F476029

General Info

Members Datasets Scaffolds Average Seq Length
699 269 1398 291

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10428840|Ga0207652_104288402
Length 293
Sequence MKRIFLFIVTNLAVVVVLSVVLHLFGLDRSLAMRGIDYRSLLLYSLVVGFTGAIISLLMSKSMAKWSTGAHVIEQPQNEAEAWLVETVRKLAQQVNIAMPEIAIYEGEPNAFATGAFKNSALVAVSTGLLQSMNREEAQAVLGHEISHVANGDMVTLTLIQGVVNTFVVFLSRIVGSIVDRAVFRNDRDYAGPGYMITVLVCQVVFGILASLIVAWFSRYREYRADAGSARLLGPLPMIHALQRLGGLQAGALPKGFRSFGIAGDGGLASLFASHPPIEKRIEALQHVQATGA

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10428840 3300025921 Bacteria 1192
2 JGI24034J26672_10008151 3300002239 Bacteria 1527
3 JGI24751J29686_10033573 3300002459 Bacteria 1064
4 Ga0065707_10142014 3300005295 Bacteria 1760
5 Ga0070658_10046404 3300005327 Bacteria 3516
6 Ga0070658_10435434 3300005327 Bacteria 1129
7 Ga0070676_10013922 3300005328 Bacteria 4413
8 Ga0070676_10096586 3300005328 Bacteria 1819
9 Ga0070676_10310701 3300005328 Bacteria 1072
10 Ga0070683_100004039 3300005329 Bacteria 12016
11 Ga0070683_100021766 3300005329 Bacteria 5723
12 Ga0070683_100071580 3300005329 Bacteria 3235
13 Ga0070683_100234239 3300005329 Bacteria 1746
14 Ga0070690_100011643 3300005330 Bacteria 5151
15 Ga0070690_100016902 3300005330 Bacteria 4379
16 Ga0070670_100028203 3300005331 Bacteria 4831
17 Ga0070670_100045408 3300005331 Bacteria 3777
18 Ga0070670_100046273 3300005331 Bacteria 3741
19 Ga0070670_100049848 3300005331 Bacteria 3599
20 Ga0068869_100000798 3300005334 Bacteria 17966
21 Ga0068869_100008299 3300005334 Bacteria 6690
22 Ga0068869_100043514 3300005334 Bacteria 3225
23 Ga0068869_100254187 3300005334 Bacteria 1405
24 Ga0068869_100275701 3300005334 Bacteria 1351
25 Ga0070666_10004718 3300005335 Bacteria 8335
26 Ga0070666_10008499 3300005335 Bacteria 6377
27 Ga0070666_10027339 3300005335 Bacteria 3735
28 Ga0070680_100020288 3300005336 Bacteria 5274
29 Ga0070680_100020396 3300005336 Bacteria 5261
30 Ga0068868_100008208 3300005338 Bacteria 7470
31 Ga0068868_100016847 3300005338 Bacteria 5435
32 Ga0068868_100058669 3300005338 Bacteria 3043
33 Ga0068868_100124584 3300005338 Bacteria 2104
34 Ga0070660_100002491 3300005339 Bacteria 12640
35 Ga0070660_100021392 3300005339 Bacteria 4770
36 Ga0070660_100039887 3300005339 Bacteria 3570
37 Ga0070660_100087979 3300005339 Bacteria 2446
38 Ga0070660_100225833 3300005339 Bacteria 1523
39 Ga0070689_100000516 3300005340 Bacteria 22793
40 Ga0070689_100009420 3300005340 Bacteria 6924
41 Ga0070689_100026271 3300005340 Bacteria 4382
42 Ga0070689_100275614 3300005340 Bacteria 1394
43 Ga0070689_100525102 3300005340 Bacteria 1017
44 Ga0070687_100047177 3300005343 Bacteria 2208
45 Ga0070661_100002610 3300005344 Bacteria 12360
46 Ga0070661_100005939 3300005344 Bacteria 8409
47 Ga0070661_100008060 3300005344 Bacteria 7271
48 Ga0070661_100023347 3300005344 Bacteria 4432
49 Ga0070661_100143319 3300005344 Bacteria 1802
50 Ga0070661_100164751 3300005344 Bacteria 1680
51 Ga0070692_10116576 3300005345 Bacteria 1484
52 Ga0070668_100010286 3300005347 Bacteria 6945
53 Ga0070668_100029856 3300005347 Bacteria 4142
54 Ga0070668_100032199 3300005347 Bacteria 3990
55 Ga0070668_100136564 3300005347 Bacteria 1973
56 Ga0070669_100001002 3300005353 Bacteria 20558
57 Ga0070669_100010129 3300005353 Bacteria 6706
58 Ga0070669_100096871 3300005353 Bacteria 2220
59 Ga0070669_100184519 3300005353 Bacteria 1634
60 Ga0070675_100016434 3300005354 Bacteria 5873
61 Ga0070675_100040803 3300005354 Bacteria 3791
62 Ga0070675_100109242 3300005354 Bacteria 2337
63 Ga0070671_100005429 3300005355 Bacteria 10175
64 Ga0070671_100006873 3300005355 Bacteria 9110
65 Ga0070671_100007647 3300005355 Bacteria 8640
66 Ga0070671_100131619 3300005355 Bacteria 2107
67 Ga0070673_100024146 3300005364 Bacteria 4453
68 Ga0070673_100060028 3300005364 Bacteria 3012
69 Ga0070673_100095488 3300005364 Bacteria 2439
70 Ga0070673_100258681 3300005364 Bacteria 1520
71 Ga0070673_100290433 3300005364 Bacteria 1437
72 Ga0070673_100354363 3300005364 Bacteria 1303
73 Ga0070673_100420785 3300005364 Bacteria 1198
74 Ga0070688_100000315 3300005365 Bacteria 24706
75 Ga0070688_100004898 3300005365 Bacteria 7004
76 Ga0070688_100078653 3300005365 Bacteria 2128
77 Ga0070659_100003342 3300005366 Bacteria 11413
78 Ga0070659_100003585 3300005366 Bacteria 11042
79 Ga0070659_100006802 3300005366 Bacteria 8277
80 Ga0070659_100107992 3300005366 Bacteria 2244
81 Ga0070659_100241805 3300005366 Bacteria 1494
82 Ga0070659_100244821 3300005366 Bacteria 1485
83 Ga0070667_100028736 3300005367 Bacteria 4630
84 Ga0070667_100060915 3300005367 Bacteria 3194
85 Ga0070667_100146160 3300005367 Bacteria 2074
86 Ga0070667_100181957 3300005367 Bacteria 1859
87 Ga0070667_100255026 3300005367 Bacteria 1569
88 Ga0070709_10004947 3300005434 Bacteria 7201
89 Ga0070709_10129378 3300005434 Bacteria 1722
90 Ga0070709_10220373 3300005434 Bacteria 1353
91 Ga0070714_100000881 3300005435 Bacteria 21343
92 Ga0070714_100008597 3300005435 Bacteria 7988
93 Ga0070714_100192774 3300005435 Bacteria 1860
94 Ga0070713_100007661 3300005436 Bacteria 7599
95 Ga0070710_10017890 3300005437 Bacteria 3638
96 Ga0070701_10003210 3300005438 Bacteria 6438
97 Ga0070711_100071956 3300005439 Bacteria 2438
98 Ga0070705_100256683 3300005440 Bacteria 1230
99 Ga0070700_100029313 3300005441 Bacteria 3280
100 Ga0070700_100238057 3300005441 Bacteria 1299
101 Ga0070663_100003516 3300005455 Bacteria 9045
102 Ga0070663_100018475 3300005455 Bacteria 4573
103 Ga0070663_100033233 3300005455 Bacteria 3562
104 Ga0070663_100108832 3300005455 Bacteria 2079
105 Ga0070678_100010882 3300005456 Bacteria 5580
106 Ga0070678_100032008 3300005456 Bacteria 3634
107 Ga0070662_100000340 3300005457 Bacteria 28030
108 Ga0070662_100049624 3300005457 Bacteria 3027
109 Ga0070662_100117974 3300005457 Bacteria 2030
110 Ga0070681_10126294 3300005458 Bacteria 2490
111 Ga0070681_10215967 3300005458 Bacteria 1834
112 Ga0068867_100002597 3300005459 Bacteria 12738
113 Ga0070685_10003123 3300005466 Bacteria 8423
114 Ga0070685_10007664 3300005466 Bacteria 5525
115 Ga0070685_10064034 3300005466 Bacteria 2161
116 Ga0070706_100008890 3300005467 Bacteria 9353
117 Ga0070707_100276713 3300005468 Bacteria 1632
118 Ga0070698_100031587 3300005471 Bacteria 5489
119 Ga0070699_100177794 3300005518 Bacteria 1888
120 Ga0070679_100086422 3300005530 Bacteria 3123
121 Ga0070679_100105851 3300005530 Bacteria 2799
122 Ga0070679_100272376 3300005530 Bacteria 1647
123 Ga0070679_100308678 3300005530 Bacteria 1532
124 Ga0070679_100405493 3300005530 Bacteria 1309
125 Ga0070684_100003132 3300005535 Bacteria 12343
126 Ga0070684_100037056 3300005535 Bacteria 4181
127 Ga0070697_100012449 3300005536 Bacteria 6666
128 Ga0068853_100005128 3300005539 Bacteria 10239
129 Ga0068853_100053541 3300005539 Bacteria 3475
130 Ga0068853_100273004 3300005539 Bacteria 1557
131 Ga0070672_100000746 3300005543 Bacteria 19295
132 Ga0070672_100093615 3300005543 Bacteria 2428
133 Ga0070672_100231243 3300005543 Bacteria 1553
134 Ga0070672_100279768 3300005543 Bacteria 1410
135 Ga0070686_100006481 3300005544 Bacteria 6509
136 Ga0070686_100078944 3300005544 Bacteria 2175
137 Ga0070696_100002786 3300005546 Bacteria 11603
138 Ga0070696_100078747 3300005546 Bacteria 2331
139 Ga0070693_100009987 3300005547 Bacteria 4738
140 Ga0070704_100087393 3300005549 Bacteria 2314
141 Ga0068855_100003919 3300005563 Bacteria 18171
142 Ga0068855_100009230 3300005563 Bacteria 11912
143 Ga0068855_100073797 3300005563 Bacteria 3963
144 Ga0068855_100107952 3300005563 Bacteria 3197
145 Ga0068855_100204675 3300005563 Bacteria 2221
146 Ga0068855_100252683 3300005563 Bacteria 1966
147 Ga0070664_100006183 3300005564 Bacteria 9676
148 Ga0070664_100010088 3300005564 Bacteria 7657
149 Ga0070664_100020841 3300005564 Bacteria 5400
150 Ga0070664_100034824 3300005564 Bacteria 4225
151 Ga0070664_100097910 3300005564 Bacteria 2547
152 Ga0070664_100135185 3300005564 Bacteria 2168
153 Ga0068857_100031520 3300005577 Bacteria 4685
154 Ga0068857_100040945 3300005577 Bacteria 4107
155 Ga0068854_100004294 3300005578 Bacteria 8980
156 Ga0068854_100021837 3300005578 Bacteria 4350
157 Ga0068854_100030257 3300005578 Bacteria 3755
158 Ga0068854_100052927 3300005578 Bacteria 2913
159 Ga0068854_100060590 3300005578 Bacteria 2739
160 Ga0068854_100081304 3300005578 Bacteria 2393
161 Ga0068854_100124108 3300005578 Bacteria 1964
162 Ga0068854_100577805 3300005578 Bacteria 957
163 Ga0068856_100000121 3300005614 Bacteria 78250
164 Ga0068856_100002936 3300005614 Bacteria 17469
165 Ga0068856_100006037 3300005614 Bacteria 11913
166 Ga0068856_100015236 3300005614 Bacteria 7429
167 Ga0068856_100030628 3300005614 Bacteria 5260
168 Ga0068856_100140206 3300005614 Bacteria 2425
169 Ga0068856_100351446 3300005614 Bacteria 1493
170 Ga0068852_100001886 3300005616 Bacteria 14284
171 Ga0068852_100010595 3300005616 Bacteria 6897
172 Ga0068852_100326454 3300005616 Bacteria 1492
173 Ga0068859_100003154 3300005617 Bacteria 16771
174 Ga0068859_100054096 3300005617 Bacteria 4037
175 Ga0068859_100091811 3300005617 Bacteria 3087
176 Ga0068859_100178521 3300005617 Bacteria 2206
177 Ga0068859_100674682 3300005617 Bacteria 1125
178 Ga0068864_100002601 3300005618 Bacteria 14909
179 Ga0068864_100004990 3300005618 Bacteria 10872
180 Ga0068864_100606193 3300005618 Bacteria 1063
181 Ga0068866_10000796 3300005718 Bacteria 14142
182 Ga0068866_10009440 3300005718 Bacteria 4143
183 Ga0068866_10009781 3300005718 Bacteria 4085
184 Ga0068861_100016140 3300005719 Bacteria 5277
185 Ga0068861_100043144 3300005719 Bacteria 3383
186 Ga0068861_100097904 3300005719 Bacteria 2328
187 Ga0068861_100104362 3300005719 Bacteria 2261
188 Ga0068861_100555725 3300005719 Bacteria 1047
189 Ga0068851_10000310 3300005834 Bacteria 22166
190 Ga0068851_10000364 3300005834 Bacteria 20414
191 Ga0068851_10019127 3300005834 Bacteria 3308
192 Ga0068851_10024474 3300005834 Bacteria 2956
193 Ga0068851_10248878 3300005834 Bacteria 1007
194 Ga0068870_10011927 3300005840 Bacteria 4044
195 Ga0068870_10057793 3300005840 Bacteria 2075
196 Ga0068870_10075565 3300005840 Bacteria 1848
197 Ga0068870_10150731 3300005840 Bacteria 1369
198 Ga0068863_100002041 3300005841 Bacteria 20018
199 Ga0068863_100023912 3300005841 Bacteria 5831
200 Ga0068863_100024523 3300005841 Bacteria 5753
201 Ga0068863_100571199 3300005841 Bacteria 1118
202 Ga0068863_100584438 3300005841 Bacteria 1104
203 Ga0068858_100013563 3300005842 Bacteria 7689
204 Ga0068858_100018130 3300005842 Bacteria 6595
205 Ga0068858_100041256 3300005842 Bacteria 4280
206 Ga0068858_100058532 3300005842 Bacteria 3563
207 Ga0068860_100017634 3300005843 Bacteria 6956
208 Ga0068860_100028277 3300005843 Bacteria 5396
209 Ga0068860_100042234 3300005843 Bacteria 4356
210 Ga0068860_100069247 3300005843 Bacteria 3353
211 Ga0068860_100104819 3300005843 Bacteria 2700
212 Ga0068860_100556301 3300005843 Bacteria 1150
213 Ga0068862_100016027 3300005844 Bacteria 6233
214 Ga0068862_100017315 3300005844 Bacteria 6000
215 Ga0068862_100029557 3300005844 Bacteria 4618
216 Ga0068862_100035738 3300005844 Bacteria 4210
217 Ga0081539_10010944 3300005985 Bacteria 7275
218 Ga0070715_10008792 3300006163 Bacteria 3533
219 Ga0070716_100039949 3300006173 Bacteria 2607
220 Ga0070712_100160734 3300006175 Bacteria 1734
221 Ga0070712_100546568 3300006175 Bacteria 975
222 Ga0097621_100004190 3300006237 Bacteria 10005
223 Ga0097621_100031854 3300006237 Bacteria 4185
224 Ga0097621_100170563 3300006237 Bacteria 1875
225 Ga0068871_100024180 3300006358 Bacteria 4707
226 Ga0068871_100102491 3300006358 Bacteria 2399
227 Ga0068871_100207340 3300006358 Bacteria 1694
228 Ga0075428_100152455 3300006844 Bacteria 2511
229 Ga0075428_100382093 3300006844 Bacteria 1510
230 Ga0075434_100098452 3300006871 Bacteria 2930
231 Ga0075434_100212680 3300006871 Bacteria 1953
232 Ga0068865_100009359 3300006881 Bacteria 6071
233 Ga0068865_100036628 3300006881 Bacteria 3309
234 Ga0075436_100230731 3300006914 Bacteria 1315
235 Ga0097620_100003154 3300006931 Bacteria 16771
236 Ga0097620_100054094 3300006931 Bacteria 4037
237 Ga0097620_100091805 3300006931 Bacteria 3087
238 Ga0097620_100178514 3300006931 Bacteria 2206
239 Ga0097620_100674688 3300006931 Bacteria 1125
240 Ga0075435_100192310 3300007076 Bacteria 1727
241 Ga0105240_10003341 3300009093 Bacteria 24979
242 Ga0105240_10009562 3300009093 Bacteria 13725
243 Ga0105240_10044573 3300009093 Bacteria 5635
244 Ga0105240_10575335 3300009093 Bacteria 1243
245 Ga0111539_10062512 3300009094 Bacteria 4407
246 Ga0105245_10014107 3300009098 Bacteria 6961
247 Ga0105245_10023755 3300009098 Bacteria 5381
248 Ga0105245_10052380 3300009098 Bacteria 3660
249 Ga0105245_10068753 3300009098 Bacteria 3210
250 Ga0105245_10472760 3300009098 Bacteria 1265
251 Ga0105243_10022296 3300009148 Bacteria 4812
252 Ga0105243_10229476 3300009148 Bacteria 1646
253 Ga0105241_10007335 3300009174 Bacteria 8108
254 Ga0105242_10013691 3300009176 Bacteria 6276
255 Ga0105242_10048723 3300009176 Bacteria 3444
256 Ga0105242_10127142 3300009176 Bacteria 2195
257 Ga0105248_10009560 3300009177 Bacteria 10671
258 Ga0105248_10021011 3300009177 Bacteria 7234
259 Ga0105248_10268409 3300009177 Bacteria 1921
260 Ga0105248_10506853 3300009177 Bacteria 1361
261 Ga0105248_10846799 3300009177 Bacteria 1032
262 Ga0105237_10059498 3300009545 Bacteria 3822
263 Ga0105237_10157305 3300009545 Bacteria 2270
264 Ga0105237_10494408 3300009545 Bacteria 1230
265 Ga0105237_10558395 3300009545 Bacteria 1151
266 Ga0105238_10002111 3300009551 Bacteria 20074
267 Ga0105238_10024732 3300009551 Bacteria 6122
268 Ga0105238_10111295 3300009551 Bacteria 2719
269 Ga0105238_10364293 3300009551 Bacteria 1435
270 Ga0105249_10036889 3300009553 Bacteria 4435
271 Ga0105249_10191172 3300009553 Bacteria 1998
272 Ga0105249_10264361 3300009553 Bacteria 1711
273 Ga0105249_10327801 3300009553 Bacteria 1544
274 Ga0105239_10022524 3300010375 Bacteria 6946
275 Ga0105239_10295392 3300010375 Bacteria 1824
276 Ga0157373_10000313 3300013100 Bacteria 39072
277 Ga0157373_10022844 3300013100 Bacteria 4536
278 Ga0157373_10097638 3300013100 Bacteria 2068
279 Ga0157371_10001341 3300013102 Bacteria 25918
280 Ga0157371_10048822 3300013102 Bacteria 3008
281 Ga0157371_10102461 3300013102 Bacteria 2031
282 Ga0157370_10012667 3300013104 Bacteria 8733
283 Ga0157370_10017427 3300013104 Bacteria 7247
284 Ga0157370_10049406 3300013104 Bacteria 4026
285 Ga0157370_10118286 3300013104 Bacteria 2475
286 Ga0157369_10004939 3300013105 Bacteria 15623
287 Ga0157369_10045027 3300013105 Bacteria 4800
288 Ga0157369_10096283 3300013105 Bacteria 3158
289 Ga0157374_10000521 3300013296 Bacteria 34613
290 Ga0157374_10026634 3300013296 Bacteria 5205
291 Ga0157374_10220909 3300013296 Bacteria 1859
292 Ga0157378_10007496 3300013297 Bacteria 9528
293 Ga0157378_10065593 3300013297 Bacteria 3250
294 Ga0157378_10070320 3300013297 Bacteria 3142
295 Ga0163162_10039103 3300013306 Bacteria 4738
296 Ga0163162_10161797 3300013306 Bacteria 2360
297 Ga0163162_10192986 3300013306 Bacteria 2164
298 Ga0157372_10005180 3300013307 Bacteria 13866
299 Ga0157372_10045220 3300013307 Bacteria 4882
300 Ga0157372_10048143 3300013307 Bacteria 4739
301 Ga0157372_10065779 3300013307 Bacteria 4072
302 Ga0157372_10098424 3300013307 Bacteria 3337
303 Ga0157372_10143190 3300013307 Bacteria 2756
304 Ga0157372_10145302 3300013307 Bacteria 2735
305 Ga0157375_10013307 3300013308 Bacteria 7317
306 Ga0157375_10410905 3300013308 Bacteria 1520
307 Ga0157375_10474554 3300013308 Bacteria 1416
308 Ga0157375_10605924 3300013308 Bacteria 1254
309 Ga0163163_10001688 3300014325 Bacteria 18648
310 Ga0163163_10138306 3300014325 Bacteria 2477
311 Ga0157380_10005564 3300014326 Bacteria 8808
312 Ga0157380_10043963 3300014326 Bacteria 3498
313 Ga0157380_10123557 3300014326 Bacteria 2196
314 Ga0157379_10001305 3300014968 Bacteria 20314
315 Ga0157379_10045410 3300014968 Bacteria 3921
316 Ga0157379_10079899 3300014968 Bacteria 2929
317 Ga0157376_10020700 3300014969 Bacteria 5097
318 Ga0157376_10047778 3300014969 Bacteria 3535
319 Ga0157376_10236903 3300014969 Bacteria 1698
320 Ga0163161_10004118 3300017792 Bacteria 10173
321 Ga0163161_10025983 3300017792 Bacteria 4147
322 Ga0207666_1001821 3300025271 Bacteria 2532
323 Ga0207697_10000552 3300025315 Bacteria 21216
324 Ga0207697_10045915 3300025315 Bacteria 1798
325 Ga0207697_10063273 3300025315 Bacteria 1542
326 Ga0207656_10005025 3300025321 Bacteria 4647
327 Ga0207656_10007401 3300025321 Bacteria 3996
328 Ga0207682_10000696 3300025893 Bacteria 15554
329 Ga0207682_10044929 3300025893 Bacteria 1812
330 Ga0207692_10100026 3300025898 Bacteria 1590
331 Ga0207692_10114597 3300025898 Bacteria 1500
332 Ga0207642_10001117 3300025899 Bacteria 8300
333 Ga0207642_10005397 3300025899 Bacteria 4170
334 Ga0207688_10035850 3300025901 Bacteria 2748
335 Ga0207680_10003849 3300025903 Bacteria 7065
336 Ga0207680_10035095 3300025903 Bacteria 2876
337 Ga0207680_10070030 3300025903 Bacteria 2169
338 Ga0207685_10004796 3300025905 Bacteria 3488
339 Ga0207699_10067589 3300025906 Bacteria 2173
340 Ga0207699_10107362 3300025906 Bacteria 1783
341 Ga0207645_10001675 3300025907 Bacteria 18033
342 Ga0207645_10002559 3300025907 Bacteria 14215
343 Ga0207645_10033095 3300025907 Bacteria 3323
344 Ga0207645_10111577 3300025907 Bacteria 1771
345 Ga0207645_10118245 3300025907 Bacteria 1719
346 Ga0207645_10236843 3300025907 Bacteria 1206
347 Ga0207645_10258720 3300025907 Bacteria 1153
348 Ga0207643_10000579 3300025908 Bacteria 23210
349 Ga0207643_10001430 3300025908 Bacteria 13700
350 Ga0207643_10062547 3300025908 Bacteria 2127
351 Ga0207643_10111350 3300025908 Bacteria 1613
352 Ga0207705_10017041 3300025909 Bacteria 5203
353 Ga0207705_10092513 3300025909 Bacteria 2216
354 Ga0207684_10117988 3300025910 Bacteria 2273
355 Ga0207684_10312116 3300025910 Bacteria 1356
356 Ga0207654_10100955 3300025911 Bacteria 1778
357 Ga0207707_10012775 3300025912 Bacteria 7305
358 Ga0207707_10292064 3300025912 Bacteria 1410
359 Ga0207695_10006083 3300025913 Bacteria 15748
360 Ga0207695_10013182 3300025913 Bacteria 9865
361 Ga0207695_10029541 3300025913 Bacteria 6053
362 Ga0207671_10019474 3300025914 Bacteria 5188
363 Ga0207671_10146327 3300025914 Bacteria 1823
364 Ga0207671_10320493 3300025914 Bacteria 1226
365 Ga0207693_10008836 3300025915 Bacteria 8231
366 Ga0207663_10008645 3300025916 Bacteria 5341
367 Ga0207660_10007335 3300025917 Bacteria 7135
368 Ga0207660_10289732 3300025917 Bacteria 1301
369 Ga0207662_10000516 3300025918 Bacteria 17183
370 Ga0207662_10079347 3300025918 Bacteria 2000
371 Ga0207657_10000809 3300025919 Bacteria 33036
372 Ga0207657_10000995 3300025919 Bacteria 30092
373 Ga0207657_10046127 3300025919 Bacteria 3818
374 Ga0207657_10056703 3300025919 Bacteria 3379
375 Ga0207657_10092536 3300025919 Bacteria 2520
376 Ga0207657_10236082 3300025919 Bacteria 1461
377 Ga0207649_10011776 3300025920 Bacteria 4836
378 Ga0207649_10013771 3300025920 Bacteria 4522
379 Ga0207649_10014459 3300025920 Bacteria 4420
380 Ga0207649_10058997 3300025920 Bacteria 2406
381 Ga0207649_10085356 3300025920 Bacteria 2054
382 Ga0207649_10216788 3300025920 Bacteria 1361
383 Ga0207652_10033812 3300025921 Bacteria 4307
384 Ga0207652_10078919 3300025921 Bacteria 2875
385 Ga0207652_10149083 3300025921 Bacteria 2094
386 Ga0207652_10532999 3300025921 Bacteria 1056
387 Ga0207681_10048300 3300025923 Bacteria 2872
388 Ga0207681_10109559 3300025923 Bacteria 2006
389 Ga0207681_10501070 3300025923 Bacteria 994
390 Ga0207694_10005020 3300025924 Bacteria 10238
391 Ga0207694_10018840 3300025924 Bacteria 5217
392 Ga0207650_10001400 3300025925 Bacteria 17395
393 Ga0207650_10008875 3300025925 Bacteria 6867
394 Ga0207650_10031052 3300025925 Bacteria 3855
395 Ga0207650_10031577 3300025925 Bacteria 3826
396 Ga0207659_10093846 3300025926 Bacteria 2247
397 Ga0207659_10148475 3300025926 Bacteria 1828
398 Ga0207687_10004986 3300025927 Bacteria 8800
399 Ga0207687_10061309 3300025927 Bacteria 2656
400 Ga0207700_10557517 3300025928 Bacteria 1017
401 Ga0207664_10022129 3300025929 Bacteria 4741
402 Ga0207664_10245969 3300025929 Bacteria 1559
403 Ga0207644_10002447 3300025931 Bacteria 11978
404 Ga0207644_10014671 3300025931 Bacteria 5249
405 Ga0207644_10032788 3300025931 Bacteria 3627
406 Ga0207644_10033514 3300025931 Bacteria 3589
407 Ga0207644_10039391 3300025931 Bacteria 3335
408 Ga0207644_10076404 3300025931 Bacteria 2464
409 Ga0207644_10149521 3300025931 Bacteria 1806
410 Ga0207644_10182491 3300025931 Bacteria 1646
411 Ga0207644_10303740 3300025931 Bacteria 1287
412 Ga0207690_10001081 3300025932 Bacteria 17428
413 Ga0207690_10015651 3300025932 Bacteria 4601
414 Ga0207690_10015672 3300025932 Bacteria 4599
415 Ga0207690_10166995 3300025932 Bacteria 1645
416 Ga0207690_10199589 3300025932 Bacteria 1518
417 Ga0207690_10409838 3300025932 Bacteria 1082
418 Ga0207706_10000351 3300025933 Bacteria 49664
419 Ga0207706_10002579 3300025933 Bacteria 17647
420 Ga0207706_10012482 3300025933 Bacteria 7739
421 Ga0207706_10179588 3300025933 Bacteria 1859
422 Ga0207706_10238665 3300025933 Bacteria 1589
423 Ga0207706_10307137 3300025933 Bacteria 1381
424 Ga0207686_10120946 3300025934 Bacteria 1782
425 Ga0207709_10157919 3300025935 Bacteria 1578
426 Ga0207709_10163491 3300025935 Bacteria 1555
427 Ga0207709_10171297 3300025935 Bacteria 1524
428 Ga0207670_10133393 3300025936 Bacteria 1823
429 Ga0207670_10133822 3300025936 Bacteria 1820
430 Ga0207669_10006056 3300025937 Bacteria 5489
431 Ga0207669_10009628 3300025937 Bacteria 4616
432 Ga0207669_10036669 3300025937 Bacteria 2805
433 Ga0207704_10013242 3300025938 Bacteria 4122
434 Ga0207704_10084212 3300025938 Bacteria 2066
435 Ga0207704_10097589 3300025938 Bacteria 1949
436 Ga0207691_10001011 3300025940 Bacteria 27902
437 Ga0207691_10002929 3300025940 Bacteria 16652
438 Ga0207691_10010343 3300025940 Bacteria 8949
439 Ga0207691_10033687 3300025940 Bacteria 4770
440 Ga0207691_10089441 3300025940 Bacteria 2761
441 Ga0207711_10000524 3300025941 Bacteria 39377
442 Ga0207711_10008586 3300025941 Bacteria 8539
443 Ga0207711_10234865 3300025941 Bacteria 1680
444 Ga0207711_10293879 3300025941 Bacteria 1498
445 Ga0207711_10443007 3300025941 Bacteria 1209
446 Ga0207711_10495915 3300025941 Bacteria 1138
447 Ga0207689_10001066 3300025942 Bacteria 26408
448 Ga0207689_10019181 3300025942 Bacteria 5766
449 Ga0207689_10028124 3300025942 Bacteria 4702
450 Ga0207689_10029926 3300025942 Bacteria 4541
451 Ga0207689_10037682 3300025942 Bacteria 4009
452 Ga0207689_10283363 3300025942 Bacteria 1372
453 Ga0207661_10143789 3300025944 Bacteria 2055
454 Ga0207679_10004504 3300025945 Bacteria 8678
455 Ga0207679_10015538 3300025945 Bacteria 5034
456 Ga0207679_10084692 3300025945 Bacteria 2433
457 Ga0207679_10152659 3300025945 Bacteria 1882
458 Ga0207667_10001104 3300025949 Bacteria 34133
459 Ga0207667_10003582 3300025949 Bacteria 19195
460 Ga0207667_10038882 3300025949 Bacteria 5074
461 Ga0207667_10101269 3300025949 Bacteria 2971
462 Ga0207667_10104692 3300025949 Bacteria 2919
463 Ga0207667_10145503 3300025949 Bacteria 2440
464 Ga0207667_10195517 3300025949 Bacteria 2075
465 Ga0207651_10000734 3300025960 Bacteria 14041
466 Ga0207651_10001712 3300025960 Bacteria 10127
467 Ga0207651_10009844 3300025960 Bacteria 5261
468 Ga0207651_10416315 3300025960 Bacteria 1146
469 Ga0207712_10382199 3300025961 Bacteria 1179
470 Ga0207668_10003581 3300025972 Bacteria 9126
471 Ga0207668_10005882 3300025972 Bacteria 7227
472 Ga0207668_10069459 3300025972 Bacteria 2508
473 Ga0207668_10073841 3300025972 Bacteria 2445
474 Ga0207668_10092327 3300025972 Bacteria 2228
475 Ga0207668_10122244 3300025972 Bacteria 1973
476 Ga0207668_10122479 3300025972 Bacteria 1972
477 Ga0207640_10002153 3300025981 Bacteria 10582
478 Ga0207640_10014303 3300025981 Bacteria 4565
479 Ga0207640_10031231 3300025981 Bacteria 3289
480 Ga0207640_10045516 3300025981 Bacteria 2818
481 Ga0207640_10140942 3300025981 Bacteria 1757
482 Ga0207640_10275203 3300025981 Bacteria 1319
483 Ga0207640_10586150 3300025981 Bacteria 942
484 Ga0207658_10029988 3300025986 Bacteria 3847
485 Ga0207658_10055610 3300025986 Bacteria 2933
486 Ga0207658_10075579 3300025986 Bacteria 2563
487 Ga0207658_10173382 3300025986 Bacteria 1779
488 Ga0207658_10209935 3300025986 Bacteria 1631
489 Ga0207677_10000322 3300026023 Bacteria 34903
490 Ga0207677_10003683 3300026023 Bacteria 8140
491 Ga0207677_10091103 3300026023 Bacteria 2217
492 Ga0207677_10120913 3300026023 Bacteria 1970
493 Ga0207677_10242760 3300026023 Bacteria 1458
494 Ga0207703_10005562 3300026035 Bacteria 10114
495 Ga0207703_10077731 3300026035 Bacteria 2756
496 Ga0207703_10141654 3300026035 Bacteria 2087
497 Ga0207639_10002265 3300026041 Bacteria 12933
498 Ga0207639_10018207 3300026041 Bacteria 4988
499 Ga0207639_10160030 3300026041 Bacteria 1896
500 Ga0207678_10002339 3300026067 Bacteria 17182
501 Ga0207678_10003679 3300026067 Bacteria 13784
502 Ga0207678_10016899 3300026067 Bacteria 6407
503 Ga0207678_10080497 3300026067 Bacteria 2789
504 Ga0207678_10087281 3300026067 Bacteria 2666
505 Ga0207678_10110303 3300026067 Bacteria 2347
506 Ga0207678_10266777 3300026067 Bacteria 1468
507 Ga0207708_10000693 3300026075 Bacteria 25576
508 Ga0207708_10146458 3300026075 Bacteria 1856
509 Ga0207702_10002542 3300026078 Bacteria 17175
510 Ga0207702_10006152 3300026078 Bacteria 10390
511 Ga0207702_10009988 3300026078 Bacteria 7956
512 Ga0207702_10047792 3300026078 Bacteria 3607
513 Ga0207702_10054824 3300026078 Bacteria 3379
514 Ga0207702_10196421 3300026078 Bacteria 1868
515 Ga0207641_10017974 3300026088 Bacteria 5792
516 Ga0207641_10057916 3300026088 Bacteria 3296
517 Ga0207641_10083289 3300026088 Bacteria 2781
518 Ga0207641_10207003 3300026088 Bacteria 1812
519 Ga0207648_10000126 3300026089 Bacteria 75403
520 Ga0207648_10001872 3300026089 Bacteria 23010
521 Ga0207648_10074378 3300026089 Bacteria 2961
522 Ga0207648_10150629 3300026089 Bacteria 2053
523 Ga0207676_10000466 3300026095 Bacteria 33927
524 Ga0207676_10171238 3300026095 Bacteria 1892
525 Ga0207676_10592981 3300026095 Bacteria 1063
526 Ga0207674_10002507 3300026116 Bacteria 23152
527 Ga0207674_10004946 3300026116 Bacteria 15914
528 Ga0207674_10113976 3300026116 Bacteria 2676
529 Ga0207675_100021296 3300026118 Bacteria 6039
530 Ga0207675_100026138 3300026118 Bacteria 5434
531 Ga0207675_100041498 3300026118 Bacteria 4297
532 Ga0207675_100070599 3300026118 Bacteria 3264
533 Ga0207675_100115513 3300026118 Bacteria 2536
534 Ga0207683_10000487 3300026121 Bacteria 36611
535 Ga0207683_10001731 3300026121 Bacteria 19437
536 Ga0207683_10006222 3300026121 Bacteria 10230
537 Ga0207683_10135897 3300026121 Bacteria 2213
538 Ga0207683_10360102 3300026121 Bacteria 1336
539 Ga0207683_10579444 3300026121 Bacteria 1038
540 Ga0207698_10009365 3300026142 Bacteria 6243
541 Ga0207698_10012240 3300026142 Bacteria 5605
542 Ga0207698_10035501 3300026142 Bacteria 3648
543 Ga0207698_10103804 3300026142 Bacteria 2363
544 Ga0207698_10512620 3300026142 Bacteria 1169
545 Ga0209999_1002890 3300027543 Bacteria 3047
546 Ga0209970_1005522 3300027614 Bacteria 2087
547 Ga0209983_1004865 3300027665 Bacteria 2804
548 Ga0209983_1008219 3300027665 Bacteria 2133
549 Ga0209971_1016658 3300027682 Bacteria 1743
550 Ga0209974_10004825 3300027876 Bacteria 4779
551 Ga0209974_10009273 3300027876 Bacteria 3341
552 Ga0207428_10014978 3300027907 Bacteria 6719
553 Ga0268266_10021725 3300028379 Bacteria 5469
554 Ga0268266_10114264 3300028379 Bacteria 2395
555 Ga0268266_10449692 3300028379 Bacteria 1224
556 Ga0268265_10013273 3300028380 Bacteria 5598
557 Ga0268265_10063422 3300028380 Bacteria 2842
558 Ga0268265_10196449 3300028380 Bacteria 1746
559 Ga0268265_10223686 3300028380 Bacteria 1649
560 Ga0268264_10025634 3300028381 Bacteria 4816
561 Ga0268264_10026376 3300028381 Bacteria 4747
562 Ga0268264_10036009 3300028381 Bacteria 4075
563 Ga0268264_10170381 3300028381 Bacteria 1968
564 Ga0268264_10284063 3300028381 Bacteria 1551
565 Ga0307408_100004748 3300031548 Bacteria 9163
566 Ga0307405_10000547 3300031731 Bacteria 14284
567 Ga0307405_10000931 3300031731 Bacteria 11645
568 Ga0307413_10056407 3300031824 Bacteria 2396
569 Ga0307413_10253563 3300031824 Bacteria 1307
570 Ga0307410_10005943 3300031852 Bacteria 6526
571 Ga0307410_10030559 3300031852 Bacteria 3444
572 Ga0307410_10037162 3300031852 Bacteria 3178
573 Ga0307410_10116498 3300031852 Bacteria 1941
574 Ga0307406_10006227 3300031901 Bacteria 6570
575 Ga0307406_10079513 3300031901 Bacteria 2174
576 Ga0307406_10114041 3300031901 Bacteria 1866
577 Ga0307407_10101124 3300031903 Bacteria 1789
578 Ga0307407_10123013 3300031903 Bacteria 1648
579 Ga0307412_10014646 3300031911 Bacteria 4632
580 Ga0307412_10266040 3300031911 Bacteria 1339
581 Ga0307409_100006013 3300031995 Bacteria 7075
582 Ga0307409_100020047 3300031995 Bacteria 4546
583 Ga0307409_100029171 3300031995 Bacteria 3944
584 Ga0307409_100141283 3300031995 Bacteria 2075
585 Ga0307416_100018425 3300032002 Bacteria 4918
586 Ga0307416_100035114 3300032002 Bacteria 3824
587 Ga0307416_100385447 3300032002 Bacteria 1433
588 Ga0307411_10003685 3300032005 Bacteria 7173
589 Ga0307411_10012224 3300032005 Bacteria 4673
590 Ga0307415_100000868 3300032126 Bacteria 13824
591 Ga0373923_0000483 3300035111 Bacteria 9537
592 Ga0373945_0057074 3300035116 Bacteria 1449
593 Ga0373953_0015750 3300035117 Bacteria 2747
594 Ga0373956_0001349 3300035119 Bacteria 10116
595 Ga0373956_0176650 3300035119 Bacteria 1009
596 Ga0373957_0074535 3300035120 Bacteria 1332
597 Ga0373946_0010844 3300035171 Bacteria 3385
598 Ga0373955_0001103 3300035172 Bacteria 11473
599 Ga0373955_0001462 3300035172 Bacteria 10028
600 Ga0373924_0003305 3300035410 Bacteria 5526
601 Ga0373931_0025480 3300035691 Bacteria 3004
602 Ga0373931_0067817 3300035691 Bacteria 1940
603 Ga0373935_0040470 3300035692 Bacteria 2925
604 Ga0373935_0048870 3300035692 Bacteria 2680
605 Ga0373935_0250338 3300035692 Bacteria 1239
606 Ga0373927_0073284 3300035695 Bacteria 2217
607 Ga0373933_0014421 3300035724 Bacteria 4396
608 Ga0373947_0147689 3300035725 Bacteria 1512
609 Ga0373937_0005152 3300036401 Bacteria 11145
610 Ga0373937_0116688 3300036401 Bacteria 2486
611 Ga0373937_0135680 3300036401 Bacteria 2301
612 Ga0373925_0041911 3300037068 Bacteria 3395
613 Ga0395899_0045183 3300037312 Bacteria 3282
614 Ga0395905_0028209 3300037471 Bacteria 5292
615 Ga0395901_0046290 3300038443 Bacteria 4518
616 Ga0395901_0126062 3300038443 Bacteria 2691
617 Ga0451853_3108887 3300041512 Bacteria 1693
618 Ga0451577_0069485 3300042876 Bacteria 3141
619 Ga0466957_0155846 3300044842 Bacteria 1480
620 Ga0451576_0123482 3300045051 Bacteria 2697
621 Ga0466967_0323659 3300045976 Bacteria 1487
622 Ga0495592_0010333 3300046454 Bacteria 7037
623 Ga0495629_0011886 3300046459 Bacteria 6312
624 Ga0495651_0071696 3300046462 Bacteria 2633
625 Ga0495651_0132387 3300046462 Bacteria 1819
626 Ga0495653_0043849 3300046463 Bacteria 3475
627 Ga0495580_0020030 3300046472 Bacteria 4959
628 Ga0495580_0038322 3300046472 Bacteria 3433
629 Ga0495580_0246943 3300046472 Bacteria 1222
630 Ga0495582_0005076 3300046473 Bacteria 7374
631 Ga0495639_0008809 3300046475 Bacteria 4328
632 Ga0495664_0129051 3300046477 Bacteria 1530
633 Ga0495594_0138802 3300046499 Bacteria 1378
634 Ga0495608_0032233 3300046511 Bacteria 3542
635 Ga0495608_0086073 3300046511 Bacteria 2037
636 Ga0495628_0581661 3300046516 Bacteria 801
637 Ga0495630_0301604 3300046517 Bacteria 1224
638 Ga0495652_0063749 3300046529 Bacteria 3102
639 Ga0495665_0007341 3300046531 Bacteria 5955
640 Ga0495586_0088508 3300046535 Bacteria 1708
641 Ga0495587_0011439 3300046536 Bacteria 5623
642 Ga0495645_0001810 3300046543 Bacteria 14529
643 Ga0495667_0025748 3300046559 Bacteria 3963
644 Ga0495634_0070494 3300046642 Bacteria 2304
645 Ga0495635_0015306 3300046663 Bacteria 5365
646 Ga0495657_0313489 3300046675 Bacteria 933
647 Ga0495599_0003356 3300046678 Bacteria 9356
648 Ga0495623_0036132 3300046679 Bacteria 3166
649 Ga0495646_0152579 3300046680 Bacteria 1284
650 Ga0495647_0004126 3300046681 Bacteria 4698
651 Ga0495658_0062138 3300046683 Bacteria 2146
652 Ga0495613_0009130 3300046689 Bacteria 7352
653 Ga0495600_0056416 3300046809 Bacteria 2566
654 Ga0495600_0067474 3300046809 Bacteria 2338
655 Ga0495581_0014766 3300047315 Bacteria 4530
656 Ga0495604_0129581 3300047317 Bacteria 1815
657 Ga0495674_0111328 3300047319 Bacteria 2321
658 Ga0495680_0036791 3300047322 Bacteria 3926
659 Ga0495680_0329827 3300047322 Bacteria 1066
660 Ga0495675_0055106 3300047444 Bacteria 2522
661 Ga0495684_0014175 3300047471 Bacteria 6133
662 Ga0495602_0208830 3300048088 Bacteria 1484
663 Ga0495614_0029480 3300048089 Bacteria 2362
664 Ga0496100_0024257 3300048903 Bacteria 3697
665 Ga0496100_0058655 3300048903 Bacteria 2527
666 Ga0496100_0196461 3300048903 Bacteria 1468
667 Ga0496101_0019654 3300048904 Bacteria 4616
668 Ga0496102_0036514 3300048905 Bacteria 4427
669 Ga0496102_0219781 3300048905 Bacteria 1791
670 Ga0496104_0001180 3300048907 Bacteria 22457
671 Ga0496105_0044362 3300048908 Bacteria 3667
672 Ga0496106_0000971 3300048909 Bacteria 20941
673 Ga0496106_0072806 3300048909 Bacteria 2628
674 Ga0496106_0124347 3300048909 Bacteria 2019
675 Ga0496107_0002428 3300048910 Bacteria 12074
676 Ga0496107_0208725 3300048910 Bacteria 1452
677 Ga0496108_0011460 3300048911 Bacteria 7205
678 Ga0496108_0061063 3300048911 Bacteria 3172
679 Ga0496108_0338390 3300048911 Bacteria 1313
680 Ga0496108_0414382 3300048911 Bacteria 1177
681 Ga0496109_0041278 3300048912 Bacteria 4180
682 Ga0496109_0464614 3300048912 Bacteria 1195
683 Ga0496112_0000187 3300048915 Bacteria 40064
684 Ga0496113_0249310 3300048916 Bacteria 1417
685 Ga0496114_0052019 3300048917 Bacteria 3411
686 Ga0496114_0057667 3300048917 Bacteria 3242
687 Ga0496114_0092239 3300048917 Bacteria 2573
688 Ga0496115_0021241 3300048918 Bacteria 5013
689 Ga0501034_0666663 3300049571 Bacteria 941
690 nmdc:mga08y16_34775_c1 3300050511 Bacteria 5294
691 nmdc:mga0n895_89199_c1 3300050512 Bacteria 3084
692 nmdc:mga0rr50_46729_c1 3300050513 Bacteria 3188
693 nmdc:mga08x19_280794_c1 3300050514 Bacteria 1154
694 Ga0495601_0036873 3300053077 Bacteria 3056
695 Ga0495601_0056435 3300053077 Bacteria 2487
696 Ga0495595_0043543 3300053084 Bacteria 2059
697 Ga0495595_0046028 3300053084 Bacteria 2008
698 Ga0495619_0009048 3300053085 Bacteria 6283
699 Ga0495619_0010006 3300053085 Bacteria 5971
700 Ga0207652_10428840
701 JGI24034J26672_10008151
702 JGI24751J29686_10033573
703 Ga0065707_10142014
704 Ga0070658_10046404
705 Ga0070658_10435434
706 Ga0070676_10013922
707 Ga0070676_10096586
708 Ga0070676_10310701
709 Ga0070683_100004039
710 Ga0070683_100021766
711 Ga0070683_100071580
712 Ga0070683_100234239
713 Ga0070690_100011643
714 Ga0070690_100016902
715 Ga0070670_100028203
716 Ga0070670_100045408
717 Ga0070670_100046273
718 Ga0070670_100049848
719 Ga0068869_100000798
720 Ga0068869_100008299
721 Ga0068869_100043514
722 Ga0068869_100254187
723 Ga0068869_100275701
724 Ga0070666_10004718
725 Ga0070666_10008499
726 Ga0070666_10027339
727 Ga0070680_100020288
728 Ga0070680_100020396
729 Ga0068868_100008208
730 Ga0068868_100016847
731 Ga0068868_100058669
732 Ga0068868_100124584
733 Ga0070660_100002491
734 Ga0070660_100021392
735 Ga0070660_100039887
736 Ga0070660_100087979
737 Ga0070660_100225833
738 Ga0070689_100000516
739 Ga0070689_100009420
740 Ga0070689_100026271
741 Ga0070689_100275614
742 Ga0070689_100525102
743 Ga0070687_100047177
744 Ga0070661_100002610
745 Ga0070661_100005939
746 Ga0070661_100008060
747 Ga0070661_100023347
748 Ga0070661_100143319
749 Ga0070661_100164751
750 Ga0070692_10116576
751 Ga0070668_100010286
752 Ga0070668_100029856
753 Ga0070668_100032199
754 Ga0070668_100136564
755 Ga0070669_100001002
756 Ga0070669_100010129
757 Ga0070669_100096871
758 Ga0070669_100184519
759 Ga0070675_100016434
760 Ga0070675_100040803
761 Ga0070675_100109242
762 Ga0070671_100005429
763 Ga0070671_100006873
764 Ga0070671_100007647
765 Ga0070671_100131619
766 Ga0070673_100024146
767 Ga0070673_100060028
768 Ga0070673_100095488
769 Ga0070673_100258681
770 Ga0070673_100290433
771 Ga0070673_100354363
772 Ga0070673_100420785
773 Ga0070688_100000315
774 Ga0070688_100004898
775 Ga0070688_100078653
776 Ga0070659_100003342
777 Ga0070659_100003585
778 Ga0070659_100006802
779 Ga0070659_100107992
780 Ga0070659_100241805
781 Ga0070659_100244821
782 Ga0070667_100028736
783 Ga0070667_100060915
784 Ga0070667_100146160
785 Ga0070667_100181957
786 Ga0070667_100255026
787 Ga0070709_10004947
788 Ga0070709_10129378
789 Ga0070709_10220373
790 Ga0070714_100000881
791 Ga0070714_100008597
792 Ga0070714_100192774
793 Ga0070713_100007661
794 Ga0070710_10017890
795 Ga0070701_10003210
796 Ga0070711_100071956
797 Ga0070705_100256683
798 Ga0070700_100029313
799 Ga0070700_100238057
800 Ga0070663_100003516
801 Ga0070663_100018475
802 Ga0070663_100033233
803 Ga0070663_100108832
804 Ga0070678_100010882
805 Ga0070678_100032008
806 Ga0070662_100000340
807 Ga0070662_100049624
808 Ga0070662_100117974
809 Ga0070681_10126294
810 Ga0070681_10215967
811 Ga0068867_100002597
812 Ga0070685_10003123
813 Ga0070685_10007664
814 Ga0070685_10064034
815 Ga0070706_100008890
816 Ga0070707_100276713
817 Ga0070698_100031587
818 Ga0070699_100177794
819 Ga0070679_100086422
820 Ga0070679_100105851
821 Ga0070679_100272376
822 Ga0070679_100308678
823 Ga0070679_100405493
824 Ga0070684_100003132
825 Ga0070684_100037056
826 Ga0070697_100012449
827 Ga0068853_100005128
828 Ga0068853_100053541
829 Ga0068853_100273004
830 Ga0070672_100000746
831 Ga0070672_100093615
832 Ga0070672_100231243
833 Ga0070672_100279768
834 Ga0070686_100006481
835 Ga0070686_100078944
836 Ga0070696_100002786
837 Ga0070696_100078747
838 Ga0070693_100009987
839 Ga0070704_100087393
840 Ga0068855_100003919
841 Ga0068855_100009230
842 Ga0068855_100073797
843 Ga0068855_100107952
844 Ga0068855_100204675
845 Ga0068855_100252683
846 Ga0070664_100006183
847 Ga0070664_100010088
848 Ga0070664_100020841
849 Ga0070664_100034824
850 Ga0070664_100097910
851 Ga0070664_100135185
852 Ga0068857_100031520
853 Ga0068857_100040945
854 Ga0068854_100004294
855 Ga0068854_100021837
856 Ga0068854_100030257
857 Ga0068854_100052927
858 Ga0068854_100060590
859 Ga0068854_100081304
860 Ga0068854_100124108
861 Ga0068854_100577805
862 Ga0068856_100000121
863 Ga0068856_100002936
864 Ga0068856_100006037
865 Ga0068856_100015236
866 Ga0068856_100030628
867 Ga0068856_100140206
868 Ga0068856_100351446
869 Ga0068852_100001886
870 Ga0068852_100010595
871 Ga0068852_100326454
872 Ga0068859_100003154
873 Ga0068859_100054096
874 Ga0068859_100091811
875 Ga0068859_100178521
876 Ga0068859_100674682
877 Ga0068864_100002601
878 Ga0068864_100004990
879 Ga0068864_100606193
880 Ga0068866_10000796
881 Ga0068866_10009440
882 Ga0068866_10009781
883 Ga0068861_100016140
884 Ga0068861_100043144
885 Ga0068861_100097904
886 Ga0068861_100104362
887 Ga0068861_100555725
888 Ga0068851_10000310
889 Ga0068851_10000364
890 Ga0068851_10019127
891 Ga0068851_10024474
892 Ga0068851_10248878
893 Ga0068870_10011927
894 Ga0068870_10057793
895 Ga0068870_10075565
896 Ga0068870_10150731
897 Ga0068863_100002041
898 Ga0068863_100023912
899 Ga0068863_100024523
900 Ga0068863_100571199
901 Ga0068863_100584438
902 Ga0068858_100013563
903 Ga0068858_100018130
904 Ga0068858_100041256
905 Ga0068858_100058532
906 Ga0068860_100017634
907 Ga0068860_100028277
908 Ga0068860_100042234
909 Ga0068860_100069247
910 Ga0068860_100104819
911 Ga0068860_100556301
912 Ga0068862_100016027
913 Ga0068862_100017315
914 Ga0068862_100029557
915 Ga0068862_100035738
916 Ga0081539_10010944
917 Ga0070715_10008792
918 Ga0070716_100039949
919 Ga0070712_100160734
920 Ga0070712_100546568
921 Ga0097621_100004190
922 Ga0097621_100031854
923 Ga0097621_100170563
924 Ga0068871_100024180
925 Ga0068871_100102491
926 Ga0068871_100207340
927 Ga0075428_100152455
928 Ga0075428_100382093
929 Ga0075434_100098452
930 Ga0075434_100212680
931 Ga0068865_100009359
932 Ga0068865_100036628
933 Ga0075436_100230731
934 Ga0097620_100003154
935 Ga0097620_100054094
936 Ga0097620_100091805
937 Ga0097620_100178514
938 Ga0097620_100674688
939 Ga0075435_100192310
940 Ga0105240_10003341
941 Ga0105240_10009562
942 Ga0105240_10044573
943 Ga0105240_10575335
944 Ga0111539_10062512
945 Ga0105245_10014107
946 Ga0105245_10023755
947 Ga0105245_10052380
948 Ga0105245_10068753
949 Ga0105245_10472760
950 Ga0105243_10022296
951 Ga0105243_10229476
952 Ga0105241_10007335
953 Ga0105242_10013691
954 Ga0105242_10048723
955 Ga0105242_10127142
956 Ga0105248_10009560
957 Ga0105248_10021011
958 Ga0105248_10268409
959 Ga0105248_10506853
960 Ga0105248_10846799
961 Ga0105237_10059498
962 Ga0105237_10157305
963 Ga0105237_10494408
964 Ga0105237_10558395
965 Ga0105238_10002111
966 Ga0105238_10024732
967 Ga0105238_10111295
968 Ga0105238_10364293
969 Ga0105249_10036889
970 Ga0105249_10191172
971 Ga0105249_10264361
972 Ga0105249_10327801
973 Ga0105239_10022524
974 Ga0105239_10295392
975 Ga0157373_10000313
976 Ga0157373_10022844
977 Ga0157373_10097638
978 Ga0157371_10001341
979 Ga0157371_10048822
980 Ga0157371_10102461
981 Ga0157370_10012667
982 Ga0157370_10017427
983 Ga0157370_10049406
984 Ga0157370_10118286
985 Ga0157369_10004939
986 Ga0157369_10045027
987 Ga0157369_10096283
988 Ga0157374_10000521
989 Ga0157374_10026634
990 Ga0157374_10220909
991 Ga0157378_10007496
992 Ga0157378_10065593
993 Ga0157378_10070320
994 Ga0163162_10039103
995 Ga0163162_10161797
996 Ga0163162_10192986
997 Ga0157372_10005180
998 Ga0157372_10045220
999 Ga0157372_10048143
1000 Ga0157372_10065779
1001 Ga0157372_10098424
1002 Ga0157372_10143190
1003 Ga0157372_10145302
1004 Ga0157375_10013307
1005 Ga0157375_10410905
1006 Ga0157375_10474554
1007 Ga0157375_10605924
1008 Ga0163163_10001688
1009 Ga0163163_10138306
1010 Ga0157380_10005564
1011 Ga0157380_10043963
1012 Ga0157380_10123557
1013 Ga0157379_10001305
1014 Ga0157379_10045410
1015 Ga0157379_10079899
1016 Ga0157376_10020700
1017 Ga0157376_10047778
1018 Ga0157376_10236903
1019 Ga0163161_10004118
1020 Ga0163161_10025983
1021 Ga0207666_1001821
1022 Ga0207697_10000552
1023 Ga0207697_10045915
1024 Ga0207697_10063273
1025 Ga0207656_10005025
1026 Ga0207656_10007401
1027 Ga0207682_10000696
1028 Ga0207682_10044929
1029 Ga0207692_10100026
1030 Ga0207692_10114597
1031 Ga0207642_10001117
1032 Ga0207642_10005397
1033 Ga0207688_10035850
1034 Ga0207680_10003849
1035 Ga0207680_10035095
1036 Ga0207680_10070030
1037 Ga0207685_10004796
1038 Ga0207699_10067589
1039 Ga0207699_10107362
1040 Ga0207645_10001675
1041 Ga0207645_10002559
1042 Ga0207645_10033095
1043 Ga0207645_10111577
1044 Ga0207645_10118245
1045 Ga0207645_10236843
1046 Ga0207645_10258720
1047 Ga0207643_10000579
1048 Ga0207643_10001430
1049 Ga0207643_10062547
1050 Ga0207643_10111350
1051 Ga0207705_10017041
1052 Ga0207705_10092513
1053 Ga0207684_10117988
1054 Ga0207684_10312116
1055 Ga0207654_10100955
1056 Ga0207707_10012775
1057 Ga0207707_10292064
1058 Ga0207695_10006083
1059 Ga0207695_10013182
1060 Ga0207695_10029541
1061 Ga0207671_10019474
1062 Ga0207671_10146327
1063 Ga0207671_10320493
1064 Ga0207693_10008836
1065 Ga0207663_10008645
1066 Ga0207660_10007335
1067 Ga0207660_10289732
1068 Ga0207662_10000516
1069 Ga0207662_10079347
1070 Ga0207657_10000809
1071 Ga0207657_10000995
1072 Ga0207657_10046127
1073 Ga0207657_10056703
1074 Ga0207657_10092536
1075 Ga0207657_10236082
1076 Ga0207649_10011776
1077 Ga0207649_10013771
1078 Ga0207649_10014459
1079 Ga0207649_10058997
1080 Ga0207649_10085356
1081 Ga0207649_10216788
1082 Ga0207652_10033812
1083 Ga0207652_10078919
1084 Ga0207652_10149083
1085 Ga0207652_10532999
1086 Ga0207681_10048300
1087 Ga0207681_10109559
1088 Ga0207681_10501070
1089 Ga0207694_10005020
1090 Ga0207694_10018840
1091 Ga0207650_10001400
1092 Ga0207650_10008875
1093 Ga0207650_10031052
1094 Ga0207650_10031577
1095 Ga0207659_10093846
1096 Ga0207659_10148475
1097 Ga0207687_10004986
1098 Ga0207687_10061309
1099 Ga0207700_10557517
1100 Ga0207664_10022129
1101 Ga0207664_10245969
1102 Ga0207644_10002447
1103 Ga0207644_10014671
1104 Ga0207644_10032788
1105 Ga0207644_10033514
1106 Ga0207644_10039391
1107 Ga0207644_10076404
1108 Ga0207644_10149521
1109 Ga0207644_10182491
1110 Ga0207644_10303740
1111 Ga0207690_10001081
1112 Ga0207690_10015651
1113 Ga0207690_10015672
1114 Ga0207690_10166995
1115 Ga0207690_10199589
1116 Ga0207690_10409838
1117 Ga0207706_10000351
1118 Ga0207706_10002579
1119 Ga0207706_10012482
1120 Ga0207706_10179588
1121 Ga0207706_10238665
1122 Ga0207706_10307137
1123 Ga0207686_10120946
1124 Ga0207709_10157919
1125 Ga0207709_10163491
1126 Ga0207709_10171297
1127 Ga0207670_10133393
1128 Ga0207670_10133822
1129 Ga0207669_10006056
1130 Ga0207669_10009628
1131 Ga0207669_10036669
1132 Ga0207704_10013242
1133 Ga0207704_10084212
1134 Ga0207704_10097589
1135 Ga0207691_10001011
1136 Ga0207691_10002929
1137 Ga0207691_10010343
1138 Ga0207691_10033687
1139 Ga0207691_10089441
1140 Ga0207711_10000524
1141 Ga0207711_10008586
1142 Ga0207711_10234865
1143 Ga0207711_10293879
1144 Ga0207711_10443007
1145 Ga0207711_10495915
1146 Ga0207689_10001066
1147 Ga0207689_10019181
1148 Ga0207689_10028124
1149 Ga0207689_10029926
1150 Ga0207689_10037682
1151 Ga0207689_10283363
1152 Ga0207661_10143789
1153 Ga0207679_10004504
1154 Ga0207679_10015538
1155 Ga0207679_10084692
1156 Ga0207679_10152659
1157 Ga0207667_10001104
1158 Ga0207667_10003582
1159 Ga0207667_10038882
1160 Ga0207667_10101269
1161 Ga0207667_10104692
1162 Ga0207667_10145503
1163 Ga0207667_10195517
1164 Ga0207651_10000734
1165 Ga0207651_10001712
1166 Ga0207651_10009844
1167 Ga0207651_10416315
1168 Ga0207712_10382199
1169 Ga0207668_10003581
1170 Ga0207668_10005882
1171 Ga0207668_10069459
1172 Ga0207668_10073841
1173 Ga0207668_10092327
1174 Ga0207668_10122244
1175 Ga0207668_10122479
1176 Ga0207640_10002153
1177 Ga0207640_10014303
1178 Ga0207640_10031231
1179 Ga0207640_10045516
1180 Ga0207640_10140942
1181 Ga0207640_10275203
1182 Ga0207640_10586150
1183 Ga0207658_10029988
1184 Ga0207658_10055610
1185 Ga0207658_10075579
1186 Ga0207658_10173382
1187 Ga0207658_10209935
1188 Ga0207677_10000322
1189 Ga0207677_10003683
1190 Ga0207677_10091103
1191 Ga0207677_10120913
1192 Ga0207677_10242760
1193 Ga0207703_10005562
1194 Ga0207703_10077731
1195 Ga0207703_10141654
1196 Ga0207639_10002265
1197 Ga0207639_10018207
1198 Ga0207639_10160030
1199 Ga0207678_10002339
1200 Ga0207678_10003679
1201 Ga0207678_10016899
1202 Ga0207678_10080497
1203 Ga0207678_10087281
1204 Ga0207678_10110303
1205 Ga0207678_10266777
1206 Ga0207708_10000693
1207 Ga0207708_10146458
1208 Ga0207702_10002542
1209 Ga0207702_10006152
1210 Ga0207702_10009988
1211 Ga0207702_10047792
1212 Ga0207702_10054824
1213 Ga0207702_10196421
1214 Ga0207641_10017974
1215 Ga0207641_10057916
1216 Ga0207641_10083289
1217 Ga0207641_10207003
1218 Ga0207648_10000126
1219 Ga0207648_10001872
1220 Ga0207648_10074378
1221 Ga0207648_10150629
1222 Ga0207676_10000466
1223 Ga0207676_10171238
1224 Ga0207676_10592981
1225 Ga0207674_10002507
1226 Ga0207674_10004946
1227 Ga0207674_10113976
1228 Ga0207675_100021296
1229 Ga0207675_100026138
1230 Ga0207675_100041498
1231 Ga0207675_100070599
1232 Ga0207675_100115513
1233 Ga0207683_10000487
1234 Ga0207683_10001731
1235 Ga0207683_10006222
1236 Ga0207683_10135897
1237 Ga0207683_10360102
1238 Ga0207683_10579444
1239 Ga0207698_10009365
1240 Ga0207698_10012240
1241 Ga0207698_10035501
1242 Ga0207698_10103804
1243 Ga0207698_10512620
1244 Ga0209999_1002890
1245 Ga0209970_1005522
1246 Ga0209983_1004865
1247 Ga0209983_1008219
1248 Ga0209971_1016658
1249 Ga0209974_10004825
1250 Ga0209974_10009273
1251 Ga0207428_10014978
1252 Ga0268266_10021725
1253 Ga0268266_10114264
1254 Ga0268266_10449692
1255 Ga0268265_10013273
1256 Ga0268265_10063422
1257 Ga0268265_10196449
1258 Ga0268265_10223686
1259 Ga0268264_10025634
1260 Ga0268264_10026376
1261 Ga0268264_10036009
1262 Ga0268264_10170381
1263 Ga0268264_10284063
1264 Ga0307408_100004748
1265 Ga0307405_10000547
1266 Ga0307405_10000931
1267 Ga0307413_10056407
1268 Ga0307413_10253563
1269 Ga0307410_10005943
1270 Ga0307410_10030559
1271 Ga0307410_10037162
1272 Ga0307410_10116498
1273 Ga0307406_10006227
1274 Ga0307406_10079513
1275 Ga0307406_10114041
1276 Ga0307407_10101124
1277 Ga0307407_10123013
1278 Ga0307412_10014646
1279 Ga0307412_10266040
1280 Ga0307409_100006013
1281 Ga0307409_100020047
1282 Ga0307409_100029171
1283 Ga0307409_100141283
1284 Ga0307416_100018425
1285 Ga0307416_100035114
1286 Ga0307416_100385447
1287 Ga0307411_10003685
1288 Ga0307411_10012224
1289 Ga0307415_100000868
1290 Ga0373923_0000483
1291 Ga0373945_0057074
1292 Ga0373953_0015750
1293 Ga0373956_0001349
1294 Ga0373956_0176650
1295 Ga0373957_0074535
1296 Ga0373946_0010844
1297 Ga0373955_0001103
1298 Ga0373955_0001462
1299 Ga0373924_0003305
1300 Ga0373931_0025480
1301 Ga0373931_0067817
1302 Ga0373935_0040470
1303 Ga0373935_0048870
1304 Ga0373935_0250338
1305 Ga0373927_0073284
1306 Ga0373933_0014421
1307 Ga0373947_0147689
1308 Ga0373937_0005152
1309 Ga0373937_0116688
1310 Ga0373937_0135680
1311 Ga0373925_0041911
1312 Ga0395899_0045183
1313 Ga0395905_0028209
1314 Ga0395901_0046290
1315 Ga0395901_0126062
1316 Ga0451853_3108887
1317 Ga0451577_0069485
1318 Ga0466957_0155846
1319 Ga0451576_0123482
1320 Ga0466967_0323659
1321 Ga0495592_0010333
1322 Ga0495629_0011886
1323 Ga0495651_0071696
1324 Ga0495651_0132387
1325 Ga0495653_0043849
1326 Ga0495580_0020030
1327 Ga0495580_0038322
1328 Ga0495580_0246943
1329 Ga0495582_0005076
1330 Ga0495639_0008809
1331 Ga0495664_0129051
1332 Ga0495594_0138802
1333 Ga0495608_0032233
1334 Ga0495608_0086073
1335 Ga0495628_0581661
1336 Ga0495630_0301604
1337 Ga0495652_0063749
1338 Ga0495665_0007341
1339 Ga0495586_0088508
1340 Ga0495587_0011439
1341 Ga0495645_0001810
1342 Ga0495667_0025748
1343 Ga0495634_0070494
1344 Ga0495635_0015306
1345 Ga0495657_0313489
1346 Ga0495599_0003356
1347 Ga0495623_0036132
1348 Ga0495646_0152579
1349 Ga0495647_0004126
1350 Ga0495658_0062138
1351 Ga0495613_0009130
1352 Ga0495600_0056416
1353 Ga0495600_0067474
1354 Ga0495581_0014766
1355 Ga0495604_0129581
1356 Ga0495674_0111328
1357 Ga0495680_0036791
1358 Ga0495680_0329827
1359 Ga0495675_0055106
1360 Ga0495684_0014175
1361 Ga0495602_0208830
1362 Ga0495614_0029480
1363 Ga0496100_0024257
1364 Ga0496100_0058655
1365 Ga0496100_0196461
1366 Ga0496101_0019654
1367 Ga0496102_0036514
1368 Ga0496102_0219781
1369 Ga0496104_0001180
1370 Ga0496105_0044362
1371 Ga0496106_0000971
1372 Ga0496106_0072806
1373 Ga0496106_0124347
1374 Ga0496107_0002428
1375 Ga0496107_0208725
1376 Ga0496108_0011460
1377 Ga0496108_0061063
1378 Ga0496108_0338390
1379 Ga0496108_0414382
1380 Ga0496109_0041278
1381 Ga0496109_0464614
1382 Ga0496112_0000187
1383 Ga0496113_0249310
1384 Ga0496114_0052019
1385 Ga0496114_0057667
1386 Ga0496114_0092239
1387 Ga0496115_0021241
1388 Ga0501034_0666663
1389 nmdc:mga08y16_34775_c1
1390 nmdc:mga0n895_89199_c1
1391 nmdc:mga0rr50_46729_c1
1392 nmdc:mga08x19_280794_c1
1393 Ga0495601_0036873
1394 Ga0495601_0056435
1395 Ga0495595_0043543
1396 Ga0495595_0046028
1397 Ga0495619_0009048
1398 Ga0495619_0010006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

78

289

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9547 71 152
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9337 64 152
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8193 64 152
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7478 71 152
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.684 78 159
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9945 71 161 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9529 71 161 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9513 71 152 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8758 71 152 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8756 78 160 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9693 45 175
AF-A0A3D2D9Z2-F1-model_v4 deleted 0.962 73 243
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9413 45 175
AF-A0A1V6AJT0-F1-model_v4 Protease HtpX (EC 3.4.24.-) 0.9393 36 287 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A836NWC2-F1-model_v4 deleted 0.9329 31 285

Map