 3300048910 | Bacteria | 1312 |
| 566 | Ga0496108_0004163 | 3300048911 | Bacteria | 11639 |
| 567 | Ga0496108_0133656 | 3300048911 | Bacteria | 2133 |
| 568 | Ga0496108_0368889 | 3300048911 | Bacteria | 1253 |
| 569 | Ga0496108_0636831 | 3300048911 | Bacteria | 927 |
| 570 | Ga0496109_0004035 | 3300048912 | Bacteria | 12262 |
| 571 | Ga0496109_0006873 | 3300048912 | Bacteria | 9593 |
| 572 | Ga0496109_0014997 | 3300048912 | Bacteria | 6744 |
| 573 | Ga0496109_0085652 | 3300048912 | Bacteria | 2909 |
| 574 | Ga0496109_0650066 | 3300048912 | Bacteria | 991 |
| 575 | Ga0496110_0024591 | 3300048913 | Bacteria | 5135 |
| 576 | Ga0496110_0026080 | 3300048913 | Bacteria | 4997 |
| 577 | Ga0496110_0061381 | 3300048913 | Bacteria | 3317 |
| 578 | Ga0496110_0115182 | 3300048913 | Bacteria | 2419 |
| 579 | Ga0496110_0185922 | 3300048913 | Bacteria | 1887 |
| 580 | Ga0496110_0445428 | 3300048913 | Bacteria | 1180 |
| 581 | Ga0496111_0001138 | 3300048914 | Bacteria | 14761 |
| 582 | Ga0496111_0049169 | 3300048914 | Bacteria | 3040 |
| 583 | Ga0496111_0099089 | 3300048914 | Bacteria | 2140 |
| 584 | Ga0496111_0165951 | 3300048914 | Bacteria | 1640 |
| 585 | Ga0496111_0231720 | 3300048914 | Bacteria | 1372 |
| 586 | Ga0496112_0001992 | 3300048915 | Bacteria | 16159 |
| 587 | Ga0496112_0025481 | 3300048915 | Bacteria | 5679 |
| 588 | Ga0496112_0026491 | 3300048915 | Bacteria | 5579 |
| 589 | Ga0496112_0087411 | 3300048915 | Bacteria | 3084 |
| 590 | Ga0496112_0110808 | 3300048915 | Bacteria | 2715 |
| 591 | Ga0496112_0170002 | 3300048915 | Bacteria | 2145 |
| 592 | Ga0496112_0213176 | 3300048915 | Bacteria | 1888 |
| 593 | Ga0496112_0213293 | 3300048915 | Bacteria | 1887 |
| 594 | Ga0496112_0340412 | 3300048915 | Bacteria | 1443 |
| 595 | Ga0496112_0384416 | 3300048915 | Unclassified | 1344 |
| 596 | Ga0496113_0041106 | 3300048916 | Bacteria | 3409 |
| 597 | Ga0496113_0175154 | 3300048916 | Bacteria | 1700 |
| 598 | Ga0496113_0200944 | 3300048916 | Bacteria | 1584 |
| 599 | Ga0496113_0300468 | 3300048916 | Bacteria | 1285 |
| 600 | Ga0496113_0728766 | 3300048916 | Unclassified | 790 |
| 601 | Ga0496114_0044347 | 3300048917 | Bacteria | 3689 |
| 602 | Ga0496114_0170883 | 3300048917 | Bacteria | 1894 |
| 603 | Ga0496114_0239110 | 3300048917 | Bacteria | 1597 |
| 604 | Ga0496114_0320919 | 3300048917 | Bacteria | 1368 |
| 605 | Ga0496115_0009633 | 3300048918 | Bacteria | 7188 |
| 606 | Ga0496115_0057971 | 3300048918 | Unclassified | 3115 |
| 607 | Ga0496115_0162757 | 3300048918 | Bacteria | 1844 |
| 608 | Ga0496115_0477194 | 3300048918 | Bacteria | 1005 |
| 609 | Ga0501031_0002877 | 3300049568 | Bacteria | 11003 |
| 610 | Ga0501034_0390720 | 3300049571 | Unclassified | 1315 |
| 611 | Ga0501036_0010229 | 3300049572 | Bacteria | 7736 |
| 612 | Ga0501036_0014420 | 3300049572 | Bacteria | 6582 |
| 613 | Ga0501037_0026419 | 3300049573 | Bacteria | 4292 |
| 614 | Ga0501038_0111645 | 3300049574 | Unclassified | 2264 |
| 615 | Ga0501039_0034537 | 3300049575 | Bacteria | 3902 |
| 616 | Ga0501041_0006676 | 3300049577 | Bacteria | 6760 |
| 617 | Ga0501042_0004105 | 3300049578 | Bacteria | 9248 |
| 618 | Ga0501042_0143077 | 3300049578 | Unclassified | 1724 |
| 619 | Ga0501042_0496285 | 3300049578 | Bacteria | 886 |
| 620 | Ga0501046_0005156 | 3300049580 | Bacteria | 11712 |
| 621 | Ga0501046_0351763 | 3300049580 | Bacteria | 1070 |
| 622 | Ga0501046_0794110 | 3300049580 | Unclassified | 663 |
| 623 | Ga0501047_0101229 | 3300049581 | Bacteria | 2761 |
| 624 | Ga0501048_0007923 | 3300049582 | Bacteria | 8046 |
| 625 | Ga0501067_0016770 | 3300049583 | Bacteria | 4048 |
| 626 | Ga0501067_0017090 | 3300049583 | Bacteria | 4008 |
| 627 | Ga0501067_0017101 | 3300049583 | Bacteria | 4007 |
| 628 | Ga0501067_0037764 | 3300049583 | Bacteria | 2682 |
| 629 | Ga0501067_0097891 | 3300049583 | Unclassified | 1629 |
| 630 | Ga0501068_0571595 | 3300049584 | Bacteria | 736 |
| 631 | Ga0501069_0028072 | 3300049585 | Unclassified | 3085 |
| 632 | Ga0501069_0038618 | 3300049585 | Bacteria | 2636 |
| 633 | Ga0501069_0104223 | 3300049585 | Unclassified | 1612 |
| 634 | Ga0501069_0460756 | 3300049585 | Unclassified | 756 |
| 635 | Ga0501070_0007274 | 3300049586 | Bacteria | 9398 |
| 636 | Ga0501070_0018543 | 3300049586 | Bacteria | 5838 |
| 637 | Ga0501070_0191466 | 3300049586 | Unclassified | 1681 |
| 638 | Ga0501070_0431002 | 3300049586 | Unclassified | 1064 |
| 639 | Ga0501070_0695794 | 3300049586 | Bacteria | 804 |
| 640 | Ga0501071_0005995 | 3300049587 | Bacteria | 7874 |
| 641 | Ga0501071_0036160 | 3300049587 | Bacteria | 3521 |
| 642 | Ga0501071_0071004 | 3300049587 | Bacteria | 2538 |
| 643 | Ga0501072_0001083 | 3300049588 | Bacteria | 20212 |
| 644 | Ga0501072_0028816 | 3300049588 | Bacteria | 4334 |
| 645 | Ga0501072_0037987 | 3300049588 | Bacteria | 3778 |
| 646 | Ga0501073_0168460 | 3300049589 | Bacteria | 1516 |
| 647 | Ga0501074_0008072 | 3300049590 | Bacteria | 7625 |
| 648 | Ga0501074_0024304 | 3300049590 | Bacteria | 4404 |
| 649 | Ga0501074_0042636 | 3300049590 | Bacteria | 3283 |
| 650 | Ga0501074_0474183 | 3300049590 | Unclassified | 887 |
| 651 | Ga0501075_0005192 | 3300049591 | Bacteria | 8908 |
| 652 | Ga0501075_0010412 | 3300049591 | Bacteria | 6535 |
| 653 | Ga0501076_0008422 | 3300049592 | Bacteria | 7556 |
| 654 | Ga0501076_0702517 | 3300049592 | Bacteria | 835 |
| 655 | Ga0501076_0863811 | 3300049592 | Unclassified | 746 |
| 656 | Ga0501077_0002003 | 3300049593 | Bacteria | 12295 |
| 657 | Ga0501077_0003802 | 3300049593 | Bacteria | 9091 |
| 658 | Ga0501079_0104413 | 3300049741 | Unclassified | 2198 |
| 659 | Ga0501079_0270032 | 3300049741 | Bacteria | 1329 |
| 660 | Ga0501080_0029157 | 3300049742 | Bacteria | 5137 |
| 661 | Ga0501080_0257994 | 3300049742 | Bacteria | 1588 |
| 662 | Ga0501083_0000145 | 3300049744 | Bacteria | 48483 |
| 663 | Ga0501045_0002722 | 3300049824 | Bacteria | 12064 |
| 664 | Ga0501045_0110199 | 3300049824 | Unclassified | 2041 |
| 665 | nmdc:mga05p37_175983_c1 | 3300050507 | Unclassified | 2607 |
| 666 | nmdc:mga0n895_3054_c1 | 3300050512 | Bacteria | 13313 |
| 667 | nmdc:mga0n895_80505_c1 | 3300050512 | Bacteria | 3245 |
| 668 | nmdc:mga0n895_863256_c1 | 3300050512 | Bacteria | 892 |
| 669 | nmdc:mga0rr50_143437_c1 | 3300050513 | Bacteria | 1923 |
| 670 | nmdc:mga08x19_233683_c1 | 3300050514 | Bacteria | 1266 |
| 671 | nmdc:mga0a205_253981_c1 | 3300050515 | Bacteria | 1637 |
| 672 | Ga0495601_0002343 | 3300053077 | Bacteria | 10719 |
| 673 | Ga0495601_0006404 | 3300053077 | Bacteria | 6884 |
| 674 | Ga0495601_0027298 | 3300053077 | Bacteria | 3529 |
| 675 | Ga0495601_0058761 | 3300053077 | Bacteria | 2437 |
| 676 | Ga0495601_0089197 | 3300053077 | Bacteria | 1983 |
| 677 | Ga0495601_0094326 | 3300053077 | Bacteria | 1928 |
| 678 | Ga0495601_0174094 | 3300053077 | Bacteria | 1407 |
| 679 | Ga0495601_0227559 | 3300053077 | Unclassified | 1218 |
| 680 | Ga0495612_0049796 | 3300053078 | Bacteria | 1719 |
| 681 | Ga0495612_0113733 | 3300053078 | Bacteria | 1160 |
| 682 | Ga0495612_0114922 | 3300053078 | Unclassified | 1155 |
| 683 | Ga0495595_0003477 | 3300053084 | Bacteria | 6255 |
| 684 | Ga0495595_0011315 | 3300053084 | Bacteria | 3726 |
| 685 | Ga0495619_0007501 | 3300053085 | Bacteria | 6908 |
| 686 | Ga0495619_0010159 | 3300053085 | Bacteria | 5929 |
| 687 | Ga0495619_0027368 | 3300053085 | Bacteria | 3671 |
| 688 | Ga0495619_0030547 | 3300053085 | Bacteria | 3488 |
| 689 | Ga0501084_0097305 | 3300054114 | Bacteria | 2471 |
| 690 | Ga0590075_033560 | 3300059424 | Bacteria | 1303 |
| 691 | Ga0501082_0004794 | 3300060353 | Bacteria | 11797 |
| 692 | Ga0501082_0040567 | 3300060353 | Bacteria | 4015 |
| 693 | Ga0501082_0286303 | 3300060353 | Unclassified | 1434 |
| 694 | Ga0466962_0008496 | 3300061719 | Bacteria | 4920 |
| 695 | Ga0466962_0153248 | 3300061719 | Bacteria | 1118 |
| 696 | Ga0466962_0166601 | 3300061719 | Bacteria | 1072 |
| 697 | Ga0530510_0002901 | 3300061734 | Bacteria | 11755 |
| 698 | Ga0530510_0064610 | 3300061734 | Unclassified | 2650 |
| 699 | Ga0530510_0101356 | 3300061734 | Bacteria | 2105 |
| 700 | Ga0495630_0450067 | |||
| 701 | Ga0070680_100045841 | |||
| 702 | Ga0070680_100470762 | |||
| 703 | Ga0070682_100026704 | |||
| 704 | Ga0070682_100027607 | |||
| 705 | Ga0070682_100505915 | |||
| 706 | Ga0068868_100042341 | |||
| 707 | Ga0070660_100002731 | |||
| 708 | Ga0070689_100010547 | |||
| 709 | Ga0070661_100050544 | |||
| 710 | Ga0070661_100498891 | |||
| 711 | Ga0070668_100010845 | |||
| 712 | Ga0070675_100047064 | |||
| 713 | Ga0070671_100089760 | |||
| 714 | Ga0070673_100070100 | |||
| 715 | Ga0070659_100086305 | |||
| 716 | Ga0070659_100119919 | |||
| 717 | Ga0070659_100578949 | |||
| 718 | Ga0070709_10014800 | |||
| 719 | Ga0070709_10181123 | |||
| 720 | Ga0070714_100021674 | |||
| 721 | Ga0070714_100030456 | |||
| 722 | Ga0070714_100046425 | |||
| 723 | Ga0070714_100096481 | |||
| 724 | Ga0070714_100531628 | |||
| 725 | Ga0070713_100037211 | |||
| 726 | Ga0070713_100121662 | |||
| 727 | Ga0070713_100367502 | |||
| 728 | Ga0070713_100376567 | |||
| 729 | Ga0070710_10006176 | |||
| 730 | Ga0070710_10006205 | |||
| 731 | Ga0070710_10020745 | |||
| 732 | Ga0070711_100051181 | |||
| 733 | Ga0070711_100071032 | |||
| 734 | Ga0070711_100151947 | |||
| 735 | Ga0070705_100033210 | |||
| 736 | Ga0070705_100129862 | |||
| 737 | Ga0070700_100061729 | |||
| 738 | Ga0070708_100283504 | |||
| 739 | Ga0070663_100011892 | |||
| 740 | Ga0070678_100456954 | |||
| 741 | Ga0070678_100910156 | |||
| 742 | Ga0070681_10003387 | |||
| 743 | Ga0070681_10048080 | |||
| 744 | Ga0070681_10062785 | |||
| 745 | Ga0070681_10070828 | |||
| 746 | Ga0070681_10119792 | |||
| 747 | Ga0070681_10659722 | |||
| 748 | Ga0070681_10766387 | |||
| 749 | Ga0070685_10009736 | |||
| 750 | Ga0070685_10296743 | |||
| 751 | Ga0070706_100316161 | |||
| 752 | Ga0070706_100322262 | |||
| 753 | Ga0070706_101164168 | |||
| 754 | Ga0070707_100001723 | |||
| 755 | Ga0070707_100012654 | |||
| 756 | Ga0070707_100045223 | |||
| 757 | Ga0070707_100158474 | |||
| 758 | Ga0070707_100179480 | |||
| 759 | Ga0070698_100011547 | |||
| 760 | Ga0070699_100929373 | |||
| 761 | Ga0070679_100036609 | |||
| 762 | Ga0070679_100101496 | |||
| 763 | Ga0070679_100118527 | |||
| 764 | Ga0070679_100163272 | |||
| 765 | Ga0070679_100205717 | |||
| 766 | Ga0070679_100211335 | |||
| 767 | Ga0070679_100339736 | |||
| 768 | Ga0070684_100085923 | |||
| 769 | Ga0070684_100260621 | |||
| 770 | Ga0070684_100273849 | |||
| 771 | Ga0070684_100429133 | |||
| 772 | Ga0070684_100564210 | |||
| 773 | Ga0070697_100289493 | |||
| 774 | Ga0070697_100372098 | |||
| 775 | Ga0068853_100022608 | |||
| 776 | Ga0070686_100053614 | |||
| 777 | Ga0070695_100000510 | |||
| 778 | Ga0070696_100098604 | |||
| 779 | Ga0070696_100165315 | |||
| 780 | Ga0070696_100357354 | |||
| 781 | Ga0070693_100015557 | |||
| 782 | Ga0070693_100031268 | |||
| 783 | Ga0068855_100637388 | |||
| 784 | Ga0068855_100790065 | |||
| 785 | Ga0070664_100539748 | |||
| 786 | Ga0068857_100289423 | |||
| 787 | Ga0068857_100485337 | |||
| 788 | Ga0068856_100097222 | |||
| 789 | Ga0068856_100305164 | |||
| 790 | Ga0068856_100344906 | |||
| 791 | Ga0068856_100899572 | |||
| 792 | Ga0070702_100054942 | |||
| 793 | Ga0070702_100059120 | |||
| 794 | Ga0068852_100103245 | |||
| 795 | Ga0068864_100272068 | |||
| 796 | Ga0068861_100509812 | |||
| 797 | Ga0068870_10118214 | |||
| 798 | Ga0068863_100218055 | |||
| 799 | Ga0068858_101003048 | |||
| 800 | Ga0068860_100752838 | |||
| 801 | Ga0081455_10421551 | |||
| 802 | Ga0081538_10063513 | |||
| 803 | Ga0081540_1002106 | |||
| 804 | Ga0081539_10000639 | |||
| 805 | Ga0070717_10001374 | |||
| 806 | Ga0070717_10006435 | |||
| 807 | Ga0070717_10272377 | |||
| 808 | Ga0070715_10003125 | |||
| 809 | Ga0070715_10034171 | |||
| 810 | Ga0070716_100017636 | |||
| 811 | Ga0070716_100123826 | |||
| 812 | Ga0070716_100254056 | |||
| 813 | Ga0070712_100183458 | |||
| 814 | Ga0070712_100196679 | |||
| 815 | Ga0070712_100608539 | |||
| 816 | Ga0068871_100057730 | |||
| 817 | Ga0068871_100615959 | |||
| 818 | Ga0075428_100278008 | |||
| 819 | Ga0075433_10254982 | |||
| 820 | Ga0075434_100000658 | |||
| 821 | Ga0075434_100201965 | |||
| 822 | Ga0075434_100495472 | |||
| 823 | Ga0075434_101112011 | |||
| 824 | Ga0075436_100160242 | |||
| 825 | Ga0105240_10006035 | |||
| 826 | Ga0105245_10143374 | |||
| 827 | Ga0105245_10157227 | |||
| 828 | Ga0114129_10855248 | |||
| 829 | Ga0105243_10011056 | |||
| 830 | Ga0105242_10587955 | |||
| 831 | Ga0105248_10356780 | |||
| 832 | Ga0105237_10016697 | |||
| 833 | Ga0105238_10472575 | |||
| 834 | Ga0105249_10322392 | |||
| 835 | Ga0105249_10676973 | |||
| 836 | Ga0105239_10124886 | |||
| 837 | Ga0105246_10042597 | |||
| 838 | Ga0105246_10182556 | |||
| 839 | Ga0157373_10554331 | |||
| 840 | Ga0157370_10578297 | |||
| 841 | Ga0157369_10029019 | |||
| 842 | Ga0157369_10175518 | |||
| 843 | Ga0157369_10217169 | |||
| 844 | Ga0157369_10432501 | |||
| 845 | Ga0157374_10021299 | |||
| 846 | Ga0157378_10011683 | |||
| 847 | Ga0157372_10225924 | |||
| 848 | Ga0157372_10303640 | |||
| 849 | Ga0157372_10946851 | |||
| 850 | Ga0157375_11134315 | |||
| 851 | Ga0157380_10627141 | |||
| 852 | Ga0182008_10004855 | |||
| 853 | Ga0182008_10066804 | |||
| 854 | Ga0182008_10108297 | |||
| 855 | Ga0157377_10069732 | |||
| 856 | Ga0157379_10461722 | |||
| 857 | Ga0157376_10001857 | |||
| 858 | Ga0157376_10015637 | |||
| 859 | Ga0157376_10095119 | |||
| 860 | Ga0157376_11211206 | |||
| 861 | Ga0182006_1039198 | |||
| 862 | Ga0182007_10013646 | |||
| 863 | Ga0206356_11073177 | |||
| 864 | Ga0206354_11313913 | |||
| 865 | Ga0206353_10203683 | |||
| 866 | Ga0206353_10539657 | |||
| 867 | Ga0207692_10005416 | |||
| 868 | Ga0207692_10292983 | |||
| 869 | Ga0207685_10006844 | |||
| 870 | Ga0207685_10009841 | |||
| 871 | Ga0207699_10006819 | |||
| 872 | Ga0207699_10131461 | |||
| 873 | Ga0207643_10227739 | |||
| 874 | Ga0207684_10215282 | |||
| 875 | Ga0207684_10227393 | |||
| 876 | Ga0207684_10275995 | |||
| 877 | Ga0207654_10060369 | |||
| 878 | Ga0207707_10002423 | |||
| 879 | Ga0207707_10014128 | |||
| 880 | Ga0207707_10049387 | |||
| 881 | Ga0207707_10081162 | |||
| 882 | Ga0207707_10102898 | |||
| 883 | Ga0207707_10250095 | |||
| 884 | Ga0207695_10419020 | |||
| 885 | Ga0207671_10020140 | |||
| 886 | Ga0207693_10000198 | |||
| 887 | Ga0207693_10001236 | |||
| 888 | Ga0207693_10081754 | |||
| 889 | Ga0207693_10175060 | |||
| 890 | Ga0207663_10008665 | |||
| 891 | Ga0207663_10012556 | |||
| 892 | Ga0207663_10138818 | |||
| 893 | Ga0207660_10065950 | |||
| 894 | Ga0207660_10094426 | |||
| 895 | Ga0207660_10642047 | |||
| 896 | Ga0207657_10002416 | |||
| 897 | Ga0207657_10002425 | |||
| 898 | Ga0207657_10015657 | |||
| 899 | Ga0207649_10260809 | |||
| 900 | Ga0207652_10009209 | |||
| 901 | Ga0207652_10028268 | |||
| 902 | Ga0207652_10072944 | |||
| 903 | Ga0207652_10095193 | |||
| 904 | Ga0207652_10130543 | |||
| 905 | Ga0207652_10293177 | |||
| 906 | Ga0207646_10002942 | |||
| 907 | Ga0207646_10005159 | |||
| 908 | Ga0207646_10271622 | |||
| 909 | Ga0207659_10204944 | |||
| 910 | Ga0207687_10120342 | |||
| 911 | Ga0207687_10166137 | |||
| 912 | Ga0207700_10028147 | |||
| 913 | Ga0207700_10228312 | |||
| 914 | Ga0207700_10269414 | |||
| 915 | Ga0207664_10012608 | |||
| 916 | Ga0207664_10061000 | |||
| 917 | Ga0207664_10175951 | |||
| 918 | Ga0207664_10324610 | |||
| 919 | Ga0207664_10727149 | |||
| 920 | Ga0207665_10001160 | |||
| 921 | Ga0207665_10027836 | |||
| 922 | Ga0207665_10376950 | |||
| 923 | Ga0207711_10234488 | |||
| 924 | Ga0207661_10024051 | |||
| 925 | Ga0207661_10091258 | |||
| 926 | Ga0207661_10115742 | |||
| 927 | Ga0207679_10333907 | |||
| 928 | Ga0207667_10668351 | |||
| 929 | Ga0207667_10803499 | |||
| 930 | Ga0207712_10243391 | |||
| 931 | Ga0207677_10173331 | |||
| 932 | Ga0207677_10245920 | |||
| 933 | Ga0207677_10422840 | |||
| 934 | Ga0207677_10730514 | |||
| 935 | Ga0207678_10019548 | |||
| 936 | Ga0207708_10045321 | |||
| 937 | Ga0207641_10107033 | |||
| 938 | Ga0207648_10618603 | |||
| 939 | Ga0207674_10232015 | |||
| 940 | Ga0207675_100378271 | |||
| 941 | Ga0207683_10000547 | |||
| 942 | Ga0207683_10032295 | |||
| 943 | Ga0207683_10170799 | |||
| 944 | Ga0268264_10379114 | |||
| 945 | Ga0265326_10008921 | |||
| 946 | Ga0265319_1002712 | |||
| 947 | Ga0265334_10002234 | |||
| 948 | Ga0265318_10001544 | |||
| 949 | Ga0265322_10006014 | |||
| 950 | Ga0265338_10004407 | |||
| 951 | Ga0265338_10008221 | |||
| 952 | Ga0265338_10012815 | |||
| 953 | Ga0265338_10055700 | |||
| 954 | Ga0265330_10001866 | |||
| 955 | Ga0265332_10003779 | |||
| 956 | Ga0265328_10003180 | |||
| 957 | Ga0265320_10007986 | |||
| 958 | Ga0265325_10009499 | |||
| 959 | Ga0265325_10023137 | |||
| 960 | Ga0265329_10001035 | |||
| 961 | Ga0265340_10004059 | |||
| 962 | Ga0265339_10009114 | |||
| 963 | Ga0265331_10008163 | |||
| 964 | Ga0265327_10006990 | |||
| 965 | Ga0265316_10010133 | |||
| 966 | Ga0265316_10322399 | |||
| 967 | Ga0265313_10005752 | |||
| 968 | Ga0265314_10007362 | |||
| 969 | Ga0265314_10102010 | |||
| 970 | Ga0265342_10004699 | |||
| 971 | Ga0307407_10200220 | |||
| 972 | Ga0307409_100380942 | |||
| 973 | Ga0307409_100440942 | |||
| 974 | Ga0307409_100904595 | |||
| 975 | Ga0307416_100020746 | |||
| 976 | Ga0307416_100032934 | |||
| 977 | Ga0307415_100022120 | |||
| 978 | Ga0307415_100984643 | |||
| 979 | Ga0373950_0041180 | |||
| 980 | Ga0373952_0008766 | |||
| 981 | Ga0373953_0307674 | |||
| 982 | Ga0373931_0044670 | |||
| 983 | Ga0373931_0114539 | |||
| 984 | Ga0373931_0568724 | |||
| 985 | Ga0373927_0190470 | |||
| 986 | Ga0373947_0007729 | |||
| 987 | Ga0373947_0254543 | |||
| 988 | Ga0373937_0002702 | |||
| 989 | Ga0373937_0028480 | |||
| 990 | Ga0373937_0295640 | |||
| 991 | Ga0373925_0000887 | |||
| 992 | Ga0395899_0006269 | |||
| 993 | Ga0395899_0034792 | |||
| 994 | Ga0395899_0103849 | |||
| 995 | Ga0395900_0003567 | |||
| 996 | Ga0395900_0008695 | |||
| 997 | Ga0395900_0083645 | |||
| 998 | Ga0395900_0091641 | |||
| 999 | Ga0395900_0261897 | |||
| 1000 | Ga0395900_0598698 | |||
| 1001 | Ga0395898_0003871 | |||
| 1002 | Ga0395898_0006288 | |||
| 1003 | Ga0395898_0007490 | |||
| 1004 | Ga0395898_0009281 | |||
| 1005 | Ga0395898_0177994 | |||
| 1006 | Ga0395905_0007967 | |||
| 1007 | Ga0395905_0018017 | |||
| 1008 | Ga0395905_0055618 | |||
| 1009 | Ga0395905_0071096 | |||
| 1010 | Ga0395905_0148278 | |||
| 1011 | Ga0395905_0192381 | |||
| 1012 | Ga0395901_0009578 | |||
| 1013 | Ga0395901_0043951 | |||
| 1014 | Ga0395901_0052280 | |||
| 1015 | Ga0395901_0066955 | |||
| 1016 | Ga0395901_0078551 | |||
| 1017 | Ga0395901_0278186 | |||
| 1018 | Ga0395901_0332770 | |||
| 1019 | Ga0395901_0667205 | |||
| 1020 | Ga0395901_0678461 | |||
| 1021 | Ga0395901_1208199 | |||
| 1022 | Ga0436360_0147319 | |||
| 1023 | Ga0439465_0140391 | |||
| 1024 | Ga0439445_0047446 | |||
| 1025 | Ga0439448_0000767 | |||
| 1026 | Ga0439455_0004717 | |||
| 1027 | Ga0439446_0020120 | |||
| 1028 | Ga0466969_0025650 | |||
| 1029 | Ga0466969_0073259 | |||
| 1030 | Ga0466972_0030506 | |||
| 1031 | Ga0466965_0033614 | |||
| 1032 | Ga0466965_0068964 | |||
| 1033 | Ga0466966_0001983 | |||
| 1034 | Ga0466966_0284296 | |||
| 1035 | Ga0466961_0005297 | |||
| 1036 | Ga0466961_0056955 | |||
| 1037 | Ga0466961_0094880 | |||
| 1038 | Ga0466961_0167980 | |||
| 1039 | Ga0466961_0217040 | |||
| 1040 | Ga0466961_0538827 | |||
| 1041 | Ga0466963_0000263 | |||
| 1042 | Ga0466963_0000765 | |||
| 1043 | Ga0466963_0006931 | |||
| 1044 | Ga0466963_0007646 | |||
| 1045 | Ga0466963_0008632 | |||
| 1046 | Ga0466963_0010452 | |||
| 1047 | Ga0466963_0020715 | |||
| 1048 | Ga0466963_0030651 | |||
| 1049 | Ga0466963_0032571 | |||
| 1050 | Ga0466963_0041587 | |||
| 1051 | Ga0466963_0095998 | |||
| 1052 | Ga0466963_0134588 | |||
| 1053 | Ga0466963_0343285 | |||
| 1054 | Ga0466964_0006723 | |||
| 1055 | Ga0466964_0015615 | |||
| 1056 | Ga0466964_0034626 | |||
| 1057 | Ga0466964_0045312 | |||
| 1058 | Ga0466971_0076149 | |||
| 1059 | Ga0466971_0147939 | |||
| 1060 | Ga0466968_0003004 | |||
| 1061 | Ga0466968_0005657 | |||
| 1062 | Ga0466968_0034121 | |||
| 1063 | Ga0466968_0041944 | |||
| 1064 | Ga0466968_0246605 | |||
| 1065 | Ga0466970_0026018 | |||
| 1066 | Ga0466957_0010565 | |||
| 1067 | Ga0466957_0016733 | |||
| 1068 | Ga0466957_0034159 | |||
| 1069 | Ga0466957_0045872 | |||
| 1070 | Ga0466957_0060222 | |||
| 1071 | Ga0466957_0166841 | |||
| 1072 | Ga0466957_0190359 | |||
| 1073 | Ga0466960_0198271 | |||
| 1074 | Ga0466960_0214465 | |||
| 1075 | Ga0466960_0559974 | |||
| 1076 | Ga0466959_0001526 | |||
| 1077 | Ga0466959_0008342 | |||
| 1078 | Ga0466959_0043115 | |||
| 1079 | Ga0466959_0402916 | |||
| 1080 | Ga0466958_0004302 | |||
| 1081 | Ga0466958_0030007 | |||
| 1082 | Ga0466958_0035418 | |||
| 1083 | Ga0466958_0070974 | |||
| 1084 | Ga0466958_0128753 | |||
| 1085 | Ga0466958_0336099 | |||
| 1086 | Ga0466958_0414182 | |||
| 1087 | Ga0466967_0004788 | |||
| 1088 | Ga0466967_0005119 | |||
| 1089 | Ga0466967_0018144 | |||
| 1090 | Ga0466967_0021993 | |||
| 1091 | Ga0466967_0024946 | |||
| 1092 | Ga0466967_0025022 | |||
| 1093 | Ga0466967_0027167 | |||
| 1094 | Ga0466967_0035234 | |||
| 1095 | Ga0466967_0035398 | |||
| 1096 | Ga0466967_0055424 | |||
| 1097 | Ga0466967_0056092 | |||
| 1098 | Ga0466967_0060645 | |||
| 1099 | Ga0466967_0068277 | |||
| 1100 | Ga0466967_0074603 | |||
| 1101 | Ga0466967_0096649 | |||
| 1102 | Ga0466967_0121175 | |||
| 1103 | Ga0466967_0137560 | |||
| 1104 | Ga0466967_0148017 | |||
| 1105 | Ga0466967_0176206 | |||
| 1106 | Ga0466967_0180674 | |||
| 1107 | Ga0466967_0298323 | |||
| 1108 | Ga0466967_0567874 | |||
| 1109 | Ga0495592_0000708 | |||
| 1110 | Ga0495592_0076909 | |||
| 1111 | Ga0495629_0062362 | |||
| 1112 | Ga0495641_0002032 | |||
| 1113 | Ga0495641_0026466 | |||
| 1114 | Ga0495641_0155397 | |||
| 1115 | Ga0495641_0157838 | |||
| 1116 | Ga0495641_0333225 | |||
| 1117 | Ga0495651_0000885 | |||
| 1118 | Ga0495651_0074101 | |||
| 1119 | Ga0495653_0001808 | |||
| 1120 | Ga0495653_0070043 | |||
| 1121 | Ga0495653_0092604 | |||
| 1122 | Ga0495653_0235802 | |||
| 1123 | Ga0495653_0448898 | |||
| 1124 | Ga0495582_0003738 | |||
| 1125 | Ga0495605_0135524 | |||
| 1126 | Ga0495639_0000458 | |||
| 1127 | Ga0495662_0000722 | |||
| 1128 | Ga0495662_0189357 | |||
| 1129 | Ga0495664_0375146 | |||
| 1130 | Ga0495584_0222678 | |||
| 1131 | Ga0495596_0017276 | |||
| 1132 | Ga0495596_0058064 | |||
| 1133 | Ga0495607_0149108 | |||
| 1134 | Ga0495607_0251348 | |||
| 1135 | Ga0495608_0002754 | |||
| 1136 | Ga0495608_0014276 | |||
| 1137 | Ga0495608_0158698 | |||
| 1138 | Ga0495618_0025634 | |||
| 1139 | Ga0495618_0192554 | |||
| 1140 | Ga0495628_0001243 | |||
| 1141 | Ga0495628_0047594 | |||
| 1142 | Ga0495630_0001392 | |||
| 1143 | Ga0495630_0073121 | |||
| 1144 | Ga0495630_0402012 | |||
| 1145 | Ga0495631_0131856 | |||
| 1146 | Ga0495666_0000065 | |||
| 1147 | Ga0495642_0052294 | |||
| 1148 | Ga0495652_0003720 | |||
| 1149 | Ga0495652_0051952 | |||
| 1150 | Ga0495652_0156929 | |||
| 1151 | Ga0495652_0230813 | |||
| 1152 | Ga0495665_0006872 | |||
| 1153 | Ga0495640_0002040 | |||
| 1154 | Ga0495640_0153750 | |||
| 1155 | Ga0495640_0334548 | |||
| 1156 | Ga0495586_0028621 | |||
| 1157 | Ga0495586_0033020 | |||
| 1158 | Ga0495587_0000675 | |||
| 1159 | Ga0495587_0080742 | |||
| 1160 | Ga0495587_0124913 | |||
| 1161 | Ga0495587_0222156 | |||
| 1162 | Ga0495609_0077826 | |||
| 1163 | Ga0495645_0000684 | |||
| 1164 | Ga0495667_0040047 | |||
| 1165 | Ga0495667_0083909 | |||
| 1166 | Ga0495667_0166773 | |||
| 1167 | Ga0495656_0188933 | |||
| 1168 | Ga0495634_0015172 | |||
| 1169 | Ga0495634_0052284 | |||
| 1170 | Ga0495634_0083509 | |||
| 1171 | Ga0495635_0004316 | |||
| 1172 | Ga0495635_0053968 | |||
| 1173 | Ga0495661_0120468 | |||
| 1174 | Ga0495588_0289643 | |||
| 1175 | Ga0495657_0019820 | |||
| 1176 | Ga0495657_0126959 | |||
| 1177 | Ga0495657_0402418 | |||
| 1178 | Ga0495599_0000455 | |||
| 1179 | Ga0495599_0009532 | |||
| 1180 | Ga0495599_0221946 | |||
| 1181 | Ga0495599_0331447 | |||
| 1182 | Ga0495623_0001619 | |||
| 1183 | Ga0495623_0335254 | |||
| 1184 | Ga0495646_0010255 | |||
| 1185 | Ga0495646_0088612 | |||
| 1186 | Ga0495646_0140123 | |||
| 1187 | Ga0495646_0195360 | |||
| 1188 | Ga0495647_0000075 | |||
| 1189 | Ga0495647_0030715 | |||
| 1190 | Ga0495647_0117602 | |||
| 1191 | Ga0495658_0000743 | |||
| 1192 | Ga0495613_0051507 | |||
| 1193 | Ga0495613_0532529 | |||
| 1194 | Ga0495624_0011560 | |||
| 1195 | Ga0495624_0120210 | |||
| 1196 | Ga0495600_0159910 | |||
| 1197 | Ga0495600_0270596 | |||
| 1198 | Ga0495581_0001695 | |||
| 1199 | Ga0495604_0001028 | |||
| 1200 | Ga0495604_0374527 | |||
| 1201 | Ga0495674_0064942 | |||
| 1202 | Ga0495674_0110524 | |||
| 1203 | Ga0495674_0145359 | |||
| 1204 | Ga0495674_0379315 | |||
| 1205 | Ga0495676_0004569 | |||
| 1206 | Ga0495676_0160040 | |||
| 1207 | Ga0495676_0390288 | |||
| 1208 | Ga0495680_0001991 | |||
| 1209 | Ga0495680_0028290 | |||
| 1210 | Ga0495680_0029511 | |||
| 1211 | Ga0495680_0119293 | |||
| 1212 | Ga0495680_0358606 | |||
| 1213 | Ga0495675_0000592 | |||
| 1214 | Ga0495677_0073977 | |||
| 1215 | Ga0495684_0016402 | |||
| 1216 | Ga0495684_0018772 | |||
| 1217 | Ga0495684_0061136 | |||
| 1218 | Ga0495684_0070941 | |||
| 1219 | Ga0495684_0194867 | |||
| 1220 | Ga0495593_0012606 | |||
| 1221 | Ga0495593_0110807 | |||
| 1222 | Ga0495602_0001484 | |||
| 1223 | Ga0495602_0261104 | |||
| 1224 | Ga0495614_0003232 | |||
| 1225 | Ga0496100_0022631 | |||
| 1226 | Ga0496100_0024315 | |||
| 1227 | Ga0496100_0088889 | |||
| 1228 | Ga0496100_0152508 | |||
| 1229 | Ga0496100_0209177 | |||
| 1230 | Ga0496100_0735781 | |||
| 1231 | Ga0496101_0087196 | |||
| 1232 | Ga0496101_0199711 | |||
| 1233 | Ga0496101_0285969 | |||
| 1234 | Ga0496102_0019852 | |||
| 1235 | Ga0496102_0028957 | |||
| 1236 | Ga0496102_0053477 | |||
| 1237 | Ga0496102_0276797 | |||
| 1238 | Ga0496102_0312205 | |||
| 1239 | Ga0496102_0769070 | |||
| 1240 | Ga0496102_0865912 | |||
| 1241 | Ga0496103_0009819 | |||
| 1242 | Ga0496103_0020360 | |||
| 1243 | Ga0496103_0224071 | |||
| 1244 | Ga0496104_0002589 | |||
| 1245 | Ga0496104_0056729 | |||
| 1246 | Ga0496104_0173940 | |||
| 1247 | Ga0496104_0591932 | |||
| 1248 | Ga0496104_0730574 | |||
| 1249 | Ga0496105_0001826 | |||
| 1250 | Ga0496105_0005511 | |||
| 1251 | Ga0496105_0103670 | |||
| 1252 | Ga0496105_0104050 | |||
| 1253 | Ga0496105_0121950 | |||
| 1254 | Ga0496105_0208068 | |||
| 1255 | Ga0496105_0583420 | |||
| 1256 | Ga0496106_0003519 | |||
| 1257 | Ga0496106_0003660 | |||
| 1258 | Ga0496106_0250705 | |||
| 1259 | Ga0496106_0373975 | |||
| 1260 | Ga0496107_0002817 | |||
| 1261 | Ga0496107_0004074 | |||
| 1262 | Ga0496107_0107162 | |||
| 1263 | Ga0496107_0153992 | |||
| 1264 | Ga0496107_0252564 | |||
| 1265 | Ga0496108_0004163 | |||
| 1266 | Ga0496108_0133656 | |||
| 1267 | Ga0496108_0368889 | |||
| 1268 | Ga0496108_0636831 | |||
| 1269 | Ga0496109_0004035 | |||
| 1270 | Ga0496109_0006873 | |||
| 1271 | Ga0496109_0014997 | |||
| 1272 | Ga0496109_0085652 | |||
| 1273 | Ga0496109_0650066 | |||
| 1274 | Ga0496110_0024591 | |||
| 1275 | Ga0496110_0026080 | |||
| 1276 | Ga0496110_0061381 | |||
| 1277 | Ga0496110_0115182 | |||
| 1278 | Ga0496110_0185922 | |||
| 1279 | Ga0496110_0445428 | |||
| 1280 | Ga0496111_0001138 | |||
| 1281 | Ga0496111_0049169 | |||
| 1282 | Ga0496111_0099089 | |||
| 1283 | Ga0496111_0165951 | |||
| 1284 | Ga0496111_0231720 | |||
| 1285 | Ga0496112_0001992 | |||
| 1286 | Ga0496112_0025481 | |||
| 1287 | Ga0496112_0026491 | |||
| 1288 | Ga0496112_0087411 | |||
| 1289 | Ga0496112_0110808 | |||
| 1290 | Ga0496112_0170002 | |||
| 1291 | Ga0496112_0213176 | |||
| 1292 | Ga0496112_0213293 | |||
| 1293 | Ga0496112_0340412 | |||
| 1294 | Ga0496112_0384416 | |||
| 1295 | Ga0496113_0041106 | |||
| 1296 | Ga0496113_0175154 | |||
| 1297 | Ga0496113_0200944 | |||
| 1298 | Ga0496113_0300468 | |||
| 1299 | Ga0496113_0728766 | |||
| 1300 | Ga0496114_0044347 | |||
| 1301 | Ga0496114_0170883 | |||
| 1302 | Ga0496114_0239110 | |||
| 1303 | Ga0496114_0320919 | |||
| 1304 | Ga0496115_0009633 | |||
| 1305 | Ga0496115_0057971 | |||
| 1306 | Ga0496115_0162757 | |||
| 1307 | Ga0496115_0477194 | |||
| 1308 | Ga0501031_0002877 | |||
| 1309 | Ga0501034_0390720 | |||
| 1310 | Ga0501036_0010229 | |||
| 1311 | Ga0501036_0014420 | |||
| 1312 | Ga0501037_0026419 | |||
| 1313 | Ga0501038_0111645 | |||
| 1314 | Ga0501039_0034537 | |||
| 1315 | Ga0501041_0006676 | |||
| 1316 | Ga0501042_0004105 | |||
| 1317 | Ga0501042_0143077 | |||
| 1318 | Ga0501042_0496285 | |||
| 1319 | Ga0501046_0005156 | |||
| 1320 | Ga0501046_0351763 | |||
| 1321 | Ga0501046_0794110 | |||
| 1322 | Ga0501047_0101229 | |||
| 1323 | Ga0501048_0007923 | |||
| 1324 | Ga0501067_0016770 | |||
| 1325 | Ga0501067_0017090 | |||
| 1326 | Ga0501067_0017101 | |||
| 1327 | Ga0501067_0037764 | |||
| 1328 | Ga0501067_0097891 | |||
| 1329 | Ga0501068_0571595 | |||
| 1330 | Ga0501069_0028072 | |||
| 1331 | Ga0501069_0038618 | |||
| 1332 | Ga0501069_0104223 | |||
| 1333 | Ga0501069_0460756 | |||
| 1334 | Ga0501070_0007274 | |||
| 1335 | Ga0501070_0018543 | |||
| 1336 | Ga0501070_0191466 | |||
| 1337 | Ga0501070_0431002 | |||
| 1338 | Ga0501070_0695794 | |||
| 1339 | Ga0501071_0005995 | |||
| 1340 | Ga0501071_0036160 | |||
| 1341 | Ga0501071_0071004 | |||
| 1342 | Ga0501072_0001083 | |||
| 1343 | Ga0501072_0028816 | |||
| 1344 | Ga0501072_0037987 | |||
| 1345 | Ga0501073_0168460 | |||
| 1346 | Ga0501074_0008072 | |||
| 1347 | Ga0501074_0024304 | |||
| 1348 | Ga0501074_0042636 | |||
| 1349 | Ga0501074_0474183 | |||
| 1350 | Ga0501075_0005192 | |||
| 1351 | Ga0501075_0010412 | |||
| 1352 | Ga0501076_0008422 | |||
| 1353 | Ga0501076_0702517 | |||
| 1354 | Ga0501076_0863811 | |||
| 1355 | Ga0501077_0002003 | |||
| 1356 | Ga0501077_0003802 | |||
| 1357 | Ga0501079_0104413 | |||
| 1358 | Ga0501079_0270032 | |||
| 1359 | Ga0501080_0029157 | |||
| 1360 | Ga0501080_0257994 | |||
| 1361 | Ga0501083_0000145 | |||
| 1362 | Ga0501045_0002722 | |||
| 1363 | Ga0501045_0110199 | |||
| 1364 | nmdc:mga05p37_175983_c1 | |||
| 1365 | nmdc:mga0n895_3054_c1 | |||
| 1366 | nmdc:mga0n895_80505_c1 | |||
| 1367 | nmdc:mga0n895_863256_c1 | |||
| 1368 | nmdc:mga0rr50_143437_c1 | |||
| 1369 | nmdc:mga08x19_233683_c1 | |||
| 1370 | nmdc:mga0a205_253981_c1 | |||
| 1371 | Ga0495601_0002343 | |||
| 1372 | Ga0495601_0006404 | |||
| 1373 | Ga0495601_0027298 | |||
| 1374 | Ga0495601_0058761 | |||
| 1375 | Ga0495601_0089197 | |||
| 1376 | Ga0495601_0094326 | |||
| 1377 | Ga0495601_0174094 | |||
| 1378 | Ga0495601_0227559 | |||
| 1379 | Ga0495612_0049796 | |||
| 1380 | Ga0495612_0113733 | |||
| 1381 | Ga0495612_0114922 | |||
| 1382 | Ga0495595_0003477 | |||
| 1383 | Ga0495595_0011315 | |||
| 1384 | Ga0495619_0007501 | |||
| 1385 | Ga0495619_0010159 | |||
| 1386 | Ga0495619_0027368 | |||
| 1387 | Ga0495619_0030547 | |||
| 1388 | Ga0501084_0097305 | |||
| 1389 | Ga0590075_033560 | |||
| 1390 | Ga0501082_0004794 | |||
| 1391 | Ga0501082_0040567 | |||
| 1392 | Ga0501082_0286303 | |||
| 1393 | Ga0466962_0008496 | |||
| 1394 | Ga0466962_0153248 | |||
| 1395 | Ga0466962_0166601 | |||
| 1396 | Ga0530510_0002901 | |||
| 1397 | Ga0530510_0064610 | |||
| 1398 | Ga0530510_0101356 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.8021 | 14 | 207 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.7945 | 14 | 207 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7847 | 12 | 200 |
| 6ajq-assembly1.cif.gz_A | e52q mutant form of uracil dna glycosylase x from mycobacterium smegmatis. | 0.7841 | 14 | 195 |
| 8iiq-assembly1.cif.gz_A | msmudgx h109s/e52n double mutant | 0.778 | 15 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8081 | 14 | 207 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7852 | 14 | 207 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7787 | 12 | 200 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7601 | 12 | 200 | 3.40.470.10 |
| 3ikbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7468 | 14 | 207 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538IF52-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.984 | 5 | 201 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7V9KYX2-F1-model_v4 | Uracil-DNA glycosylase family protein | 0.9745 | 6 | 204 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7V9JI02-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.971 | 2 | 206 |
GO:0006281
GO:0046677 GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7W0PZB9-F1-model_v4 | Uracil-DNA glycosylase | 0.9693 | 37 | 201 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A538HFQ1-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.969 | 1 | 206 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |