F476008

General Info

Members Datasets Scaffolds Average Seq Length
699 295 1398 150

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100416058|Ga0070690_1004160582
Length 159
Sequence MLRLSKKADYALMAMKHLAVSSVRSDRTSHASSSAREIAELYDIPIELMAKVLQRLVRRGLLASTQGTRGGYQLARLPSQISVADVIQAIDGPVTVTACSTDEGTQCEQFSKCNVRDPLWRVREKILSALGECTIAELAADVPPPATVKAAVLHRSAGM

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 4.58
Rhizosphere 94.28
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100416058 3300005330 Bacteria 990
2 Ga0006777J48905_1096487 3300003308 Unclassified 553
3 Ga0058859_11609013 3300004798 Bacteria 1330
4 Ga0058860_12077543 3300004801 Bacteria 1021
5 Ga0058862_12725589 3300004803 Bacteria 1177
6 Ga0065712_10005878 3300005290 Bacteria 2947
7 Ga0065715_10057391 3300005293 Unclassified 859
8 Ga0065715_10559384 3300005293 Unclassified 735
9 Ga0065715_10590170 3300005293 Bacteria 714
10 Ga0065707_10088482 3300005295 Bacteria 4647
11 Ga0065707_10475393 3300005295 Bacteria 777
12 Ga0065707_10848142 3300005295 Bacteria 577
13 Ga0070676_10011104 3300005328 Bacteria 4895
14 Ga0070676_10160690 3300005328 Bacteria 1446
15 Ga0070676_10222771 3300005328 Bacteria 1247
16 Ga0070683_100220622 3300005329 Bacteria 1802
17 Ga0070683_100663272 3300005329 Bacteria 999
18 Ga0070690_100066729 3300005330 Bacteria 2330
19 Ga0070690_100216486 3300005330 Bacteria 1340
20 Ga0070690_100478816 3300005330 Bacteria 928
21 Ga0070670_100086329 3300005331 Bacteria 2696
22 Ga0070670_100512297 3300005331 Bacteria 1068
23 Ga0070670_100670051 3300005331 Bacteria 932
24 Ga0070670_101493942 3300005331 Unclassified 620
25 Ga0068869_100322605 3300005334 Bacteria 1253
26 Ga0068869_100410831 3300005334 Bacteria 1115
27 Ga0068869_100630861 3300005334 Bacteria 908
28 Ga0068869_100765334 3300005334 Bacteria 828
29 Ga0070666_10111187 3300005335 Bacteria 1895
30 Ga0070666_10114907 3300005335 Bacteria 1864
31 Ga0070666_10191949 3300005335 Bacteria 1435
32 Ga0070666_10396554 3300005335 Bacteria 992
33 Ga0070666_10422873 3300005335 Bacteria 960
34 Ga0070666_10861700 3300005335 Bacteria 669
35 Ga0070680_100933180 3300005336 Unclassified 749
36 Ga0070680_101540452 3300005336 Unclassified 576
37 Ga0070689_100568390 3300005340 Bacteria 979
38 Ga0070689_100719759 3300005340 Bacteria 873
39 Ga0070691_10027517 3300005341 Bacteria 2653
40 Ga0070687_100423428 3300005343 Bacteria 879
41 Ga0070668_100027940 3300005347 Bacteria 4281
42 Ga0070668_100088382 3300005347 Bacteria 2439
43 Ga0070668_100322008 3300005347 Bacteria 1302
44 Ga0070668_101763278 3300005347 Unclassified 569
45 Ga0070669_100026319 3300005353 Bacteria 4185
46 Ga0070669_100032978 3300005353 Bacteria 3743
47 Ga0070669_100144665 3300005353 Bacteria 1836
48 Ga0070675_100001471 3300005354 Bacteria 17360
49 Ga0070675_100020524 3300005354 Bacteria 5271
50 Ga0070675_100099647 3300005354 Bacteria 2446
51 Ga0070675_100294978 3300005354 Bacteria 1427
52 Ga0070675_100628492 3300005354 Bacteria 975
53 Ga0070671_100845799 3300005355 Bacteria 798
54 Ga0070671_101220696 3300005355 Bacteria 662
55 Ga0070674_100046956 3300005356 Bacteria 2956
56 Ga0070674_100202591 3300005356 Bacteria 1533
57 Ga0070674_100305527 3300005356 Bacteria 1270
58 Ga0070674_100422617 3300005356 Bacteria 1094
59 Ga0070673_100008147 3300005364 Bacteria 6953
60 Ga0070673_100093990 3300005364 Bacteria 2457
61 Ga0070688_100414576 3300005365 Bacteria 1000
62 Ga0070667_100726415 3300005367 Bacteria 920
63 Ga0070667_100789000 3300005367 Bacteria 881
64 Ga0070709_10180512 3300005434 Bacteria 1482
65 Ga0070709_10390598 3300005434 Bacteria 1037
66 Ga0070714_100001083 3300005435 Bacteria 19485
67 Ga0070713_100062692 3300005436 Bacteria 3114
68 Ga0070713_100844641 3300005436 Bacteria 879
69 Ga0070713_102125906 3300005436 Unclassified 544
70 Ga0070701_10001654 3300005438 Bacteria 8337
71 Ga0070705_100019261 3300005440 Bacteria 3591
72 Ga0070705_100054623 3300005440 Bacteria 2344
73 Ga0070705_100264982 3300005440 Bacteria 1214
74 Ga0070705_100698016 3300005440 Bacteria 797
75 Ga0070700_100009398 3300005441 Bacteria 5364
76 Ga0070700_100430046 3300005441 Unclassified 1000
77 Ga0070700_100459551 3300005441 Bacteria 971
78 Ga0070694_100023728 3300005444 Bacteria 3950
79 Ga0070694_100248133 3300005444 Bacteria 1346
80 Ga0070678_100059687 3300005456 Bacteria 2804
81 Ga0070678_100696857 3300005456 Bacteria 915
82 Ga0070678_100782860 3300005456 Bacteria 865
83 Ga0070662_100049454 3300005457 Bacteria 3031
84 Ga0070662_100536653 3300005457 Bacteria 979
85 Ga0070662_101041902 3300005457 Bacteria 701
86 Ga0070662_101200334 3300005457 Unclassified 652
87 Ga0070662_101653293 3300005457 Bacteria 553
88 Ga0070681_10458054 3300005458 Bacteria 1188
89 Ga0068867_100069701 3300005459 Bacteria 2626
90 Ga0068867_100301611 3300005459 Bacteria 1321
91 Ga0068867_100390350 3300005459 Bacteria 1171
92 Ga0068867_101200284 3300005459 Bacteria 697
93 Ga0070685_10463499 3300005466 Bacteria 890
94 Ga0070706_100183428 3300005467 Bacteria 1954
95 Ga0070706_100590756 3300005467 Unclassified 1032
96 Ga0070706_100855440 3300005467 Bacteria 841
97 Ga0070707_100127989 3300005468 Bacteria 2468
98 Ga0070707_100173755 3300005468 Bacteria 2099
99 Ga0070698_100339908 3300005471 Bacteria 1433
100 Ga0070699_100021600 3300005518 Bacteria 5550
101 Ga0070699_101286387 3300005518 Bacteria 671
102 Ga0070684_100101079 3300005535 Bacteria 2576
103 Ga0070684_100524357 3300005535 Bacteria 1098
104 Ga0070684_100559667 3300005535 Bacteria 1061
105 Ga0070684_100852637 3300005535 Unclassified 853
106 Ga0070697_100015943 3300005536 Bacteria 5906
107 Ga0070697_100661057 3300005536 Bacteria 921
108 Ga0070697_101538738 3300005536 Bacteria 595
109 Ga0068853_100588664 3300005539 Bacteria 1056
110 Ga0070672_100397447 3300005543 Bacteria 1181
111 Ga0070672_100870287 3300005543 Bacteria 795
112 Ga0070686_100001456 3300005544 Bacteria 13358
113 Ga0070686_100034136 3300005544 Bacteria 3132
114 Ga0070686_100122761 3300005544 Bacteria 1785
115 Ga0070686_100165422 3300005544 Bacteria 1560
116 Ga0070686_101590694 3300005544 Unclassified 553
117 Ga0070695_100105152 3300005545 Bacteria 1907
118 Ga0070696_100092985 3300005546 Bacteria 2150
119 Ga0070696_100216083 3300005546 Bacteria 1437
120 Ga0070696_100484081 3300005546 Bacteria 982
121 Ga0070696_100675059 3300005546 Bacteria 840
122 Ga0070696_101129358 3300005546 Unclassified 660
123 Ga0070696_101628903 3300005546 Unclassified 555
124 Ga0070696_101897725 3300005546 Unclassified 516
125 Ga0070693_100363371 3300005547 Bacteria 994
126 Ga0070693_100610121 3300005547 Unclassified 789
127 Ga0070665_100024961 3300005548 Bacteria 6025
128 Ga0070665_100510241 3300005548 Bacteria 1214
129 Ga0070665_100662370 3300005548 Unclassified 1057
130 Ga0070704_100031310 3300005549 Bacteria 3577
131 Ga0070704_100097384 3300005549 Bacteria 2208
132 Ga0070704_100914363 3300005549 Bacteria 790
133 Ga0068855_102133352 3300005563 Unclassified 564
134 Ga0070664_100162011 3300005564 Bacteria 1979
135 Ga0070664_100535950 3300005564 Bacteria 1081
136 Ga0070664_100645325 3300005564 Bacteria 984
137 Ga0070664_100985886 3300005564 Unclassified 792
138 Ga0068857_101486852 3300005577 Unclassified 660
139 Ga0068854_100091905 3300005578 Bacteria 2260
140 Ga0068854_100767335 3300005578 Bacteria 838
141 Ga0068854_100959223 3300005578 Bacteria 755
142 Ga0068854_101058814 3300005578 Unclassified 721
143 Ga0068854_101463666 3300005578 Unclassified 619
144 Ga0068856_100021485 3300005614 Bacteria 6273
145 Ga0070702_100012843 3300005615 Bacteria 4214
146 Ga0070702_100343440 3300005615 Bacteria 1048
147 Ga0070702_100641607 3300005615 Unclassified 802
148 Ga0068852_100102970 3300005616 Bacteria 2581
149 Ga0068852_100556233 3300005616 Bacteria 1148
150 Ga0068852_101260013 3300005616 Bacteria 761
151 Ga0068852_101330840 3300005616 Unclassified 740
152 Ga0068859_100086862 3300005617 Bacteria 3175
153 Ga0068859_100487687 3300005617 Bacteria 1328
154 Ga0068859_100523178 3300005617 Unclassified 1281
155 Ga0068859_100747532 3300005617 Unclassified 1067
156 Ga0068859_100792547 3300005617 Bacteria 1035
157 Ga0068859_101186458 3300005617 Bacteria 841
158 Ga0068859_101540212 3300005617 Unclassified 734
159 Ga0068864_100117743 3300005618 Bacteria 2372
160 Ga0068864_100341281 3300005618 Bacteria 1411
161 Ga0068864_100879820 3300005618 Bacteria 884
162 Ga0068866_10067938 3300005718 Bacteria 1873
163 Ga0068866_10072531 3300005718 Bacteria 1824
164 Ga0068861_100024326 3300005719 Bacteria 4379
165 Ga0068861_100031667 3300005719 Bacteria 3887
166 Ga0068861_100052050 3300005719 Bacteria 3111
167 Ga0068861_100510227 3300005719 Bacteria 1089
168 Ga0068861_101442947 3300005719 Unclassified 673
169 Ga0068851_10228102 3300005834 Bacteria 1049
170 Ga0068851_10760809 3300005834 Bacteria 600
171 Ga0068870_10059655 3300005840 Bacteria 2046
172 Ga0068863_100141802 3300005841 Bacteria 2297
173 Ga0068863_100619501 3300005841 Bacteria 1072
174 Ga0068863_100731483 3300005841 Bacteria 985
175 Ga0068858_100012089 3300005842 Bacteria 8137
176 Ga0068858_100253352 3300005842 Bacteria 1672
177 Ga0068858_100412676 3300005842 Bacteria 1298
178 Ga0068858_100556327 3300005842 Bacteria 1111
179 Ga0068858_100692383 3300005842 Bacteria 991
180 Ga0068860_100619302 3300005843 Bacteria 1089
181 Ga0068860_101117044 3300005843 Unclassified 808
182 Ga0068862_100282522 3300005844 Bacteria 1521
183 Ga0068862_100298445 3300005844 Bacteria 1481
184 Ga0068862_100350413 3300005844 Bacteria 1370
185 Ga0068862_100756632 3300005844 Bacteria 946
186 Ga0068862_101120534 3300005844 Bacteria 783
187 Ga0081455_10049286 3300005937 Bacteria 3631
188 Ga0081455_10096122 3300005937 Bacteria 2389
189 Ga0081539_10008229 3300005985 Bacteria 9166
190 Ga0070717_10527048 3300006028 Bacteria 1069
191 Ga0075368_10229398 3300006042 Bacteria 790
192 Ga0070715_10060513 3300006163 Bacteria 1661
193 Ga0070716_100145920 3300006173 Bacteria 1516
194 Ga0097621_100000820 3300006237 Bacteria 21967
195 Ga0097621_100029201 3300006237 Bacteria 4353
196 Ga0097621_100036127 3300006237 Bacteria 3952
197 Ga0097621_100042957 3300006237 Bacteria 3642
198 Ga0097621_100139356 3300006237 Bacteria 2072
199 Ga0097621_100314136 3300006237 Bacteria 1387
200 Ga0075370_10279932 3300006353 Bacteria 991
201 Ga0068871_100000748 3300006358 Bacteria 22005
202 Ga0068871_100014327 3300006358 Bacteria 5907
203 Ga0068871_100020494 3300006358 Bacteria 5067
204 Ga0068871_100024414 3300006358 Bacteria 4688
205 Ga0068871_100145291 3300006358 Bacteria 2019
206 Ga0068871_100610021 3300006358 Unclassified 993
207 Ga0068871_100645888 3300006358 Bacteria 966
208 Ga0068871_100649963 3300006358 Bacteria 963
209 Ga0075428_101801824 3300006844 Bacteria 637
210 Ga0075430_100940421 3300006846 Unclassified 712
211 Ga0075431_100445684 3300006847 Bacteria 1291
212 Ga0075433_10007699 3300006852 Bacteria 8557
213 Ga0075433_10052071 3300006852 Bacteria 3566
214 Ga0075433_10369238 3300006852 Bacteria 1267
215 Ga0075434_100025302 3300006871 Bacteria 5807
216 Ga0075434_100078477 3300006871 Bacteria 3297
217 Ga0075434_100217873 3300006871 Bacteria 1929
218 Ga0075434_100289494 3300006871 Bacteria 1658
219 Ga0075434_100910928 3300006871 Bacteria 894
220 Ga0075434_101150594 3300006871 Bacteria 788
221 Ga0068865_100033564 3300006881 Bacteria 3437
222 Ga0068865_100534689 3300006881 Bacteria 982
223 Ga0068865_100813975 3300006881 Unclassified 807
224 Ga0075436_100003325 3300006914 Bacteria 11005
225 Ga0075436_100008962 3300006914 Bacteria 6846
226 Ga0075436_100036269 3300006914 Bacteria 3403
227 Ga0075436_100438323 3300006914 Bacteria 950
228 Ga0075436_100993202 3300006914 Unclassified 630
229 Ga0097620_100086865 3300006931 Bacteria 3175
230 Ga0097620_100487680 3300006931 Bacteria 1328
231 Ga0097620_100523224 3300006931 Unclassified 1281
232 Ga0097620_100747555 3300006931 Unclassified 1067
233 Ga0097620_100792588 3300006931 Bacteria 1035
234 Ga0097620_101186535 3300006931 Bacteria 841
235 Ga0097620_101540007 3300006931 Unclassified 734
236 Ga0075435_100000192 3300007076 Bacteria 36826
237 Ga0075435_100002813 3300007076 Bacteria 11639
238 Ga0075435_100026694 3300007076 Bacteria 4510
239 Ga0075435_100259932 3300007076 Bacteria 1479
240 Ga0075435_100423221 3300007076 Bacteria 1147
241 Ga0075435_100458528 3300007076 Bacteria 1100
242 Ga0075435_100527618 3300007076 Bacteria 1022
243 Ga0105240_10617828 3300009093 Bacteria 1191
244 Ga0111539_10003965 3300009094 Bacteria 19451
245 Ga0111539_10012733 3300009094 Bacteria 10533
246 Ga0111539_10259314 3300009094 Bacteria 2024
247 Ga0111539_11494740 3300009094 Bacteria 783
248 Ga0111539_11500484 3300009094 Unclassified 782
249 Ga0111539_12334745 3300009094 Bacteria 621
250 Ga0105245_10020103 3300009098 Bacteria 5853
251 Ga0105245_10258279 3300009098 Bacteria 1695
252 Ga0105245_10346988 3300009098 Bacteria 1469
253 Ga0105245_12082645 3300009098 Unclassified 621
254 Ga0105245_12237366 3300009098 Unclassified 600
255 Ga0105247_10018462 3300009101 Bacteria 4183
256 Ga0114129_10000434 3300009147 Bacteria 49632
257 Ga0114129_10044118 3300009147 Bacteria 6272
258 Ga0114129_10184527 3300009147 Bacteria 2836
259 Ga0114129_10283926 3300009147 Bacteria 2211
260 Ga0114129_10292698 3300009147 Bacteria 2172
261 Ga0114129_10430334 3300009147 Bacteria 1734
262 Ga0105243_10109693 3300009148 Bacteria 2306
263 Ga0105243_10302494 3300009148 Bacteria 1450
264 Ga0105243_10384235 3300009148 Bacteria 1299
265 Ga0105243_10576711 3300009148 Bacteria 1079
266 Ga0105243_11397552 3300009148 Bacteria 720
267 Ga0105241_10120746 3300009174 Bacteria 2110
268 Ga0105241_11652243 3300009174 Unclassified 621
269 Ga0105242_10014046 3300009176 Bacteria 6197
270 Ga0105242_10020985 3300009176 Bacteria 5124
271 Ga0105242_10034230 3300009176 Bacteria 4073
272 Ga0105242_10557734 3300009176 Bacteria 1099
273 Ga0105242_10624214 3300009176 Bacteria 1044
274 Ga0105242_10822149 3300009176 Bacteria 922
275 Ga0105242_11004951 3300009176 Bacteria 842
276 Ga0105248_10017990 3300009177 Bacteria 7801
277 Ga0105248_10080837 3300009177 Bacteria 3653
278 Ga0105248_10173762 3300009177 Bacteria 2428
279 Ga0105248_10407503 3300009177 Bacteria 1531
280 Ga0105248_10813830 3300009177 Bacteria 1054
281 Ga0105248_10959717 3300009177 Bacteria 966
282 Ga0105248_10998479 3300009177 Bacteria 945
283 Ga0105248_11045686 3300009177 Bacteria 923
284 Ga0105248_11169078 3300009177 Bacteria 870
285 Ga0105248_11935155 3300009177 Bacteria 669
286 Ga0105248_12351815 3300009177 Unclassified 607
287 Ga0105249_10583309 3300009553 Bacteria 1171
288 Ga0105249_10900196 3300009553 Bacteria 952
289 Ga0105249_10987904 3300009553 Bacteria 910
290 Ga0105249_11057683 3300009553 Unclassified 881
291 Ga0105249_12151131 3300009553 Bacteria 631
292 Ga0105239_10467160 3300010375 Bacteria 1432
293 Ga0105246_10797392 3300011119 Bacteria 838
294 Ga0157369_10247257 3300013105 Bacteria 1862
295 Ga0157374_10071772 3300013296 Bacteria 3266
296 Ga0157374_10212217 3300013296 Bacteria 1898
297 Ga0157374_10533595 3300013296 Bacteria 1180
298 Ga0157374_12466955 3300013296 Unclassified 547
299 Ga0157378_10001160 3300013297 Bacteria 23959
300 Ga0157378_10158596 3300013297 Bacteria 2114
301 Ga0157378_11018048 3300013297 Unclassified 863
302 Ga0157378_11815288 3300013297 Bacteria 658
303 Ga0163162_10994371 3300013306 Bacteria 948
304 Ga0163162_11363103 3300013306 Bacteria 807
305 Ga0163162_13299388 3300013306 Unclassified 517
306 Ga0157375_10227766 3300013308 Bacteria 2023
307 Ga0157375_10406809 3300013308 Bacteria 1527
308 Ga0157375_10592878 3300013308 Bacteria 1268
309 Ga0157375_10897851 3300013308 Bacteria 1030
310 Ga0157375_11453939 3300013308 Bacteria 808
311 Ga0157375_11744238 3300013308 Unclassified 738
312 Ga0163163_10096088 3300014325 Bacteria 2983
313 Ga0163163_10226180 3300014325 Bacteria 1920
314 Ga0163163_10465455 3300014325 Bacteria 1325
315 Ga0163163_11015556 3300014325 Unclassified 893
316 Ga0163163_12364970 3300014325 Bacteria 590
317 Ga0157380_10475308 3300014326 Bacteria 1207
318 Ga0157380_10714036 3300014326 Bacteria 1009
319 Ga0157380_10714135 3300014326 Bacteria 1009
320 Ga0157380_10745904 3300014326 Bacteria 990
321 Ga0157380_11442930 3300014326 Bacteria 740
322 Ga0157377_10122392 3300014745 Bacteria 1578
323 Ga0157377_10327851 3300014745 Bacteria 1019
324 Ga0157377_11137547 3300014745 Unclassified 600
325 Ga0157379_10050508 3300014968 Bacteria 3713
326 Ga0157379_10077042 3300014968 Bacteria 2986
327 Ga0157379_10406986 3300014968 Bacteria 1251
328 Ga0157379_10956845 3300014968 Bacteria 815
329 Ga0157379_10990176 3300014968 Bacteria 801
330 Ga0157376_10003823 3300014969 Bacteria 10412
331 Ga0157376_10019382 3300014969 Bacteria 5243
332 Ga0157376_10596172 3300014969 Bacteria 1099
333 Ga0157376_10822135 3300014969 Bacteria 943
334 Ga0157376_11277521 3300014969 Bacteria 764
335 Ga0157376_11536992 3300014969 Unclassified 699
336 Ga0157376_12421312 3300014969 Unclassified 564
337 Ga0182007_10132394 3300015262 Bacteria 839
338 Ga0163161_10943963 3300017792 Unclassified 733
339 Ga0206356_10062690 3300020070 Bacteria 1004
340 Ga0206352_10983658 3300020078 Bacteria 596
341 Ga0206350_10455111 3300020080 Bacteria 747
342 Ga0207697_10031362 3300025315 Bacteria 2174
343 Ga0207656_10368159 3300025321 Unclassified 719
344 Ga0207682_10277287 3300025893 Unclassified 784
345 Ga0207642_10040255 3300025899 Bacteria 2037
346 Ga0207642_10495104 3300025899 Bacteria 747
347 Ga0207642_10660725 3300025899 Unclassified 656
348 Ga0207642_10774455 3300025899 Unclassified 609
349 Ga0207710_10041200 3300025900 Bacteria 2048
350 Ga0207680_10019112 3300025903 Bacteria 3660
351 Ga0207680_10044326 3300025903 Bacteria 2615
352 Ga0207680_10291029 3300025903 Bacteria 1137
353 Ga0207680_10380043 3300025903 Bacteria 996
354 Ga0207680_10773624 3300025903 Bacteria 688
355 Ga0207699_10014617 3300025906 Bacteria 4053
356 Ga0207645_10015913 3300025907 Bacteria 4985
357 Ga0207645_10113284 3300025907 Bacteria 1757
358 Ga0207645_10297148 3300025907 Unclassified 1075
359 Ga0207643_10065802 3300025908 Bacteria 2077
360 Ga0207654_10774706 3300025911 Unclassified 692
361 Ga0207695_10915279 3300025913 Bacteria 756
362 Ga0207662_10132340 3300025918 Bacteria 1574
363 Ga0207657_10390712 3300025919 Bacteria 1095
364 Ga0207652_10205661 3300025921 Bacteria 1772
365 Ga0207681_10028989 3300025923 Bacteria 3589
366 Ga0207681_10403894 3300025923 Bacteria 1104
367 Ga0207681_11078549 3300025923 Unclassified 674
368 Ga0207650_10202238 3300025925 Bacteria 1592
369 Ga0207650_10366329 3300025925 Bacteria 1188
370 Ga0207650_10546226 3300025925 Bacteria 971
371 Ga0207659_10002275 3300025926 Bacteria 11435
372 Ga0207659_10056122 3300025926 Bacteria 2820
373 Ga0207659_10260362 3300025926 Bacteria 1411
374 Ga0207659_10349932 3300025926 Bacteria 1226
375 Ga0207700_10002726 3300025928 Bacteria 10184
376 Ga0207644_10381326 3300025931 Bacteria 1150
377 Ga0207706_10461992 3300025933 Bacteria 1098
378 Ga0207686_10006012 3300025934 Bacteria 6515
379 Ga0207686_10035017 3300025934 Bacteria 3010
380 Ga0207686_10207212 3300025934 Bacteria 1408
381 Ga0207686_10674166 3300025934 Bacteria 820
382 Ga0207686_10871575 3300025934 Bacteria 725
383 Ga0207709_10086843 3300025935 Bacteria 2032
384 Ga0207670_10194560 3300025936 Bacteria 1536
385 Ga0207670_10653915 3300025936 Unclassified 867
386 Ga0207669_10019759 3300025937 Bacteria 3517
387 Ga0207669_10051838 3300025937 Bacteria 2461
388 Ga0207669_10103439 3300025937 Bacteria 1889
389 Ga0207669_10209882 3300025937 Bacteria 1420
390 Ga0207669_10336328 3300025937 Bacteria 1161
391 Ga0207704_10057324 3300025938 Bacteria 2392
392 Ga0207665_10205455 3300025939 Bacteria 1437
393 Ga0207665_10348591 3300025939 Bacteria 1117
394 Ga0207691_10449807 3300025940 Bacteria 1096
395 Ga0207691_10647960 3300025940 Bacteria 893
396 Ga0207691_10801184 3300025940 Unclassified 792
397 Ga0207711_10020432 3300025941 Bacteria 5520
398 Ga0207711_10032545 3300025941 Bacteria 4409
399 Ga0207711_10118062 3300025941 Bacteria 2366
400 Ga0207711_10608165 3300025941 Bacteria 1020
401 Ga0207711_10918540 3300025941 Bacteria 814
402 Ga0207689_10187747 3300025942 Bacteria 1705
403 Ga0207689_10390264 3300025942 Unclassified 1160
404 Ga0207689_10417290 3300025942 Bacteria 1120
405 Ga0207689_10910578 3300025942 Unclassified 742
406 Ga0207661_10355288 3300025944 Bacteria 1323
407 Ga0207679_10533217 3300025945 Bacteria 1051
408 Ga0207651_10017196 3300025960 Bacteria 4264
409 Ga0207651_10353556 3300025960 Bacteria 1238
410 Ga0207651_10428515 3300025960 Bacteria 1131
411 Ga0207651_11132812 3300025960 Bacteria 702
412 Ga0207651_11155533 3300025960 Bacteria 694
413 Ga0207712_10416616 3300025961 Bacteria 1132
414 Ga0207712_10786532 3300025961 Bacteria 836
415 Ga0207668_11066913 3300025972 Bacteria 723
416 Ga0207640_10074611 3300025981 Bacteria 2296
417 Ga0207640_10205218 3300025981 Bacteria 1497
418 Ga0207640_10850234 3300025981 Bacteria 794
419 Ga0207658_10745344 3300025986 Bacteria 887
420 Ga0207677_10313034 3300026023 Bacteria 1302
421 Ga0207677_10466439 3300026023 Bacteria 1085
422 Ga0207703_10013711 3300026035 Bacteria 6317
423 Ga0207703_10273545 3300026035 Bacteria 1531
424 Ga0207703_10526984 3300026035 Bacteria 1112
425 Ga0207639_10348352 3300026041 Bacteria 1322
426 Ga0207639_11142125 3300026041 Bacteria 731
427 Ga0207708_10033406 3300026075 Bacteria 3909
428 Ga0207708_10196847 3300026075 Bacteria 1606
429 Ga0207708_10302781 3300026075 Bacteria 1301
430 Ga0207708_10433338 3300026075 Unclassified 1092
431 Ga0207702_10017099 3300026078 Bacteria 5998
432 Ga0207641_10462021 3300026088 Bacteria 1228
433 Ga0207648_10082175 3300026089 Bacteria 2809
434 Ga0207648_10131258 3300026089 Bacteria 2205
435 Ga0207648_10189429 3300026089 Bacteria 1822
436 Ga0207648_10305959 3300026089 Bacteria 1426
437 Ga0207648_10839357 3300026089 Bacteria 856
438 Ga0207648_11191783 3300026089 Bacteria 715
439 Ga0207676_10122176 3300026095 Bacteria 2198
440 Ga0207676_10166415 3300026095 Bacteria 1916
441 Ga0207676_10379618 3300026095 Bacteria 1315
442 Ga0207676_10527251 3300026095 Bacteria 1125
443 Ga0207674_11404058 3300026116 Bacteria 667
444 Ga0207675_100016506 3300026118 Bacteria 6894
445 Ga0207675_100028549 3300026118 Bacteria 5195
446 Ga0207675_100060170 3300026118 Bacteria 3546
447 Ga0207675_100159184 3300026118 Bacteria 2153
448 Ga0207675_100175717 3300026118 Bacteria 2049
449 Ga0207675_100227419 3300026118 Bacteria 1799
450 Ga0207675_100473278 3300026118 Bacteria 1244
451 Ga0207683_10083130 3300026121 Bacteria 2845
452 Ga0207683_10094405 3300026121 Bacteria 2666
453 Ga0207683_10957923 3300026121 Bacteria 795
454 Ga0207428_10184684 3300027907 Bacteria 1574
455 Ga0207428_10257478 3300027907 Bacteria 1300
456 Ga0268266_10007237 3300028379 Bacteria 10034
457 Ga0268266_10014041 3300028379 Bacteria 6895
458 Ga0268266_10396162 3300028379 Bacteria 1305
459 Ga0268266_10717807 3300028379 Bacteria 964
460 Ga0268266_11097029 3300028379 Unclassified 770
461 Ga0268265_10073843 3300028380 Bacteria 2665
462 Ga0268265_10095079 3300028380 Bacteria 2391
463 Ga0268265_10366119 3300028380 Bacteria 1321
464 Ga0268265_10415146 3300028380 Bacteria 1248
465 Ga0268265_11095638 3300028380 Bacteria 790
466 Ga0268264_10603967 3300028381 Bacteria 1081
467 Ga0265332_10015920 3300031238 Bacteria 3319
468 Ga0265328_10033285 3300031239 Bacteria 1912
469 Ga0265320_10068339 3300031240 Bacteria 1679
470 Ga0265314_10026707 3300031711 Bacteria 4334
471 Ga0265342_10521984 3300031712 Unclassified 604
472 Ga0307406_11860656 3300031901 Bacteria 536
473 Ga0307416_100041649 3300032002 Bacteria 3579
474 Ga0307415_100408202 3300032126 Bacteria 1162
475 Ga0373930_0006116 3300034816 Bacteria 2022
476 Ga0373948_0011539 3300034817 Bacteria 1564
477 Ga0373950_0001144 3300034818 Bacteria 3404
478 Ga0373958_0016089 3300034819 Bacteria 1328
479 Ga0373958_0046810 3300034819 Bacteria 902
480 Ga0373959_0001529 3300034820 Bacteria 3686
481 Ga0373938_0000511 3300034957 Bacteria 6268
482 Ga0373926_0064341 3300035083 Bacteria 1340
483 Ga0373928_0085041 3300035084 Bacteria 803
484 Ga0373929_0002827 3300035085 Bacteria 3169
485 Ga0373934_0191040 3300035086 Bacteria 842
486 Ga0373940_0000437 3300035088 Bacteria 6355
487 Ga0373949_0002562 3300035090 Bacteria 4620
488 Ga0373951_0000713 3300035091 Bacteria 9122
489 Ga0373952_0001468 3300035092 Bacteria 4285
490 Ga0373932_0000374 3300035112 Bacteria 13771
491 Ga0373939_0003349 3300035114 Bacteria 3761
492 Ga0373941_0001016 3300035115 Bacteria 5827
493 Ga0373953_0021882 3300035117 Bacteria 2405
494 Ga0373954_0185805 3300035118 Bacteria 1020
495 Ga0373956_0194548 3300035119 Bacteria 961
496 Ga0373956_0416809 3300035119 Bacteria 641
497 Ga0373957_0237014 3300035120 Bacteria 766
498 Ga0373960_0000304 3300035121 Bacteria 9361
499 Ga0373943_0005300 3300035170 Bacteria 5799
500 Ga0373943_0355277 3300035170 Bacteria 840
501 Ga0373946_0096457 3300035171 Bacteria 1318
502 Ga0373946_0203738 3300035171 Bacteria 949
503 Ga0373955_0195506 3300035172 Bacteria 1203
504 Ga0373955_0242353 3300035172 Bacteria 1080
505 Ga0373942_0001386 3300035207 Bacteria 6268
506 Ga0373961_0003846 3300035241 Bacteria 3665
507 Ga0373961_0376427 3300035241 Unclassified 540
508 Ga0373962_0000484 3300035242 Bacteria 8817
509 Ga0373924_0024114 3300035410 Bacteria 2394
510 Ga0373931_0002957 3300035691 Bacteria 7585
511 Ga0373931_0815796 3300035691 Unclassified 623
512 Ga0373935_0023270 3300035692 Bacteria 3807
513 Ga0373935_0068910 3300035692 Bacteria 2277
514 Ga0373927_1066299 3300035695 Unclassified 533
515 Ga0373933_0167328 3300035724 Bacteria 1398
516 Ga0373933_0244683 3300035724 Bacteria 1154
517 Ga0373947_0007810 3300035725 Bacteria 6179
518 Ga0373947_0409944 3300035725 Bacteria 915
519 Ga0373947_0596051 3300035725 Bacteria 753
520 Ga0373947_0706117 3300035725 Bacteria 688
521 Ga0373947_1169052 3300035725 Unclassified 524
522 Ga0373937_0110617 3300036401 Bacteria 2555
523 Ga0373937_0417600 3300036401 Bacteria 1273
524 Ga0373937_1446212 3300036401 Unclassified 635
525 Ga0373937_1987996 3300036401 Unclassified 527
526 Ga0373925_0000987 3300037068 Bacteria 25925
527 Ga0373925_0332123 3300037068 Bacteria 1232
528 Ga0373925_0363443 3300037068 Bacteria 1177
529 Ga0395901_1208032 3300038443 Bacteria 722
530 Ga0436365_0974042 3300039437 Bacteria 7230
531 Ga0451839_0500936 3300041496 Bacteria 500
532 Ga0450890_059368 3300042127 Unclassified 597
533 Ga0466963_1148984 3300044694 Bacteria 546
534 Ga0451576_0060381 3300045051 Bacteria 3956
535 Ga0451576_0347476 3300045051 Bacteria 1553
536 Ga0495592_0017655 3300046454 Bacteria 5423
537 Ga0495603_0074880 3300046455 Bacteria 1988
538 Ga0495629_0531487 3300046459 Bacteria 791
539 Ga0495580_0105197 3300046472 Bacteria 1961
540 Ga0495580_0300875 3300046472 Bacteria 1092
541 Ga0495582_0080907 3300046473 Bacteria 1804
542 Ga0495582_0433876 3300046473 Bacteria 758
543 Ga0495582_0929663 3300046473 Unclassified 503
544 Ga0495639_0033025 3300046475 Bacteria 2310
545 Ga0495639_0075189 3300046475 Bacteria 1566
546 Ga0495664_0315096 3300046477 Bacteria 944
547 Ga0495608_0076812 3300046511 Bacteria 2174
548 Ga0495628_0010696 3300046516 Bacteria 7770
549 Ga0495628_0278038 3300046516 Bacteria 1244
550 Ga0495628_0409734 3300046516 Bacteria 989
551 Ga0495630_0027893 3300046517 Bacteria 4194
552 Ga0495644_0153178 3300046523 Bacteria 883
553 Ga0495642_0191905 3300046528 Bacteria 890
554 Ga0495652_0064984 3300046529 Bacteria 3067
555 Ga0495640_0110506 3300046533 Bacteria 1797
556 Ga0495640_0229436 3300046533 Bacteria 1168
557 Ga0495586_0072434 3300046535 Bacteria 1884
558 Ga0495586_0100463 3300046535 Bacteria 1605
559 Ga0495587_0239407 3300046536 Bacteria 1021
560 Ga0495587_0378721 3300046536 Bacteria 787
561 Ga0495621_0362684 3300046539 Unclassified 610
562 Ga0495645_0001334 3300046543 Bacteria 16733
563 Ga0495645_0010248 3300046543 Bacteria 6568
564 Ga0495656_0612485 3300046615 Bacteria 583
565 Ga0495634_0134026 3300046642 Bacteria 1577
566 Ga0495611_0375714 3300046648 Bacteria 651
567 Ga0495588_0179848 3300046674 Bacteria 1118
568 Ga0495657_0231921 3300046675 Bacteria 1116
569 Ga0495623_0196272 3300046679 Bacteria 1163
570 Ga0495623_0221484 3300046679 Bacteria 1078
571 Ga0495647_0020817 3300046681 Bacteria 2358
572 Ga0495647_0035530 3300046681 Bacteria 1872
573 Ga0495647_0061715 3300046681 Bacteria 1481
574 Ga0495658_0053477 3300046683 Bacteria 2294
575 Ga0495658_0164747 3300046683 Bacteria 1369
576 Ga0495658_0288593 3300046683 Bacteria 1036
577 Ga0495658_0832008 3300046683 Bacteria 591
578 Ga0495669_0060620 3300046684 Bacteria 1711
579 Ga0495613_0000720 3300046689 Bacteria 25918
580 Ga0495670_0436924 3300046691 Unclassified 709
581 Ga0495581_0164153 3300047315 Bacteria 1299
582 Ga0495604_0511813 3300047317 Bacteria 777
583 Ga0495674_0098266 3300047319 Bacteria 2493
584 Ga0495674_1103618 3300047319 Unclassified 604
585 Ga0495680_0784912 3300047322 Bacteria 623
586 Ga0495684_0006668 3300047471 Bacteria 8958
587 Ga0495684_1002019 3300047471 Bacteria 531
588 Ga0495602_0342982 3300048088 Bacteria 1080
589 Ga0496100_0003982 3300048903 Bacteria 7764
590 Ga0496100_0774195 3300048903 Bacteria 751
591 Ga0496101_0000451 3300048904 Bacteria 26069
592 Ga0496101_0739899 3300048904 Unclassified 776
593 Ga0496102_0329745 3300048905 Bacteria 1437
594 Ga0496102_0524973 3300048905 Bacteria 1106
595 Ga0496103_0333409 3300048906 Bacteria 976
596 Ga0496104_0012288 3300048907 Bacteria 7697
597 Ga0496104_0671848 3300048907 Bacteria 944
598 Ga0496104_1080593 3300048907 Bacteria 706
599 Ga0496105_0010234 3300048908 Bacteria 7373
600 Ga0496105_0689733 3300048908 Bacteria 785
601 Ga0496106_0103204 3300048909 Bacteria 2213
602 Ga0496106_0178080 3300048909 Bacteria 1687
603 Ga0496107_0523713 3300048910 Bacteria 879
604 Ga0496108_0043116 3300048911 Bacteria 3768
605 Ga0496108_0187117 3300048911 Bacteria 1794
606 Ga0496109_0290972 3300048912 Bacteria 1540
607 Ga0496109_1749994 3300048912 Unclassified 555
608 Ga0496110_0189494 3300048913 Bacteria 1868
609 Ga0496110_0274842 3300048913 Bacteria 1534
610 Ga0496111_0067008 3300048914 Bacteria 2608
611 Ga0496111_0463070 3300048914 Bacteria 935
612 Ga0496111_0495951 3300048914 Bacteria 899
613 Ga0496112_0028751 3300048915 Bacteria 5369
614 Ga0496112_0781736 3300048915 Bacteria 880
615 Ga0496113_0860714 3300048916 Unclassified 718
616 Ga0496114_0001764 3300048917 Bacteria 16428
617 Ga0496114_0152601 3300048917 Bacteria 2004
618 Ga0496114_0272746 3300048917 Bacteria 1491
619 Ga0496114_0429551 3300048917 Bacteria 1170
620 Ga0496115_0605447 3300048918 Bacteria 871
621 Ga0501317_096601 3300049533 Unclassified 529
622 Ga0501034_0336179 3300049571 Bacteria 1441
623 Ga0501034_0731085 3300049571 Bacteria 886
624 Ga0501036_0494789 3300049572 Bacteria 1018
625 Ga0501047_0052236 3300049581 Bacteria 3950
626 Ga0501073_0477862 3300049589 Bacteria 862
627 Ga0501073_0518189 3300049589 Bacteria 824
628 Ga0501073_1157717 3300049589 Bacteria 531
629 Ga0501076_1152415 3300049592 Unclassified 638
630 Ga0501249_093462 3300049679 Bacteria 715
631 Ga0501080_0173280 3300049742 Bacteria 1989
632 Ga0501080_0501488 3300049742 Bacteria 1085
633 Ga0501083_0034169 3300049744 Bacteria 3478
634 Ga0501083_0870925 3300049744 Bacteria 586
635 Ga0501271_031144 3300049768 Bacteria 660
636 Ga0501044_0001109 3300049823 Bacteria 32036
637 Ga0501045_0932014 3300049824 Bacteria 638
638 nmdc:mga05p37_206940_c1 3300050507 Bacteria 2373
639 nmdc:mga05p37_353194_c1 3300050507 Bacteria 1730
640 nmdc:mga05p37_42525_c1 3300050507 Bacteria 5584
641 nmdc:mga05p37_47950_c1 3300050507 Bacteria 5253
642 nmdc:mga05p37_542807_c1 3300050507 Bacteria 1325
643 nmdc:mga05p37_8651_c1 3300050507 Bacteria 12034
644 nmdc:mga06r32_20491_c1 3300050510 Bacteria 6089
645 nmdc:mga08y16_193366_c1 3300050511 Bacteria 2110
646 nmdc:mga08y16_215319_c1 3300050511 Bacteria 1989
647 nmdc:mga08y16_3867_c1 3300050511 Bacteria 15575
648 nmdc:mga08y16_8901_c1 3300050511 Bacteria 10540
649 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
650 nmdc:mga0n895_13192_c1 3300050512 Bacteria 7444
651 nmdc:mga0n895_1399453_c1 3300050512 Bacteria 668
652 nmdc:mga0n895_293159_c1 3300050512 Bacteria 1649
653 nmdc:mga0n895_347887_c1 3300050512 Bacteria 1501
654 nmdc:mga0n895_368758_c1 3300050512 Bacteria 1454
655 nmdc:mga0n895_510245_c1 3300050512 Bacteria 1211
656 nmdc:mga0n895_639714_c1 3300050512 Bacteria 1063
657 nmdc:mga0n895_938044_c1 3300050512 Bacteria 849
658 nmdc:mga0rr50_1224056_c1 3300050513 Unclassified 638
659 nmdc:mga0rr50_20409_c1 3300050513 Bacteria 4499
660 nmdc:mga0rr50_284489_c1 3300050513 Bacteria 1380
661 nmdc:mga0rr50_414_c1 3300050513 Bacteria 23130
662 nmdc:mga0rr50_57894_c1 3300050513 Bacteria 2902
663 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
664 nmdc:mga0rr50_62965_c1 3300050513 Bacteria 2800
665 nmdc:mga0rr50_835839_c1 3300050513 Bacteria 785
666 nmdc:mga0rr50_85230_c1 3300050513 Bacteria 2448
667 nmdc:mga08x19_11233_c1 3300050514 Bacteria 5391
668 nmdc:mga08x19_1984_c1 3300050514 Bacteria 12538
669 nmdc:mga08x19_232064_c1 3300050514 Bacteria 1270
670 nmdc:mga08x19_9159_c1 3300050514 Bacteria 5909
671 nmdc:mga0a205_143019_c1 3300050515 Bacteria 2292
672 nmdc:mga0a205_284139_c1 3300050515 Bacteria 1530
673 nmdc:mga0a205_330134_c1 3300050515 Bacteria 1395
674 nmdc:mga0a205_403132_c1 3300050515 Bacteria 1231
675 nmdc:mga0a205_60642_c2 3300050515 Bacteria 3310
676 nmdc:mga0a205_74012_c1 3300050515 Bacteria 3291
677 nmdc:mga0a205_789687_c1 3300050515 Bacteria 797
678 Ga0495601_0013493 3300053077 Bacteria 4914
679 Ga0495601_0015483 3300053077 Bacteria 4608
680 Ga0495601_0073519 3300053077 Bacteria 2186
681 Ga0495601_0169210 3300053077 Bacteria 1428
682 Ga0495601_0178737 3300053077 Bacteria 1387
683 Ga0495612_0246607 3300053078 Bacteria 794
684 Ga0495612_0395366 3300053078 Bacteria 628
685 Ga0495655_0097985 3300053083 Bacteria 864
686 Ga0495595_0002565 3300053084 Bacteria 7124
687 Ga0495619_0001542 3300053085 Bacteria 15176
688 Ga0495619_0036427 3300053085 Bacteria 3204
689 Ga0495619_0110717 3300053085 Bacteria 1876
690 Ga0495619_0394431 3300053085 Bacteria 956
691 Ga0495619_0575244 3300053085 Bacteria 772
692 Ga0500566_0267918 3300053094 Bacteria 821
693 Ga0500588_0335272 3300053146 Bacteria 574
694 Ga0501084_0237714 3300054114 Bacteria 1538
695 Ga0501084_0360792 3300054114 Bacteria 1228
696 Ga0501084_1693960 3300054114 Unclassified 528
697 Ga0587073_0032701 3300059492 Bacteria 1085
698 Ga0501082_1002865 3300060353 Bacteria 730
699 Ga0530510_0469196 3300061734 Bacteria 953
700 Ga0070690_100416058
701 Ga0006777J48905_1096487
702 Ga0058859_11609013
703 Ga0058860_12077543
704 Ga0058862_12725589
705 Ga0065712_10005878
706 Ga0065715_10057391
707 Ga0065715_10559384
708 Ga0065715_10590170
709 Ga0065707_10088482
710 Ga0065707_10475393
711 Ga0065707_10848142
712 Ga0070676_10011104
713 Ga0070676_10160690
714 Ga0070676_10222771
715 Ga0070683_100220622
716 Ga0070683_100663272
717 Ga0070690_100066729
718 Ga0070690_100216486
719 Ga0070690_100478816
720 Ga0070670_100086329
721 Ga0070670_100512297
722 Ga0070670_100670051
723 Ga0070670_101493942
724 Ga0068869_100322605
725 Ga0068869_100410831
726 Ga0068869_100630861
727 Ga0068869_100765334
728 Ga0070666_10111187
729 Ga0070666_10114907
730 Ga0070666_10191949
731 Ga0070666_10396554
732 Ga0070666_10422873
733 Ga0070666_10861700
734 Ga0070680_100933180
735 Ga0070680_101540452
736 Ga0070689_100568390
737 Ga0070689_100719759
738 Ga0070691_10027517
739 Ga0070687_100423428
740 Ga0070668_100027940
741 Ga0070668_100088382
742 Ga0070668_100322008
743 Ga0070668_101763278
744 Ga0070669_100026319
745 Ga0070669_100032978
746 Ga0070669_100144665
747 Ga0070675_100001471
748 Ga0070675_100020524
749 Ga0070675_100099647
750 Ga0070675_100294978
751 Ga0070675_100628492
752 Ga0070671_100845799
753 Ga0070671_101220696
754 Ga0070674_100046956
755 Ga0070674_100202591
756 Ga0070674_100305527
757 Ga0070674_100422617
758 Ga0070673_100008147
759 Ga0070673_100093990
760 Ga0070688_100414576
761 Ga0070667_100726415
762 Ga0070667_100789000
763 Ga0070709_10180512
764 Ga0070709_10390598
765 Ga0070714_100001083
766 Ga0070713_100062692
767 Ga0070713_100844641
768 Ga0070713_102125906
769 Ga0070701_10001654
770 Ga0070705_100019261
771 Ga0070705_100054623
772 Ga0070705_100264982
773 Ga0070705_100698016
774 Ga0070700_100009398
775 Ga0070700_100430046
776 Ga0070700_100459551
777 Ga0070694_100023728
778 Ga0070694_100248133
779 Ga0070678_100059687
780 Ga0070678_100696857
781 Ga0070678_100782860
782 Ga0070662_100049454
783 Ga0070662_100536653
784 Ga0070662_101041902
785 Ga0070662_101200334
786 Ga0070662_101653293
787 Ga0070681_10458054
788 Ga0068867_100069701
789 Ga0068867_100301611
790 Ga0068867_100390350
791 Ga0068867_101200284
792 Ga0070685_10463499
793 Ga0070706_100183428
794 Ga0070706_100590756
795 Ga0070706_100855440
796 Ga0070707_100127989
797 Ga0070707_100173755
798 Ga0070698_100339908
799 Ga0070699_100021600
800 Ga0070699_101286387
801 Ga0070684_100101079
802 Ga0070684_100524357
803 Ga0070684_100559667
804 Ga0070684_100852637
805 Ga0070697_100015943
806 Ga0070697_100661057
807 Ga0070697_101538738
808 Ga0068853_100588664
809 Ga0070672_100397447
810 Ga0070672_100870287
811 Ga0070686_100001456
812 Ga0070686_100034136
813 Ga0070686_100122761
814 Ga0070686_100165422
815 Ga0070686_101590694
816 Ga0070695_100105152
817 Ga0070696_100092985
818 Ga0070696_100216083
819 Ga0070696_100484081
820 Ga0070696_100675059
821 Ga0070696_101129358
822 Ga0070696_101628903
823 Ga0070696_101897725
824 Ga0070693_100363371
825 Ga0070693_100610121
826 Ga0070665_100024961
827 Ga0070665_100510241
828 Ga0070665_100662370
829 Ga0070704_100031310
830 Ga0070704_100097384
831 Ga0070704_100914363
832 Ga0068855_102133352
833 Ga0070664_100162011
834 Ga0070664_100535950
835 Ga0070664_100645325
836 Ga0070664_100985886
837 Ga0068857_101486852
838 Ga0068854_100091905
839 Ga0068854_100767335
840 Ga0068854_100959223
841 Ga0068854_101058814
842 Ga0068854_101463666
843 Ga0068856_100021485
844 Ga0070702_100012843
845 Ga0070702_100343440
846 Ga0070702_100641607
847 Ga0068852_100102970
848 Ga0068852_100556233
849 Ga0068852_101260013
850 Ga0068852_101330840
851 Ga0068859_100086862
852 Ga0068859_100487687
853 Ga0068859_100523178
854 Ga0068859_100747532
855 Ga0068859_100792547
856 Ga0068859_101186458
857 Ga0068859_101540212
858 Ga0068864_100117743
859 Ga0068864_100341281
860 Ga0068864_100879820
861 Ga0068866_10067938
862 Ga0068866_10072531
863 Ga0068861_100024326
864 Ga0068861_100031667
865 Ga0068861_100052050
866 Ga0068861_100510227
867 Ga0068861_101442947
868 Ga0068851_10228102
869 Ga0068851_10760809
870 Ga0068870_10059655
871 Ga0068863_100141802
872 Ga0068863_100619501
873 Ga0068863_100731483
874 Ga0068858_100012089
875 Ga0068858_100253352
876 Ga0068858_100412676
877 Ga0068858_100556327
878 Ga0068858_100692383
879 Ga0068860_100619302
880 Ga0068860_101117044
881 Ga0068862_100282522
882 Ga0068862_100298445
883 Ga0068862_100350413
884 Ga0068862_100756632
885 Ga0068862_101120534
886 Ga0081455_10049286
887 Ga0081455_10096122
888 Ga0081539_10008229
889 Ga0070717_10527048
890 Ga0075368_10229398
891 Ga0070715_10060513
892 Ga0070716_100145920
893 Ga0097621_100000820
894 Ga0097621_100029201
895 Ga0097621_100036127
896 Ga0097621_100042957
897 Ga0097621_100139356
898 Ga0097621_100314136
899 Ga0075370_10279932
900 Ga0068871_100000748
901 Ga0068871_100014327
902 Ga0068871_100020494
903 Ga0068871_100024414
904 Ga0068871_100145291
905 Ga0068871_100610021
906 Ga0068871_100645888
907 Ga0068871_100649963
908 Ga0075428_101801824
909 Ga0075430_100940421
910 Ga0075431_100445684
911 Ga0075433_10007699
912 Ga0075433_10052071
913 Ga0075433_10369238
914 Ga0075434_100025302
915 Ga0075434_100078477
916 Ga0075434_100217873
917 Ga0075434_100289494
918 Ga0075434_100910928
919 Ga0075434_101150594
920 Ga0068865_100033564
921 Ga0068865_100534689
922 Ga0068865_100813975
923 Ga0075436_100003325
924 Ga0075436_100008962
925 Ga0075436_100036269
926 Ga0075436_100438323
927 Ga0075436_100993202
928 Ga0097620_100086865
929 Ga0097620_100487680
930 Ga0097620_100523224
931 Ga0097620_100747555
932 Ga0097620_100792588
933 Ga0097620_101186535
934 Ga0097620_101540007
935 Ga0075435_100000192
936 Ga0075435_100002813
937 Ga0075435_100026694
938 Ga0075435_100259932
939 Ga0075435_100423221
940 Ga0075435_100458528
941 Ga0075435_100527618
942 Ga0105240_10617828
943 Ga0111539_10003965
944 Ga0111539_10012733
945 Ga0111539_10259314
946 Ga0111539_11494740
947 Ga0111539_11500484
948 Ga0111539_12334745
949 Ga0105245_10020103
950 Ga0105245_10258279
951 Ga0105245_10346988
952 Ga0105245_12082645
953 Ga0105245_12237366
954 Ga0105247_10018462
955 Ga0114129_10000434
956 Ga0114129_10044118
957 Ga0114129_10184527
958 Ga0114129_10283926
959 Ga0114129_10292698
960 Ga0114129_10430334
961 Ga0105243_10109693
962 Ga0105243_10302494
963 Ga0105243_10384235
964 Ga0105243_10576711
965 Ga0105243_11397552
966 Ga0105241_10120746
967 Ga0105241_11652243
968 Ga0105242_10014046
969 Ga0105242_10020985
970 Ga0105242_10034230
971 Ga0105242_10557734
972 Ga0105242_10624214
973 Ga0105242_10822149
974 Ga0105242_11004951
975 Ga0105248_10017990
976 Ga0105248_10080837
977 Ga0105248_10173762
978 Ga0105248_10407503
979 Ga0105248_10813830
980 Ga0105248_10959717
981 Ga0105248_10998479
982 Ga0105248_11045686
983 Ga0105248_11169078
984 Ga0105248_11935155
985 Ga0105248_12351815
986 Ga0105249_10583309
987 Ga0105249_10900196
988 Ga0105249_10987904
989 Ga0105249_11057683
990 Ga0105249_12151131
991 Ga0105239_10467160
992 Ga0105246_10797392
993 Ga0157369_10247257
994 Ga0157374_10071772
995 Ga0157374_10212217
996 Ga0157374_10533595
997 Ga0157374_12466955
998 Ga0157378_10001160
999 Ga0157378_10158596
1000 Ga0157378_11018048
1001 Ga0157378_11815288
1002 Ga0163162_10994371
1003 Ga0163162_11363103
1004 Ga0163162_13299388
1005 Ga0157375_10227766
1006 Ga0157375_10406809
1007 Ga0157375_10592878
1008 Ga0157375_10897851
1009 Ga0157375_11453939
1010 Ga0157375_11744238
1011 Ga0163163_10096088
1012 Ga0163163_10226180
1013 Ga0163163_10465455
1014 Ga0163163_11015556
1015 Ga0163163_12364970
1016 Ga0157380_10475308
1017 Ga0157380_10714036
1018 Ga0157380_10714135
1019 Ga0157380_10745904
1020 Ga0157380_11442930
1021 Ga0157377_10122392
1022 Ga0157377_10327851
1023 Ga0157377_11137547
1024 Ga0157379_10050508
1025 Ga0157379_10077042
1026 Ga0157379_10406986
1027 Ga0157379_10956845
1028 Ga0157379_10990176
1029 Ga0157376_10003823
1030 Ga0157376_10019382
1031 Ga0157376_10596172
1032 Ga0157376_10822135
1033 Ga0157376_11277521
1034 Ga0157376_11536992
1035 Ga0157376_12421312
1036 Ga0182007_10132394
1037 Ga0163161_10943963
1038 Ga0206356_10062690
1039 Ga0206352_10983658
1040 Ga0206350_10455111
1041 Ga0207697_10031362
1042 Ga0207656_10368159
1043 Ga0207682_10277287
1044 Ga0207642_10040255
1045 Ga0207642_10495104
1046 Ga0207642_10660725
1047 Ga0207642_10774455
1048 Ga0207710_10041200
1049 Ga0207680_10019112
1050 Ga0207680_10044326
1051 Ga0207680_10291029
1052 Ga0207680_10380043
1053 Ga0207680_10773624
1054 Ga0207699_10014617
1055 Ga0207645_10015913
1056 Ga0207645_10113284
1057 Ga0207645_10297148
1058 Ga0207643_10065802
1059 Ga0207654_10774706
1060 Ga0207695_10915279
1061 Ga0207662_10132340
1062 Ga0207657_10390712
1063 Ga0207652_10205661
1064 Ga0207681_10028989
1065 Ga0207681_10403894
1066 Ga0207681_11078549
1067 Ga0207650_10202238
1068 Ga0207650_10366329
1069 Ga0207650_10546226
1070 Ga0207659_10002275
1071 Ga0207659_10056122
1072 Ga0207659_10260362
1073 Ga0207659_10349932
1074 Ga0207700_10002726
1075 Ga0207644_10381326
1076 Ga0207706_10461992
1077 Ga0207686_10006012
1078 Ga0207686_10035017
1079 Ga0207686_10207212
1080 Ga0207686_10674166
1081 Ga0207686_10871575
1082 Ga0207709_10086843
1083 Ga0207670_10194560
1084 Ga0207670_10653915
1085 Ga0207669_10019759
1086 Ga0207669_10051838
1087 Ga0207669_10103439
1088 Ga0207669_10209882
1089 Ga0207669_10336328
1090 Ga0207704_10057324
1091 Ga0207665_10205455
1092 Ga0207665_10348591
1093 Ga0207691_10449807
1094 Ga0207691_10647960
1095 Ga0207691_10801184
1096 Ga0207711_10020432
1097 Ga0207711_10032545
1098 Ga0207711_10118062
1099 Ga0207711_10608165
1100 Ga0207711_10918540
1101 Ga0207689_10187747
1102 Ga0207689_10390264
1103 Ga0207689_10417290
1104 Ga0207689_10910578
1105 Ga0207661_10355288
1106 Ga0207679_10533217
1107 Ga0207651_10017196
1108 Ga0207651_10353556
1109 Ga0207651_10428515
1110 Ga0207651_11132812
1111 Ga0207651_11155533
1112 Ga0207712_10416616
1113 Ga0207712_10786532
1114 Ga0207668_11066913
1115 Ga0207640_10074611
1116 Ga0207640_10205218
1117 Ga0207640_10850234
1118 Ga0207658_10745344
1119 Ga0207677_10313034
1120 Ga0207677_10466439
1121 Ga0207703_10013711
1122 Ga0207703_10273545
1123 Ga0207703_10526984
1124 Ga0207639_10348352
1125 Ga0207639_11142125
1126 Ga0207708_10033406
1127 Ga0207708_10196847
1128 Ga0207708_10302781
1129 Ga0207708_10433338
1130 Ga0207702_10017099
1131 Ga0207641_10462021
1132 Ga0207648_10082175
1133 Ga0207648_10131258
1134 Ga0207648_10189429
1135 Ga0207648_10305959
1136 Ga0207648_10839357
1137 Ga0207648_11191783
1138 Ga0207676_10122176
1139 Ga0207676_10166415
1140 Ga0207676_10379618
1141 Ga0207676_10527251
1142 Ga0207674_11404058
1143 Ga0207675_100016506
1144 Ga0207675_100028549
1145 Ga0207675_100060170
1146 Ga0207675_100159184
1147 Ga0207675_100175717
1148 Ga0207675_100227419
1149 Ga0207675_100473278
1150 Ga0207683_10083130
1151 Ga0207683_10094405
1152 Ga0207683_10957923
1153 Ga0207428_10184684
1154 Ga0207428_10257478
1155 Ga0268266_10007237
1156 Ga0268266_10014041
1157 Ga0268266_10396162
1158 Ga0268266_10717807
1159 Ga0268266_11097029
1160 Ga0268265_10073843
1161 Ga0268265_10095079
1162 Ga0268265_10366119
1163 Ga0268265_10415146
1164 Ga0268265_11095638
1165 Ga0268264_10603967
1166 Ga0265332_10015920
1167 Ga0265328_10033285
1168 Ga0265320_10068339
1169 Ga0265314_10026707
1170 Ga0265342_10521984
1171 Ga0307406_11860656
1172 Ga0307416_100041649
1173 Ga0307415_100408202
1174 Ga0373930_0006116
1175 Ga0373948_0011539
1176 Ga0373950_0001144
1177 Ga0373958_0016089
1178 Ga0373958_0046810
1179 Ga0373959_0001529
1180 Ga0373938_0000511
1181 Ga0373926_0064341
1182 Ga0373928_0085041
1183 Ga0373929_0002827
1184 Ga0373934_0191040
1185 Ga0373940_0000437
1186 Ga0373949_0002562
1187 Ga0373951_0000713
1188 Ga0373952_0001468
1189 Ga0373932_0000374
1190 Ga0373939_0003349
1191 Ga0373941_0001016
1192 Ga0373953_0021882
1193 Ga0373954_0185805
1194 Ga0373956_0194548
1195 Ga0373956_0416809
1196 Ga0373957_0237014
1197 Ga0373960_0000304
1198 Ga0373943_0005300
1199 Ga0373943_0355277
1200 Ga0373946_0096457
1201 Ga0373946_0203738
1202 Ga0373955_0195506
1203 Ga0373955_0242353
1204 Ga0373942_0001386
1205 Ga0373961_0003846
1206 Ga0373961_0376427
1207 Ga0373962_0000484
1208 Ga0373924_0024114
1209 Ga0373931_0002957
1210 Ga0373931_0815796
1211 Ga0373935_0023270
1212 Ga0373935_0068910
1213 Ga0373927_1066299
1214 Ga0373933_0167328
1215 Ga0373933_0244683
1216 Ga0373947_0007810
1217 Ga0373947_0409944
1218 Ga0373947_0596051
1219 Ga0373947_0706117
1220 Ga0373947_1169052
1221 Ga0373937_0110617
1222 Ga0373937_0417600
1223 Ga0373937_1446212
1224 Ga0373937_1987996
1225 Ga0373925_0000987
1226 Ga0373925_0332123
1227 Ga0373925_0363443
1228 Ga0395901_1208032
1229 Ga0436365_0974042
1230 Ga0451839_0500936
1231 Ga0450890_059368
1232 Ga0466963_1148984
1233 Ga0451576_0060381
1234 Ga0451576_0347476
1235 Ga0495592_0017655
1236 Ga0495603_0074880
1237 Ga0495629_0531487
1238 Ga0495580_0105197
1239 Ga0495580_0300875
1240 Ga0495582_0080907
1241 Ga0495582_0433876
1242 Ga0495582_0929663
1243 Ga0495639_0033025
1244 Ga0495639_0075189
1245 Ga0495664_0315096
1246 Ga0495608_0076812
1247 Ga0495628_0010696
1248 Ga0495628_0278038
1249 Ga0495628_0409734
1250 Ga0495630_0027893
1251 Ga0495644_0153178
1252 Ga0495642_0191905
1253 Ga0495652_0064984
1254 Ga0495640_0110506
1255 Ga0495640_0229436
1256 Ga0495586_0072434
1257 Ga0495586_0100463
1258 Ga0495587_0239407
1259 Ga0495587_0378721
1260 Ga0495621_0362684
1261 Ga0495645_0001334
1262 Ga0495645_0010248
1263 Ga0495656_0612485
1264 Ga0495634_0134026
1265 Ga0495611_0375714
1266 Ga0495588_0179848
1267 Ga0495657_0231921
1268 Ga0495623_0196272
1269 Ga0495623_0221484
1270 Ga0495647_0020817
1271 Ga0495647_0035530
1272 Ga0495647_0061715
1273 Ga0495658_0053477
1274 Ga0495658_0164747
1275 Ga0495658_0288593
1276 Ga0495658_0832008
1277 Ga0495669_0060620
1278 Ga0495613_0000720
1279 Ga0495670_0436924
1280 Ga0495581_0164153
1281 Ga0495604_0511813
1282 Ga0495674_0098266
1283 Ga0495674_1103618
1284 Ga0495680_0784912
1285 Ga0495684_0006668
1286 Ga0495684_1002019
1287 Ga0495602_0342982
1288 Ga0496100_0003982
1289 Ga0496100_0774195
1290 Ga0496101_0000451
1291 Ga0496101_0739899
1292 Ga0496102_0329745
1293 Ga0496102_0524973
1294 Ga0496103_0333409
1295 Ga0496104_0012288
1296 Ga0496104_0671848
1297 Ga0496104_1080593
1298 Ga0496105_0010234
1299 Ga0496105_0689733
1300 Ga0496106_0103204
1301 Ga0496106_0178080
1302 Ga0496107_0523713
1303 Ga0496108_0043116
1304 Ga0496108_0187117
1305 Ga0496109_0290972
1306 Ga0496109_1749994
1307 Ga0496110_0189494
1308 Ga0496110_0274842
1309 Ga0496111_0067008
1310 Ga0496111_0463070
1311 Ga0496111_0495951
1312 Ga0496112_0028751
1313 Ga0496112_0781736
1314 Ga0496113_0860714
1315 Ga0496114_0001764
1316 Ga0496114_0152601
1317 Ga0496114_0272746
1318 Ga0496114_0429551
1319 Ga0496115_0605447
1320 Ga0501317_096601
1321 Ga0501034_0336179
1322 Ga0501034_0731085
1323 Ga0501036_0494789
1324 Ga0501047_0052236
1325 Ga0501073_0477862
1326 Ga0501073_0518189
1327 Ga0501073_1157717
1328 Ga0501076_1152415
1329 Ga0501249_093462
1330 Ga0501080_0173280
1331 Ga0501080_0501488
1332 Ga0501083_0034169
1333 Ga0501083_0870925
1334 Ga0501271_031144
1335 Ga0501044_0001109
1336 Ga0501045_0932014
1337 nmdc:mga05p37_206940_c1
1338 nmdc:mga05p37_353194_c1
1339 nmdc:mga05p37_42525_c1
1340 nmdc:mga05p37_47950_c1
1341 nmdc:mga05p37_542807_c1
1342 nmdc:mga05p37_8651_c1
1343 nmdc:mga06r32_20491_c1
1344 nmdc:mga08y16_193366_c1
1345 nmdc:mga08y16_215319_c1
1346 nmdc:mga08y16_3867_c1
1347 nmdc:mga08y16_8901_c1
1348 nmdc:mga0n895_111_c1
1349 nmdc:mga0n895_13192_c1
1350 nmdc:mga0n895_1399453_c1
1351 nmdc:mga0n895_293159_c1
1352 nmdc:mga0n895_347887_c1
1353 nmdc:mga0n895_368758_c1
1354 nmdc:mga0n895_510245_c1
1355 nmdc:mga0n895_639714_c1
1356 nmdc:mga0n895_938044_c1
1357 nmdc:mga0rr50_1224056_c1
1358 nmdc:mga0rr50_20409_c1
1359 nmdc:mga0rr50_284489_c1
1360 nmdc:mga0rr50_414_c1
1361 nmdc:mga0rr50_57894_c1
1362 nmdc:mga0rr50_57_c1
1363 nmdc:mga0rr50_62965_c1
1364 nmdc:mga0rr50_835839_c1
1365 nmdc:mga0rr50_85230_c1
1366 nmdc:mga08x19_11233_c1
1367 nmdc:mga08x19_1984_c1
1368 nmdc:mga08x19_232064_c1
1369 nmdc:mga08x19_9159_c1
1370 nmdc:mga0a205_143019_c1
1371 nmdc:mga0a205_284139_c1
1372 nmdc:mga0a205_330134_c1
1373 nmdc:mga0a205_403132_c1
1374 nmdc:mga0a205_60642_c2
1375 nmdc:mga0a205_74012_c1
1376 nmdc:mga0a205_789687_c1
1377 Ga0495601_0013493
1378 Ga0495601_0015483
1379 Ga0495601_0073519
1380 Ga0495601_0169210
1381 Ga0495601_0178737
1382 Ga0495612_0246607
1383 Ga0495612_0395366
1384 Ga0495655_0097985
1385 Ga0495595_0002565
1386 Ga0495619_0001542
1387 Ga0495619_0036427
1388 Ga0495619_0110717
1389 Ga0495619_0394431
1390 Ga0495619_0575244
1391 Ga0500566_0267918
1392 Ga0500588_0335272
1393 Ga0501084_0237714
1394 Ga0501084_0360792
1395 Ga0501084_1693960
1396 Ga0587073_0032701
1397 Ga0501082_1002865
1398 Ga0530510_0469196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

4

141

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrv-assembly1.cif.gz_A crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9315 11 67
3nrv-assembly2.cif.gz_B crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9311 11 67
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9148 5 67
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.9134 9 67
3irq-assembly1.cif.gz_A crystal structure of a z-z junction 0.911 9 67
ID Description Score Start End Superfamily
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9379 7 67 1.10.10.10
3nrvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9305 10 67 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9132 5 67 1.10.10.10
af_P39360_5_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9066 5 67 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.906 6 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8PDW9-F1-model_v4 Transcriptional regulator 0.8449 3 132 GO:0003700
GO:0005829
AF-A0A1Q2MFI3-F1-model_v4 HTH-type transcriptional repressor NsrR 0.8363 4 136 GO:0003700
GO:0005829
AF-A0A7C7H712-F1-model_v4 Rrf2 family transcriptional regulator 0.8362 1 136 GO:0003700
GO:0005829
AF-A0A1V5YW79-F1-model_v4 HTH-type transcriptional regulator CymR 0.8319 3 132 GO:0003700
GO:0005829
AF-A0A2W0A8W0-F1-model_v4 Transcriptional regulator 0.8312 1 136 GO:0003700
GO:0005829

Map