F475905

General Info

Members Datasets Scaffolds Average Seq Length
697 312 1394 95

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_1656851|Ga0451802_1656851_181_525
Length 114
Sequence MAHVKDLAGAEAVIDRLVADQPLIKPALPPSRAMVTSGHPLASAAGAIYSKHRARELFVELERLNVKRDNLEIEWGQLQLEQSAWSTHAFVENVAGTKLKMSTPPPQDIELVAP

Samples

Sample ID Description Type Environment
1 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
188 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
197 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
202 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
291 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
292 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
293 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
294 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
295 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
296 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
302 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
306 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 0
Rhizoplane 4.45
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451802_1656851 3300041460 Bacteria 537
2 JGI25406J46586_10080365 3300003203 Bacteria 1001
3 rootL2_10068794 3300003322 Bacteria 3045
4 Ga0070676_10154222 3300005328 Bacteria 1473
5 Ga0070676_10339380 3300005328 Bacteria 1030
6 Ga0070683_100210509 3300005329 Bacteria 1847
7 Ga0070683_101225686 3300005329 Bacteria 721
8 Ga0070690_100200714 3300005330 Bacteria 1387
9 Ga0070690_100554472 3300005330 Unclassified 867
10 Ga0070670_100212777 3300005331 Bacteria 1681
11 Ga0070670_100418930 3300005331 Bacteria 1184
12 Ga0070677_10003986 3300005333 Bacteria 4800
13 Ga0070677_10100260 3300005333 Bacteria 1275
14 Ga0068869_100266818 3300005334 Bacteria 1372
15 Ga0068869_100277014 3300005334 Bacteria 1348
16 Ga0068869_100340388 3300005334 Bacteria 1220
17 Ga0068869_100369837 3300005334 Bacteria 1173
18 Ga0068869_100506162 3300005334 Bacteria 1009
19 Ga0068869_101015731 3300005334 Bacteria 723
20 Ga0070666_10004216 3300005335 Bacteria 8728
21 Ga0070666_10009494 3300005335 Bacteria 6067
22 Ga0070680_100047098 3300005336 Bacteria 3510
23 Ga0070682_100106863 3300005337 Bacteria 1858
24 Ga0070682_100240770 3300005337 Bacteria 1299
25 Ga0070682_101578278 3300005337 Bacteria 567
26 Ga0070682_101759638 3300005337 Unclassified 540
27 Ga0068868_100007435 3300005338 Bacteria 7799
28 Ga0068868_100852102 3300005338 Bacteria 825
29 Ga0068868_102370840 3300005338 Bacteria 507
30 Ga0070689_100006887 3300005340 Bacteria 7910
31 Ga0070689_100206483 3300005340 Bacteria 1606
32 Ga0070689_100839639 3300005340 Bacteria 810
33 Ga0070689_101098013 3300005340 Unclassified 711
34 Ga0070687_100180268 3300005343 Bacteria 1265
35 Ga0070661_100474556 3300005344 Unclassified 998
36 Ga0070692_10225788 3300005345 Bacteria 1109
37 Ga0070668_100165739 3300005347 Bacteria 1795
38 Ga0070668_100364604 3300005347 Bacteria 1226
39 Ga0070668_101782747 3300005347 Bacteria 566
40 Ga0070669_101309044 3300005353 Unclassified 627
41 Ga0070675_100035869 3300005354 Bacteria 4032
42 Ga0070675_100093989 3300005354 Bacteria 2515
43 Ga0070675_100238667 3300005354 Bacteria 1588
44 Ga0070675_100324899 3300005354 Bacteria 1360
45 Ga0070675_100351868 3300005354 Bacteria 1306
46 Ga0070675_101455172 3300005354 Bacteria 632
47 Ga0070675_101663928 3300005354 Bacteria 589
48 Ga0070671_100031895 3300005355 Bacteria 4355
49 Ga0070671_100325896 3300005355 Bacteria 1309
50 Ga0070674_100042586 3300005356 Bacteria 3085
51 Ga0070674_100092380 3300005356 Bacteria 2187
52 Ga0070673_100066144 3300005364 Bacteria 2886
53 Ga0070673_100070772 3300005364 Bacteria 2800
54 Ga0070673_100089085 3300005364 Bacteria 2518
55 Ga0070673_100136437 3300005364 Bacteria 2065
56 Ga0070673_100148509 3300005364 Bacteria 1983
57 Ga0070673_100434429 3300005364 Bacteria 1179
58 Ga0070673_101749638 3300005364 Bacteria 588
59 Ga0070688_100010698 3300005365 Bacteria 5069
60 Ga0070659_100782597 3300005366 Bacteria 829
61 Ga0070659_101708403 3300005366 Unclassified 563
62 Ga0070667_100000184 3300005367 Bacteria 75408
63 Ga0070667_100016642 3300005367 Bacteria 6086
64 Ga0070667_100510475 3300005367 Bacteria 1102
65 Ga0070667_100543711 3300005367 Bacteria 1067
66 Ga0070667_100778258 3300005367 Bacteria 888
67 Ga0070667_101661742 3300005367 Bacteria 601
68 Ga0070667_101980702 3300005367 Bacteria 549
69 Ga0070709_10578905 3300005434 Bacteria 862
70 Ga0070709_10816480 3300005434 Bacteria 733
71 Ga0070713_100415535 3300005436 Unclassified 1258
72 Ga0070713_100418066 3300005436 Bacteria 1255
73 Ga0070710_10326810 3300005437 Bacteria 1008
74 Ga0070710_10676076 3300005437 Bacteria 726
75 Ga0070701_10016200 3300005438 Bacteria 3459
76 Ga0070701_10070603 3300005438 Bacteria 1866
77 Ga0070701_10150971 3300005438 Bacteria 1338
78 Ga0070705_100009121 3300005440 Bacteria 4924
79 Ga0070700_100113612 3300005441 Bacteria 1804
80 Ga0070700_100277626 3300005441 Bacteria 1213
81 Ga0070700_100376358 3300005441 Bacteria 1061
82 Ga0070700_100389322 3300005441 Bacteria 1045
83 Ga0070700_100767989 3300005441 Bacteria 773
84 Ga0070694_100164927 3300005444 Bacteria 1628
85 Ga0070694_101733137 3300005444 Unclassified 532
86 Ga0070663_101539450 3300005455 Bacteria 592
87 Ga0070678_100286683 3300005456 Bacteria 1394
88 Ga0070678_101513591 3300005456 Bacteria 628
89 Ga0070662_100842253 3300005457 Bacteria 781
90 Ga0070662_100941725 3300005457 Bacteria 738
91 Ga0070681_10010910 3300005458 Bacteria 8984
92 Ga0070681_10089146 3300005458 Bacteria 3036
93 Ga0070681_11020913 3300005458 Unclassified 747
94 Ga0068867_100045016 3300005459 Bacteria 3234
95 Ga0068867_100373111 3300005459 Bacteria 1196
96 Ga0068867_101474231 3300005459 Bacteria 633
97 Ga0070685_10288778 3300005466 Bacteria 1101
98 Ga0070679_100037680 3300005530 Bacteria 4805
99 Ga0070679_100079717 3300005530 Bacteria 3264
100 Ga0070679_100700598 3300005530 Bacteria 955
101 Ga0070684_100144282 3300005535 Bacteria 2154
102 Ga0070684_100340440 3300005535 Bacteria 1379
103 Ga0070684_100553316 3300005535 Bacteria 1068
104 Ga0068853_100628216 3300005539 Bacteria 1021
105 Ga0068853_101158798 3300005539 Bacteria 746
106 Ga0068853_101250094 3300005539 Unclassified 717
107 Ga0070672_100010050 3300005543 Bacteria 6551
108 Ga0070672_100021356 3300005543 Bacteria 4735
109 Ga0070672_100238511 3300005543 Bacteria 1529
110 Ga0070672_100466250 3300005543 Bacteria 1089
111 Ga0070686_100013264 3300005544 Bacteria 4713
112 Ga0070686_100786957 3300005544 Bacteria 766
113 Ga0070696_100026580 3300005546 Bacteria 3937
114 Ga0070693_100371564 3300005547 Bacteria 984
115 Ga0070693_100721251 3300005547 Bacteria 732
116 Ga0070665_100008952 3300005548 Bacteria 10144
117 Ga0070665_100037380 3300005548 Bacteria 4883
118 Ga0070665_100068512 3300005548 Bacteria 3557
119 Ga0070664_101380912 3300005564 Unclassified 666
120 Ga0070664_102016678 3300005564 Unclassified 548
121 Ga0068857_100343588 3300005577 Unclassified 1381
122 Ga0068857_100464172 3300005577 Bacteria 1185
123 Ga0068857_101740959 3300005577 Bacteria 610
124 Ga0068857_101774013 3300005577 Bacteria 604
125 Ga0068854_101825408 3300005578 Bacteria 558
126 Ga0068856_100315667 3300005614 Bacteria 1580
127 Ga0068856_102433062 3300005614 Unclassified 531
128 Ga0070702_100009251 3300005615 Bacteria 4815
129 Ga0070702_100215208 3300005615 Bacteria 1281
130 Ga0068859_100099223 3300005617 Bacteria 2967
131 Ga0068859_100162506 3300005617 Bacteria 2312
132 Ga0068859_100204778 3300005617 Bacteria 2058
133 Ga0068859_100597761 3300005617 Bacteria 1196
134 Ga0068859_100739217 3300005617 Bacteria 1073
135 Ga0068859_101233828 3300005617 Bacteria 824
136 Ga0068859_101752975 3300005617 Bacteria 686
137 Ga0068859_102557736 3300005617 Bacteria 562
138 Ga0068864_100018240 3300005618 Bacteria 5858
139 Ga0068864_100064542 3300005618 Bacteria 3176
140 Ga0068864_100181691 3300005618 Bacteria 1923
141 Ga0068866_10447634 3300005718 Unclassified 844
142 Ga0068861_100040357 3300005719 Bacteria 3490
143 Ga0068861_100051338 3300005719 Bacteria 3130
144 Ga0068861_100160810 3300005719 Bacteria 1852
145 Ga0068861_100316157 3300005719 Bacteria 1358
146 Ga0068861_100392263 3300005719 Bacteria 1230
147 Ga0068861_100601178 3300005719 Bacteria 1009
148 Ga0068861_101125367 3300005719 Bacteria 756
149 Ga0068870_10034651 3300005840 Bacteria 2584
150 Ga0068870_10141678 3300005840 Bacteria 1407
151 Ga0068870_10162276 3300005840 Bacteria 1326
152 Ga0068863_100042860 3300005841 Bacteria 4299
153 Ga0068863_100148052 3300005841 Bacteria 2246
154 Ga0068863_100303680 3300005841 Bacteria 1548
155 Ga0068863_100444234 3300005841 Bacteria 1272
156 Ga0068863_100585401 3300005841 Bacteria 1104
157 Ga0068858_100091083 3300005842 Bacteria 2838
158 Ga0068858_100416588 3300005842 Bacteria 1292
159 Ga0068858_102227185 3300005842 Bacteria 542
160 Ga0068860_100013634 3300005843 Bacteria 7966
161 Ga0068860_100394328 3300005843 Bacteria 1368
162 Ga0068860_100689320 3300005843 Unclassified 1031
163 Ga0068860_100856677 3300005843 Bacteria 924
164 Ga0068860_101967858 3300005843 Bacteria 606
165 Ga0068862_100028519 3300005844 Bacteria 4701
166 Ga0068862_100107325 3300005844 Bacteria 2448
167 Ga0068862_100199098 3300005844 Bacteria 1805
168 Ga0068862_100328788 3300005844 Bacteria 1413
169 Ga0068862_100431583 3300005844 Bacteria 1238
170 Ga0068862_100475100 3300005844 Bacteria 1182
171 Ga0068862_100491311 3300005844 Bacteria 1163
172 Ga0068862_100627476 3300005844 Bacteria 1034
173 Ga0081455_10000679 3300005937 Bacteria 44123
174 Ga0081455_10004105 3300005937 Bacteria 16479
175 Ga0081539_10000006 3300005985 Bacteria 534555
176 Ga0081539_10386210 3300005985 Unclassified 583
177 Ga0070717_11247354 3300006028 Bacteria 676
178 Ga0070712_100680304 3300006175 Unclassified 876
179 Ga0097621_100073851 3300006237 Bacteria 2824
180 Ga0097621_100149636 3300006237 Bacteria 2001
181 Ga0097621_100177839 3300006237 Bacteria 1837
182 Ga0097621_100788950 3300006237 Bacteria 879
183 Ga0068871_100019350 3300006358 Bacteria 5197
184 Ga0068871_100064789 3300006358 Bacteria 2992
185 Ga0068871_100186187 3300006358 Bacteria 1786
186 Ga0068871_100257264 3300006358 Bacteria 1522
187 Ga0068871_100425328 3300006358 Bacteria 1187
188 Ga0068871_101316055 3300006358 Bacteria 680
189 Ga0068871_101433483 3300006358 Bacteria 651
190 Ga0075428_100629318 3300006844 Bacteria 1145
191 Ga0068865_100194669 3300006881 Bacteria 1570
192 Ga0068865_100391863 3300006881 Bacteria 1135
193 Ga0068865_101189023 3300006881 Bacteria 674
194 Ga0097620_100099227 3300006931 Bacteria 2967
195 Ga0097620_100162496 3300006931 Bacteria 2312
196 Ga0097620_100204784 3300006931 Bacteria 2058
197 Ga0097620_100597773 3300006931 Bacteria 1196
198 Ga0097620_100739271 3300006931 Bacteria 1073
199 Ga0097620_101233851 3300006931 Bacteria 824
200 Ga0097620_101752820 3300006931 Bacteria 686
201 Ga0097620_102558037 3300006931 Bacteria 562
202 Ga0105250_10305001 3300009092 Bacteria 689
203 Ga0105240_10001884 3300009093 Bacteria 34865
204 Ga0105240_10049655 3300009093 Bacteria 5294
205 Ga0105240_10171005 3300009093 Bacteria 2574
206 Ga0105240_10196914 3300009093 Bacteria 2364
207 Ga0105240_10305537 3300009093 Bacteria 1818
208 Ga0111539_10020948 3300009094 Bacteria 8050
209 Ga0111539_11888574 3300009094 Unclassified 692
210 Ga0105245_10083637 3300009098 Bacteria 2922
211 Ga0105247_10076278 3300009101 Bacteria 2105
212 Ga0105247_10294189 3300009101 Bacteria 1124
213 Ga0105243_10333928 3300009148 Bacteria 1386
214 Ga0105243_11006050 3300009148 Unclassified 836
215 Ga0105243_11455900 3300009148 Bacteria 707
216 Ga0105243_12006829 3300009148 Bacteria 613
217 Ga0105243_13009559 3300009148 Unclassified 511
218 Ga0105241_10617807 3300009174 Bacteria 981
219 Ga0105242_10083711 3300009176 Bacteria 2672
220 Ga0105242_10091716 3300009176 Bacteria 2558
221 Ga0105242_10700816 3300009176 Bacteria 991
222 Ga0105248_10197500 3300009177 Bacteria 2267
223 Ga0105248_10209027 3300009177 Bacteria 2199
224 Ga0105248_12590087 3300009177 Bacteria 578
225 Ga0105237_10101762 3300009545 Bacteria 2865
226 Ga0105237_10393309 3300009545 Bacteria 1391
227 Ga0105238_10157344 3300009551 Unclassified 2248
228 Ga0105238_10240269 3300009551 Bacteria 1789
229 Ga0105238_10444962 3300009551 Bacteria 1292
230 Ga0105238_11224941 3300009551 Bacteria 775
231 Ga0105238_11371193 3300009551 Bacteria 734
232 Ga0105238_11505077 3300009551 Bacteria 702
233 Ga0105238_12586940 3300009551 Bacteria 544
234 Ga0105249_10059430 3300009553 Bacteria 3506
235 Ga0105249_10350052 3300009553 Unclassified 1496
236 Ga0105249_10683573 3300009553 Bacteria 1085
237 Ga0105239_10052409 3300010375 Bacteria 4474
238 Ga0105239_10862041 3300010375 Bacteria 1039
239 Ga0105246_10129408 3300011119 Bacteria 1883
240 Ga0105246_11343058 3300011119 Bacteria 664
241 Ga0157369_10140326 3300013105 Bacteria 2557
242 Ga0157374_10029871 3300013296 Bacteria 4944
243 Ga0157374_10304336 3300013296 Bacteria 1577
244 Ga0157378_10023709 3300013297 Bacteria 5398
245 Ga0157378_10784099 3300013297 Bacteria 978
246 Ga0157378_11732494 3300013297 Bacteria 672
247 Ga0157378_12023287 3300013297 Unclassified 626
248 Ga0163162_10043944 3300013306 Bacteria 4473
249 Ga0163162_11892050 3300013306 Bacteria 683
250 Ga0157375_10031034 3300013308 Bacteria 5045
251 Ga0157375_10916902 3300013308 Bacteria 1019
252 Ga0157375_10950366 3300013308 Bacteria 1001
253 Ga0157375_11634425 3300013308 Bacteria 762
254 Ga0163163_10015439 3300014325 Bacteria 7061
255 Ga0163163_10018471 3300014325 Bacteria 6528
256 Ga0163163_10091719 3300014325 Bacteria 3053
257 Ga0163163_10146475 3300014325 Bacteria 2405
258 Ga0163163_10358614 3300014325 Bacteria 1514
259 Ga0163163_10573338 3300014325 Bacteria 1191
260 Ga0163163_10576472 3300014325 Bacteria 1188
261 Ga0163163_10841958 3300014325 Bacteria 981
262 Ga0163163_11273208 3300014325 Bacteria 798
263 Ga0163163_11603601 3300014325 Bacteria 712
264 Ga0157380_10144282 3300014326 Bacteria 2050
265 Ga0157380_10227225 3300014326 Bacteria 1673
266 Ga0157380_10251395 3300014326 Bacteria 1600
267 Ga0157380_10390060 3300014326 Bacteria 1317
268 Ga0157380_10421698 3300014326 Bacteria 1273
269 Ga0157380_10482024 3300014326 Bacteria 1200
270 Ga0157380_10532392 3300014326 Bacteria 1148
271 Ga0157380_10781119 3300014326 Bacteria 970
272 Ga0157377_10546344 3300014745 Bacteria 818
273 Ga0157379_10001876 3300014968 Bacteria 17378
274 Ga0157379_10132035 3300014968 Bacteria 2248
275 Ga0157379_10945523 3300014968 Bacteria 819
276 Ga0157379_12037897 3300014968 Unclassified 568
277 Ga0157376_10031203 3300014969 Bacteria 4264
278 Ga0157376_10195373 3300014969 Bacteria 1858
279 Ga0157376_10309025 3300014969 Bacteria 1499
280 Ga0157376_10472049 3300014969 Bacteria 1228
281 Ga0157376_10930738 3300014969 Bacteria 889
282 Ga0157376_11074164 3300014969 Bacteria 830
283 Ga0157376_11546341 3300014969 Bacteria 697
284 Ga0163161_10120572 3300017792 Bacteria 1970
285 Ga0163161_10859093 3300017792 Bacteria 766
286 Ga0213874_10315095 3300021377 Bacteria 592
287 Ga0213876_10097500 3300021384 Bacteria 1558
288 Ga0207697_10030794 3300025315 Bacteria 2195
289 Ga0207682_10086323 3300025893 Bacteria 1353
290 Ga0207682_10103682 3300025893 Bacteria 1246
291 Ga0207682_10301579 3300025893 Bacteria 751
292 Ga0207682_10555934 3300025893 Bacteria 542
293 Ga0207692_10419193 3300025898 Bacteria 838
294 Ga0207692_10596244 3300025898 Unclassified 710
295 Ga0207642_10482877 3300025899 Bacteria 756
296 Ga0207710_10058299 3300025900 Bacteria 1745
297 Ga0207710_10162835 3300025900 Bacteria 1087
298 Ga0207680_10006851 3300025903 Bacteria 5530
299 Ga0207680_10375789 3300025903 Bacteria 1001
300 Ga0207685_10301298 3300025905 Bacteria 793
301 Ga0207699_10164141 3300025906 Bacteria 1481
302 Ga0207699_10717144 3300025906 Bacteria 733
303 Ga0207645_10218373 3300025907 Bacteria 1256
304 Ga0207643_10054260 3300025908 Bacteria 2278
305 Ga0207643_10058094 3300025908 Bacteria 2203
306 Ga0207707_10064108 3300025912 Bacteria 3198
307 Ga0207707_10652979 3300025912 Unclassified 886
308 Ga0207695_10012932 3300025913 Bacteria 9985
309 Ga0207695_10043614 3300025913 Bacteria 4780
310 Ga0207695_10550732 3300025913 Bacteria 1035
311 Ga0207671_10224016 3300025914 Bacteria 1474
312 Ga0207671_10233155 3300025914 Bacteria 1444
313 Ga0207663_10129054 3300025916 Bacteria 1744
314 Ga0207660_10045704 3300025917 Bacteria 3085
315 Ga0207660_10505333 3300025917 Unclassified 981
316 Ga0207662_10121422 3300025918 Bacteria 1639
317 Ga0207662_10160651 3300025918 Bacteria 1435
318 Ga0207662_10363402 3300025918 Bacteria 974
319 Ga0207657_11148287 3300025919 Bacteria 592
320 Ga0207649_10413679 3300025920 Bacteria 1011
321 Ga0207649_11003808 3300025920 Bacteria 657
322 Ga0207652_10019843 3300025921 Bacteria 5533
323 Ga0207652_10066650 3300025921 Bacteria 3121
324 Ga0207681_10223459 3300025923 Bacteria 1458
325 Ga0207681_10574850 3300025923 Bacteria 929
326 Ga0207681_10942754 3300025923 Bacteria 723
327 Ga0207681_11662691 3300025923 Bacteria 534
328 Ga0207694_10046411 3300025924 Bacteria 3358
329 Ga0207694_11012611 3300025924 Bacteria 703
330 Ga0207650_10119403 3300025925 Bacteria 2050
331 Ga0207650_10358920 3300025925 Bacteria 1200
332 Ga0207650_10444603 3300025925 Bacteria 1078
333 Ga0207659_10316014 3300025926 Bacteria 1287
334 Ga0207659_10538504 3300025926 Bacteria 991
335 Ga0207659_10780628 3300025926 Bacteria 820
336 Ga0207659_11245178 3300025926 Unclassified 639
337 Ga0207659_11561461 3300025926 Bacteria 564
338 Ga0207687_10017401 3300025927 Bacteria 4733
339 Ga0207700_10024553 3300025928 Bacteria 4173
340 Ga0207700_10168670 3300025928 Bacteria 1824
341 Ga0207644_10601781 3300025931 Bacteria 913
342 Ga0207644_11127322 3300025931 Bacteria 659
343 Ga0207706_10593963 3300025933 Bacteria 951
344 Ga0207686_10037909 3300025934 Bacteria 2912
345 Ga0207686_10255887 3300025934 Bacteria 1281
346 Ga0207670_10060399 3300025936 Bacteria 2582
347 Ga0207670_10225870 3300025936 Bacteria 1435
348 Ga0207670_10359466 3300025936 Bacteria 1155
349 Ga0207670_11293234 3300025936 Bacteria 618
350 Ga0207669_10722196 3300025937 Bacteria 820
351 Ga0207669_11109164 3300025937 Bacteria 668
352 Ga0207704_10071469 3300025938 Bacteria 2202
353 Ga0207704_10233364 3300025938 Bacteria 1370
354 Ga0207704_11900176 3300025938 Bacteria 512
355 Ga0207691_10027783 3300025940 Bacteria 5302
356 Ga0207691_10090224 3300025940 Bacteria 2748
357 Ga0207691_10104906 3300025940 Bacteria 2518
358 Ga0207691_10219120 3300025940 Bacteria 1651
359 Ga0207691_10280107 3300025940 Bacteria 1435
360 Ga0207711_10032349 3300025941 Bacteria 4422
361 Ga0207711_10260372 3300025941 Bacteria 1594
362 Ga0207689_10131827 3300025942 Bacteria 2057
363 Ga0207689_10133728 3300025942 Bacteria 2042
364 Ga0207689_10137031 3300025942 Bacteria 2015
365 Ga0207689_10240930 3300025942 Bacteria 1495
366 Ga0207689_10276955 3300025942 Bacteria 1389
367 Ga0207689_10485645 3300025942 Bacteria 1034
368 Ga0207689_11260597 3300025942 Bacteria 622
369 Ga0207689_11576606 3300025942 Unclassified 547
370 Ga0207661_10077971 3300025944 Bacteria 2726
371 Ga0207661_10089530 3300025944 Bacteria 2561
372 Ga0207661_10359317 3300025944 Bacteria 1315
373 Ga0207679_10154487 3300025945 Bacteria 1872
374 Ga0207667_10355044 3300025949 Bacteria 1495
375 Ga0207651_10121974 3300025960 Bacteria 1978
376 Ga0207651_10285972 3300025960 Bacteria 1365
377 Ga0207651_10337946 3300025960 Bacteria 1264
378 Ga0207651_10398275 3300025960 Bacteria 1170
379 Ga0207712_10167261 3300025961 Unclassified 1715
380 Ga0207668_10648332 3300025972 Bacteria 924
381 Ga0207668_11204077 3300025972 Bacteria 681
382 Ga0207640_10990715 3300025981 Bacteria 739
383 Ga0207640_11333571 3300025981 Bacteria 641
384 Ga0207640_11617135 3300025981 Bacteria 584
385 Ga0207640_12017819 3300025981 Bacteria 523
386 Ga0207658_10001013 3300025986 Bacteria 22929
387 Ga0207658_10154138 3300025986 Bacteria 1875
388 Ga0207658_10647659 3300025986 Bacteria 952
389 Ga0207658_10998903 3300025986 Bacteria 763
390 Ga0207677_10108147 3300026023 Bacteria 2064
391 Ga0207677_10155024 3300026023 Bacteria 1772
392 Ga0207677_11188133 3300026023 Bacteria 698
393 Ga0207677_11876766 3300026023 Unclassified 557
394 Ga0207703_10036167 3300026035 Bacteria 3928
395 Ga0207703_10269242 3300026035 Bacteria 1543
396 Ga0207703_10358106 3300026035 Bacteria 1345
397 Ga0207703_11867809 3300026035 Unclassified 577
398 Ga0207639_10706251 3300026041 Bacteria 936
399 Ga0207639_10877079 3300026041 Bacteria 838
400 Ga0207678_10294203 3300026067 Bacteria 1395
401 Ga0207678_10774973 3300026067 Unclassified 846
402 Ga0207678_11187071 3300026067 Unclassified 676
403 Ga0207708_10118576 3300026075 Bacteria 2061
404 Ga0207708_10506646 3300026075 Bacteria 1012
405 Ga0207708_10702402 3300026075 Bacteria 865
406 Ga0207641_10031891 3300026088 Bacteria 4372
407 Ga0207641_10134247 3300026088 Bacteria 2226
408 Ga0207641_10280527 3300026088 Bacteria 1567
409 Ga0207641_10367342 3300026088 Bacteria 1375
410 Ga0207641_12386421 3300026088 Bacteria 528
411 Ga0207648_10062357 3300026089 Bacteria 3250
412 Ga0207648_10287719 3300026089 Bacteria 1471
413 Ga0207648_11948832 3300026089 Bacteria 549
414 Ga0207676_10073351 3300026095 Bacteria 2754
415 Ga0207676_10611078 3300026095 Bacteria 1048
416 Ga0207674_10235642 3300026116 Bacteria 1778
417 Ga0207674_10787483 3300026116 Bacteria 918
418 Ga0207674_11818072 3300026116 Bacteria 576
419 Ga0207675_100009143 3300026118 Bacteria 9293
420 Ga0207675_100074037 3300026118 Bacteria 3187
421 Ga0207675_100171892 3300026118 Bacteria 2071
422 Ga0207675_100195591 3300026118 Bacteria 1941
423 Ga0207675_100212364 3300026118 Bacteria 1862
424 Ga0207675_100815585 3300026118 Bacteria 947
425 Ga0207683_10098090 3300026121 Bacteria 2614
426 Ga0207683_11203726 3300026121 Bacteria 702
427 Ga0207698_11734146 3300026142 Bacteria 640
428 Ga0207428_10129586 3300027907 Bacteria 1931
429 Ga0268266_10007953 3300028379 Bacteria 9481
430 Ga0268266_10022791 3300028379 Bacteria 5331
431 Ga0268266_10324134 3300028379 Bacteria 1443
432 Ga0268266_10477236 3300028379 Bacteria 1188
433 Ga0268266_10943865 3300028379 Unclassified 834
434 Ga0268266_10996400 3300028379 Bacteria 811
435 Ga0268265_10151055 3300028380 Bacteria 1959
436 Ga0268265_10183623 3300028380 Bacteria 1799
437 Ga0268265_10220746 3300028380 Bacteria 1658
438 Ga0268265_10287122 3300028380 Bacteria 1475
439 Ga0268265_10517377 3300028380 Bacteria 1127
440 Ga0268265_10874126 3300028380 Bacteria 881
441 Ga0268265_10949240 3300028380 Bacteria 847
442 Ga0268265_11021699 3300028380 Bacteria 817
443 Ga0268265_11098880 3300028380 Bacteria 789
444 Ga0268264_10030995 3300028381 Bacteria 4384
445 Ga0268264_10073430 3300028381 Bacteria 2903
446 Ga0268264_11322158 3300028381 Bacteria 731
447 Ga0265334_10143691 3300028573 Unclassified 844
448 Ga0307515_10207922 3300028794 Bacteria 1811
449 Ga0307515_10506357 3300028794 Bacteria 818
450 Ga0265338_11034509 3300028800 Bacteria 555
451 Ga0265331_10010845 3300031250 Bacteria 5012
452 Ga0307513_10013985 3300031456 Bacteria 9831
453 Ga0307513_10028805 3300031456 Bacteria 6343
454 Ga0307513_10044949 3300031456 Bacteria 4832
455 Ga0307513_10156325 3300031456 Bacteria 2179
456 Ga0307513_10418758 3300031456 Bacteria 1070
457 Ga0307513_10437799 3300031456 Bacteria 1034
458 Ga0307513_10800424 3300031456 Unclassified 648
459 Ga0307509_10000017 3300031507 Bacteria 265012
460 Ga0307509_10029840 3300031507 Bacteria 6044
461 Ga0307509_10136691 3300031507 Bacteria 2395
462 Ga0307509_10256419 3300031507 Bacteria 1528
463 Ga0307509_10474064 3300031507 Bacteria 941
464 Ga0307408_100027435 3300031548 Bacteria 3924
465 Ga0307408_100596442 3300031548 Bacteria 981
466 Ga0307408_101066035 3300031548 Bacteria 748
467 Ga0307408_101319416 3300031548 Bacteria 677
468 Ga0265313_10147353 3300031595 Bacteria 1008
469 Ga0307514_10275174 3300031649 Bacteria 970
470 Ga0307514_10500090 3300031649 Unclassified 578
471 Ga0307516_10291658 3300031730 Bacteria 1310
472 Ga0307516_10809104 3300031730 Bacteria 599
473 Ga0307405_10039958 3300031731 Bacteria 2839
474 Ga0307405_10085671 3300031731 Bacteria 2072
475 Ga0307413_10025090 3300031824 Bacteria 3261
476 Ga0307410_10000500 3300031852 Bacteria 15951
477 Ga0307410_10153623 3300031852 Bacteria 1716
478 Ga0307406_10370800 3300031901 Bacteria 1125
479 Ga0307407_10021514 3300031903 Bacteria 3328
480 Ga0307407_10394372 3300031903 Bacteria 991
481 Ga0307407_11002725 3300031903 Unclassified 645
482 Ga0307407_11090269 3300031903 Bacteria 620
483 Ga0307407_11098075 3300031903 Bacteria 618
484 Ga0307407_11716344 3300031903 Bacteria 500
485 Ga0307412_10077641 3300031911 Bacteria 2285
486 Ga0307412_10604922 3300031911 Bacteria 929
487 Ga0307412_12054259 3300031911 Bacteria 530
488 Ga0307409_100000732 3300031995 Bacteria 14712
489 Ga0307409_100185521 3300031995 Bacteria 1846
490 Ga0307409_100819533 3300031995 Bacteria 939
491 Ga0307409_102059425 3300031995 Bacteria 600
492 Ga0307416_100146625 3300032002 Bacteria 2156
493 Ga0307416_100539515 3300032002 Bacteria 1238
494 Ga0307416_101118897 3300032002 Bacteria 892
495 Ga0307416_101617955 3300032002 Unclassified 753
496 Ga0307411_10060016 3300032005 Bacteria 2523
497 Ga0307411_10319141 3300032005 Bacteria 1254
498 Ga0307411_10385563 3300032005 Bacteria 1154
499 Ga0307411_10873556 3300032005 Bacteria 797
500 Ga0307411_11197540 3300032005 Bacteria 688
501 Ga0307411_12009336 3300032005 Bacteria 540
502 Ga0307415_100272207 3300032126 Bacteria 1388
503 Ga0307415_100304741 3300032126 Bacteria 1321
504 Ga0307415_101581648 3300032126 Bacteria 629
505 Ga0307510_10063197 3300033180 Bacteria 3773
506 Ga0373936_0033970 3300035113 Bacteria 2024
507 Ga0373942_0207187 3300035207 Bacteria 653
508 Ga0373937_0188738 3300036401 Bacteria 1936
509 Ga0395905_1394930 3300037471 Bacteria 605
510 Ga0436365_0755364 3300039437 Bacteria 638
511 Ga0436365_1414349 3300039437 Bacteria 6345
512 Ga0436360_1216741 3300039438 Bacteria 529
513 Ga0436361_0806503 3300039447 Bacteria 897
514 Ga0436363_0384404 3300039450 Bacteria 1442
515 Ga0436363_0582684 3300039450 Bacteria 2256
516 Ga0436363_1050128 3300039450 Unclassified 800
517 Ga0451789_0231863 3300041443 Unclassified 519
518 Ga0451791_1020835 3300041451 Bacteria 1636
519 Ga0451791_1150992 3300041451 Bacteria 997
520 Ga0451791_1280237 3300041451 Unclassified 688
521 Ga0451797_0036704 3300041453 Bacteria 733
522 Ga0451797_1259277 3300041453 Bacteria 1579
523 Ga0451795_0253039 3300041456 Bacteria 582
524 Ga0451795_0606969 3300041456 Bacteria 544
525 Ga0451798_0990137 3300041458 Bacteria 1292
526 Ga0451800_0618373 3300041459 Unclassified 671
527 Ga0451800_1063276 3300041459 Bacteria 1325
528 Ga0451802_1051117 3300041460 Bacteria 879
529 Ga0451802_1324941 3300041460 Bacteria 1534
530 Ga0451802_1342131 3300041460 Bacteria 1915
531 Ga0451802_1528997 3300041460 Bacteria 1875
532 Ga0451807_0611469 3300041486 Bacteria 1687
533 Ga0451807_1539539 3300041486 Bacteria 574
534 Ga0451807_1960503 3300041486 Unclassified 715
535 Ga0451807_2462356 3300041486 Bacteria 527
536 Ga0451807_2614589 3300041486 Bacteria 619
537 Ga0451833_0828448 3300041491 Bacteria 629
538 Ga0451837_0466646 3300041494 Bacteria 1810
539 Ga0451839_0890507 3300041496 Bacteria 504
540 Ga0451839_1473046 3300041496 Bacteria 796
541 Ga0451841_0916763 3300041498 Bacteria 754
542 Ga0451845_0289016 3300041501 Bacteria 1805
543 Ga0451847_0040389 3300041503 Bacteria 500
544 Ga0451847_1019890 3300041503 Bacteria 877
545 Ga0451843_1678960 3300041509 Bacteria 727
546 Ga0451855_1859765 3300041511 Bacteria 636
547 Ga0451853_0103031 3300041512 Bacteria 541
548 Ga0451853_0211150 3300041512 Bacteria 977
549 Ga0451853_1174884 3300041512 Bacteria 654
550 Ga0451853_1558326 3300041512 Bacteria 565
551 Ga0451853_3559535 3300041512 Bacteria 1447
552 Ga0451853_3835823 3300041512 Bacteria 752
553 Ga0451853_3917417 3300041512 Unclassified 749
554 Ga0450896_020730 3300042133 Bacteria 963
555 Ga0439459_0141539 3300042438 Bacteria 622
556 Ga0439459_0214563 3300042438 Bacteria 531
557 Ga0466969_0000960 3300044656 Bacteria 15534
558 Ga0466969_0005735 3300044656 Bacteria 6600
559 Ga0466972_0088570 3300044658 Bacteria 1469
560 Ga0466966_0328088 3300044684 Bacteria 919
561 Ga0466970_0046170 3300044765 Bacteria 2320
562 Ga0466970_0182566 3300044765 Bacteria 1164
563 Ga0466959_0034640 3300045049 Bacteria 3735
564 Ga0466959_0036175 3300045049 Bacteria 3648
565 Ga0466959_0250908 3300045049 Bacteria 1220
566 Ga0466958_0036183 3300045836 Bacteria 2954
567 Ga0466967_2431252 3300045976 Unclassified 519
568 Ga0495617_063110 3300046452 Bacteria 1224
569 Ga0495603_0433702 3300046455 Bacteria 753
570 Ga0495590_0002047 3300046457 Bacteria 8457
571 Ga0495590_0165748 3300046457 Bacteria 804
572 Ga0495591_016735 3300046458 Bacteria 2540
573 Ga0495629_0362955 3300046459 Bacteria 987
574 Ga0495638_0076082 3300046460 Bacteria 2045
575 Ga0495638_0106227 3300046460 Bacteria 1673
576 Ga0495641_0383844 3300046461 Bacteria 637
577 Ga0495650_0118621 3300046471 Bacteria 976
578 Ga0495580_0055985 3300046472 Bacteria 2778
579 Ga0495662_0237413 3300046476 Bacteria 898
580 Ga0495664_0614081 3300046477 Bacteria 646
581 Ga0495584_0023980 3300046491 Bacteria 3093
582 Ga0495594_0384733 3300046499 Bacteria 798
583 Ga0495596_0312402 3300046500 Bacteria 611
584 Ga0495583_0021099 3300046506 Bacteria 3356
585 Ga0495583_0263795 3300046506 Unclassified 689
586 Ga0495616_0001603 3300046513 Bacteria 15497
587 Ga0495616_0454743 3300046513 Bacteria 518
588 Ga0495616_0456389 3300046513 Bacteria 517
589 Ga0495620_0222914 3300046515 Unclassified 721
590 Ga0495632_0026552 3300046519 Bacteria 3047
591 Ga0495632_0044195 3300046519 Bacteria 2224
592 Ga0495643_0364882 3300046522 Unclassified 644
593 Ga0495644_0051138 3300046523 Bacteria 1551
594 Ga0495648_0276990 3300046524 Bacteria 797
595 Ga0495663_0075748 3300046525 Bacteria 1077
596 Ga0495586_0059053 3300046535 Bacteria 2084
597 Ga0495598_0014800 3300046537 Bacteria 1957
598 Ga0495621_0008964 3300046539 Bacteria 3018
599 Ga0495633_0391444 3300046558 Bacteria 629
600 Ga0495656_0011521 3300046615 Bacteria 3248
601 Ga0495656_0149864 3300046615 Unclassified 1126
602 Ga0495668_0148242 3300046616 Bacteria 1285
603 Ga0495625_0029133 3300046660 Bacteria 4133
604 Ga0495625_0029573 3300046660 Bacteria 4095
605 Ga0495625_0048436 3300046660 Bacteria 3060
606 Ga0495625_0101406 3300046660 Bacteria 1977
607 Ga0495625_0174873 3300046660 Bacteria 1431
608 Ga0495661_0314427 3300046665 Bacteria 780
609 Ga0495647_0001869 3300046681 Bacteria 6540
610 Ga0495658_0066866 3300046683 Bacteria 2077
611 Ga0495669_0323548 3300046684 Bacteria 744
612 Ga0495613_0395806 3300046689 Bacteria 943
613 Ga0495649_0003326 3300046694 Bacteria 10920
614 Ga0495649_0248526 3300046694 Unclassified 914
615 Ga0495589_0065449 3300046794 Unclassified 1782
616 Ga0495589_0106596 3300046794 Bacteria 1354
617 Ga0495600_0415128 3300046809 Bacteria 836
618 Ga0495604_0196784 3300047317 Bacteria 1401
619 Ga0495674_0929608 3300047319 Bacteria 670
620 Ga0495672_0484035 3300047320 Bacteria 553
621 Ga0495676_0351220 3300047321 Bacteria 986
622 Ga0495680_0790183 3300047322 Bacteria 621
623 Ga0495675_0324599 3300047444 Bacteria 910
624 Ga0495677_0199685 3300047445 Bacteria 777
625 Ga0495673_0364839 3300047469 Bacteria 508
626 Ga0495681_0035604 3300047470 Bacteria 2470
627 Ga0496101_0331384 3300048904 Bacteria 1195
628 Ga0496104_0004867 3300048907 Bacteria 11704
629 Ga0496105_0195108 3300048908 Bacteria 1654
630 Ga0496107_1159279 3300048910 Unclassified 557
631 Ga0496108_0009689 3300048911 Bacteria 7804
632 Ga0496109_0101258 3300048912 Bacteria 2673
633 Ga0496110_0035167 3300048913 Bacteria 4344
634 Ga0496111_0013088 3300048914 Bacteria 5634
635 Ga0496114_0034713 3300048917 Bacteria 4162
636 Ga0496114_0075481 3300048917 Bacteria 2840
637 Ga0496124_0781465 3300048927 Unclassified 594
638 Ga0496126_0026477 3300048929 Bacteria 5560
639 Ga0496126_0393763 3300048929 Bacteria 1125
640 Ga0496126_0755265 3300048929 Unclassified 750
641 Ga0501036_0366690 3300049572 Bacteria 1202
642 Ga0501042_0050315 3300049578 Bacteria 2972
643 Ga0501042_0222689 3300049578 Bacteria 1361
644 Ga0501068_0650927 3300049584 Bacteria 688
645 Ga0501071_0299362 3300049587 Bacteria 1219
646 Ga0501073_0239520 3300049589 Bacteria 1253
647 Ga0501074_1139571 3300049590 Bacteria 547
648 Ga0501075_0426400 3300049591 Bacteria 1011
649 Ga0501077_0755553 3300049593 Bacteria 625
650 Ga0501079_1101034 3300049741 Bacteria 626
651 Ga0501081_0854872 3300049743 Bacteria 685
652 Ga0501083_0897808 3300049744 Bacteria 577
653 Ga0501035_1202366 3300049822 Bacteria 588
654 Ga0501044_0310096 3300049823 Bacteria 1505
655 Ga0501044_1013348 3300049823 Bacteria 702
656 Ga0501045_0175636 3300049824 Bacteria 1596
657 nmdc:mga0k408_896682_c1 3300050493 Bacteria 514
658 nmdc:mga08y16_1120747_c1 3300050511 Unclassified 761
659 nmdc:mga08y16_218811_c1 3300050511 Bacteria 1972
660 Ga0495612_0126252 3300053078 Bacteria 1103
661 Ga0500578_0393278 3300053086 Bacteria 801
662 Ga0500646_0064808 3300053090 Bacteria 1083
663 Ga0500647_0377316 3300053091 Bacteria 582
664 Ga0500583_0042636 3300053092 Bacteria 2068
665 Ga0500583_0314422 3300053092 Bacteria 764
666 Ga0500641_0021511 3300053096 Bacteria 2460
667 Ga0500641_0063851 3300053096 Bacteria 1537
668 Ga0500556_0283382 3300053104 Bacteria 649
669 Ga0500558_117718 3300053106 Bacteria 1033
670 Ga0500572_215656 3300053111 Bacteria 628
671 Ga0500594_0010636 3300053118 Bacteria 2140
672 Ga0500597_202235 3300053120 Bacteria 834
673 Ga0500614_056638 3300053123 Bacteria 1043
674 Ga0500617_019162 3300053124 Bacteria 2988
675 Ga0500628_261720 3300053129 Unclassified 510
676 Ga0500642_0136163 3300053130 Bacteria 1151
677 Ga0500642_0174958 3300053130 Bacteria 1004
678 Ga0500658_0015386 3300053134 Bacteria 2840
679 Ga0500559_0187582 3300053136 Bacteria 975
680 Ga0500568_0044626 3300053139 Bacteria 1767
681 Ga0500588_0173679 3300053146 Bacteria 789
682 Ga0500604_0171034 3300053151 Bacteria 743
683 Ga0500616_0000018 3300053153 Bacteria 610976
684 Ga0500616_0040981 3300053153 Unclassified 2487
685 Ga0500627_0103054 3300053158 Unclassified 1282
686 Ga0500627_0396354 3300053158 Unclassified 589
687 Ga0500633_0007765 3300053160 Bacteria 2724
688 Ga0500639_361555 3300053163 Bacteria 508
689 Ga0500636_0256896 3300053177 Unclassified 887
690 Ga0500637_0005616 3300053178 Bacteria 6094
691 Ga0500637_0041588 3300053178 Bacteria 2598
692 Ga0500637_0174463 3300053178 Bacteria 1234
693 Ga0500637_0624179 3300053178 Bacteria 506
694 Ga0501084_0325899 3300054114 Bacteria 1297
695 Ga0501082_0826478 3300060353 Bacteria 810
696 Ga0466962_0124315 3300061719 Bacteria 1246
697 Ga0530510_0700263 3300061734 Bacteria 772
698 Ga0451802_1656851
699 JGI25406J46586_10080365
700 rootL2_10068794
701 Ga0070676_10154222
702 Ga0070676_10339380
703 Ga0070683_100210509
704 Ga0070683_101225686
705 Ga0070690_100200714
706 Ga0070690_100554472
707 Ga0070670_100212777
708 Ga0070670_100418930
709 Ga0070677_10003986
710 Ga0070677_10100260
711 Ga0068869_100266818
712 Ga0068869_100277014
713 Ga0068869_100340388
714 Ga0068869_100369837
715 Ga0068869_100506162
716 Ga0068869_101015731
717 Ga0070666_10004216
718 Ga0070666_10009494
719 Ga0070680_100047098
720 Ga0070682_100106863
721 Ga0070682_100240770
722 Ga0070682_101578278
723 Ga0070682_101759638
724 Ga0068868_100007435
725 Ga0068868_100852102
726 Ga0068868_102370840
727 Ga0070689_100006887
728 Ga0070689_100206483
729 Ga0070689_100839639
730 Ga0070689_101098013
731 Ga0070687_100180268
732 Ga0070661_100474556
733 Ga0070692_10225788
734 Ga0070668_100165739
735 Ga0070668_100364604
736 Ga0070668_101782747
737 Ga0070669_101309044
738 Ga0070675_100035869
739 Ga0070675_100093989
740 Ga0070675_100238667
741 Ga0070675_100324899
742 Ga0070675_100351868
743 Ga0070675_101455172
744 Ga0070675_101663928
745 Ga0070671_100031895
746 Ga0070671_100325896
747 Ga0070674_100042586
748 Ga0070674_100092380
749 Ga0070673_100066144
750 Ga0070673_100070772
751 Ga0070673_100089085
752 Ga0070673_100136437
753 Ga0070673_100148509
754 Ga0070673_100434429
755 Ga0070673_101749638
756 Ga0070688_100010698
757 Ga0070659_100782597
758 Ga0070659_101708403
759 Ga0070667_100000184
760 Ga0070667_100016642
761 Ga0070667_100510475
762 Ga0070667_100543711
763 Ga0070667_100778258
764 Ga0070667_101661742
765 Ga0070667_101980702
766 Ga0070709_10578905
767 Ga0070709_10816480
768 Ga0070713_100415535
769 Ga0070713_100418066
770 Ga0070710_10326810
771 Ga0070710_10676076
772 Ga0070701_10016200
773 Ga0070701_10070603
774 Ga0070701_10150971
775 Ga0070705_100009121
776 Ga0070700_100113612
777 Ga0070700_100277626
778 Ga0070700_100376358
779 Ga0070700_100389322
780 Ga0070700_100767989
781 Ga0070694_100164927
782 Ga0070694_101733137
783 Ga0070663_101539450
784 Ga0070678_100286683
785 Ga0070678_101513591
786 Ga0070662_100842253
787 Ga0070662_100941725
788 Ga0070681_10010910
789 Ga0070681_10089146
790 Ga0070681_11020913
791 Ga0068867_100045016
792 Ga0068867_100373111
793 Ga0068867_101474231
794 Ga0070685_10288778
795 Ga0070679_100037680
796 Ga0070679_100079717
797 Ga0070679_100700598
798 Ga0070684_100144282
799 Ga0070684_100340440
800 Ga0070684_100553316
801 Ga0068853_100628216
802 Ga0068853_101158798
803 Ga0068853_101250094
804 Ga0070672_100010050
805 Ga0070672_100021356
806 Ga0070672_100238511
807 Ga0070672_100466250
808 Ga0070686_100013264
809 Ga0070686_100786957
810 Ga0070696_100026580
811 Ga0070693_100371564
812 Ga0070693_100721251
813 Ga0070665_100008952
814 Ga0070665_100037380
815 Ga0070665_100068512
816 Ga0070664_101380912
817 Ga0070664_102016678
818 Ga0068857_100343588
819 Ga0068857_100464172
820 Ga0068857_101740959
821 Ga0068857_101774013
822 Ga0068854_101825408
823 Ga0068856_100315667
824 Ga0068856_102433062
825 Ga0070702_100009251
826 Ga0070702_100215208
827 Ga0068859_100099223
828 Ga0068859_100162506
829 Ga0068859_100204778
830 Ga0068859_100597761
831 Ga0068859_100739217
832 Ga0068859_101233828
833 Ga0068859_101752975
834 Ga0068859_102557736
835 Ga0068864_100018240
836 Ga0068864_100064542
837 Ga0068864_100181691
838 Ga0068866_10447634
839 Ga0068861_100040357
840 Ga0068861_100051338
841 Ga0068861_100160810
842 Ga0068861_100316157
843 Ga0068861_100392263
844 Ga0068861_100601178
845 Ga0068861_101125367
846 Ga0068870_10034651
847 Ga0068870_10141678
848 Ga0068870_10162276
849 Ga0068863_100042860
850 Ga0068863_100148052
851 Ga0068863_100303680
852 Ga0068863_100444234
853 Ga0068863_100585401
854 Ga0068858_100091083
855 Ga0068858_100416588
856 Ga0068858_102227185
857 Ga0068860_100013634
858 Ga0068860_100394328
859 Ga0068860_100689320
860 Ga0068860_100856677
861 Ga0068860_101967858
862 Ga0068862_100028519
863 Ga0068862_100107325
864 Ga0068862_100199098
865 Ga0068862_100328788
866 Ga0068862_100431583
867 Ga0068862_100475100
868 Ga0068862_100491311
869 Ga0068862_100627476
870 Ga0081455_10000679
871 Ga0081455_10004105
872 Ga0081539_10000006
873 Ga0081539_10386210
874 Ga0070717_11247354
875 Ga0070712_100680304
876 Ga0097621_100073851
877 Ga0097621_100149636
878 Ga0097621_100177839
879 Ga0097621_100788950
880 Ga0068871_100019350
881 Ga0068871_100064789
882 Ga0068871_100186187
883 Ga0068871_100257264
884 Ga0068871_100425328
885 Ga0068871_101316055
886 Ga0068871_101433483
887 Ga0075428_100629318
888 Ga0068865_100194669
889 Ga0068865_100391863
890 Ga0068865_101189023
891 Ga0097620_100099227
892 Ga0097620_100162496
893 Ga0097620_100204784
894 Ga0097620_100597773
895 Ga0097620_100739271
896 Ga0097620_101233851
897 Ga0097620_101752820
898 Ga0097620_102558037
899 Ga0105250_10305001
900 Ga0105240_10001884
901 Ga0105240_10049655
902 Ga0105240_10171005
903 Ga0105240_10196914
904 Ga0105240_10305537
905 Ga0111539_10020948
906 Ga0111539_11888574
907 Ga0105245_10083637
908 Ga0105247_10076278
909 Ga0105247_10294189
910 Ga0105243_10333928
911 Ga0105243_11006050
912 Ga0105243_11455900
913 Ga0105243_12006829
914 Ga0105243_13009559
915 Ga0105241_10617807
916 Ga0105242_10083711
917 Ga0105242_10091716
918 Ga0105242_10700816
919 Ga0105248_10197500
920 Ga0105248_10209027
921 Ga0105248_12590087
922 Ga0105237_10101762
923 Ga0105237_10393309
924 Ga0105238_10157344
925 Ga0105238_10240269
926 Ga0105238_10444962
927 Ga0105238_11224941
928 Ga0105238_11371193
929 Ga0105238_11505077
930 Ga0105238_12586940
931 Ga0105249_10059430
932 Ga0105249_10350052
933 Ga0105249_10683573
934 Ga0105239_10052409
935 Ga0105239_10862041
936 Ga0105246_10129408
937 Ga0105246_11343058
938 Ga0157369_10140326
939 Ga0157374_10029871
940 Ga0157374_10304336
941 Ga0157378_10023709
942 Ga0157378_10784099
943 Ga0157378_11732494
944 Ga0157378_12023287
945 Ga0163162_10043944
946 Ga0163162_11892050
947 Ga0157375_10031034
948 Ga0157375_10916902
949 Ga0157375_10950366
950 Ga0157375_11634425
951 Ga0163163_10015439
952 Ga0163163_10018471
953 Ga0163163_10091719
954 Ga0163163_10146475
955 Ga0163163_10358614
956 Ga0163163_10573338
957 Ga0163163_10576472
958 Ga0163163_10841958
959 Ga0163163_11273208
960 Ga0163163_11603601
961 Ga0157380_10144282
962 Ga0157380_10227225
963 Ga0157380_10251395
964 Ga0157380_10390060
965 Ga0157380_10421698
966 Ga0157380_10482024
967 Ga0157380_10532392
968 Ga0157380_10781119
969 Ga0157377_10546344
970 Ga0157379_10001876
971 Ga0157379_10132035
972 Ga0157379_10945523
973 Ga0157379_12037897
974 Ga0157376_10031203
975 Ga0157376_10195373
976 Ga0157376_10309025
977 Ga0157376_10472049
978 Ga0157376_10930738
979 Ga0157376_11074164
980 Ga0157376_11546341
981 Ga0163161_10120572
982 Ga0163161_10859093
983 Ga0213874_10315095
984 Ga0213876_10097500
985 Ga0207697_10030794
986 Ga0207682_10086323
987 Ga0207682_10103682
988 Ga0207682_10301579
989 Ga0207682_10555934
990 Ga0207692_10419193
991 Ga0207692_10596244
992 Ga0207642_10482877
993 Ga0207710_10058299
994 Ga0207710_10162835
995 Ga0207680_10006851
996 Ga0207680_10375789
997 Ga0207685_10301298
998 Ga0207699_10164141
999 Ga0207699_10717144
1000 Ga0207645_10218373
1001 Ga0207643_10054260
1002 Ga0207643_10058094
1003 Ga0207707_10064108
1004 Ga0207707_10652979
1005 Ga0207695_10012932
1006 Ga0207695_10043614
1007 Ga0207695_10550732
1008 Ga0207671_10224016
1009 Ga0207671_10233155
1010 Ga0207663_10129054
1011 Ga0207660_10045704
1012 Ga0207660_10505333
1013 Ga0207662_10121422
1014 Ga0207662_10160651
1015 Ga0207662_10363402
1016 Ga0207657_11148287
1017 Ga0207649_10413679
1018 Ga0207649_11003808
1019 Ga0207652_10019843
1020 Ga0207652_10066650
1021 Ga0207681_10223459
1022 Ga0207681_10574850
1023 Ga0207681_10942754
1024 Ga0207681_11662691
1025 Ga0207694_10046411
1026 Ga0207694_11012611
1027 Ga0207650_10119403
1028 Ga0207650_10358920
1029 Ga0207650_10444603
1030 Ga0207659_10316014
1031 Ga0207659_10538504
1032 Ga0207659_10780628
1033 Ga0207659_11245178
1034 Ga0207659_11561461
1035 Ga0207687_10017401
1036 Ga0207700_10024553
1037 Ga0207700_10168670
1038 Ga0207644_10601781
1039 Ga0207644_11127322
1040 Ga0207706_10593963
1041 Ga0207686_10037909
1042 Ga0207686_10255887
1043 Ga0207670_10060399
1044 Ga0207670_10225870
1045 Ga0207670_10359466
1046 Ga0207670_11293234
1047 Ga0207669_10722196
1048 Ga0207669_11109164
1049 Ga0207704_10071469
1050 Ga0207704_10233364
1051 Ga0207704_11900176
1052 Ga0207691_10027783
1053 Ga0207691_10090224
1054 Ga0207691_10104906
1055 Ga0207691_10219120
1056 Ga0207691_10280107
1057 Ga0207711_10032349
1058 Ga0207711_10260372
1059 Ga0207689_10131827
1060 Ga0207689_10133728
1061 Ga0207689_10137031
1062 Ga0207689_10240930
1063 Ga0207689_10276955
1064 Ga0207689_10485645
1065 Ga0207689_11260597
1066 Ga0207689_11576606
1067 Ga0207661_10077971
1068 Ga0207661_10089530
1069 Ga0207661_10359317
1070 Ga0207679_10154487
1071 Ga0207667_10355044
1072 Ga0207651_10121974
1073 Ga0207651_10285972
1074 Ga0207651_10337946
1075 Ga0207651_10398275
1076 Ga0207712_10167261
1077 Ga0207668_10648332
1078 Ga0207668_11204077
1079 Ga0207640_10990715
1080 Ga0207640_11333571
1081 Ga0207640_11617135
1082 Ga0207640_12017819
1083 Ga0207658_10001013
1084 Ga0207658_10154138
1085 Ga0207658_10647659
1086 Ga0207658_10998903
1087 Ga0207677_10108147
1088 Ga0207677_10155024
1089 Ga0207677_11188133
1090 Ga0207677_11876766
1091 Ga0207703_10036167
1092 Ga0207703_10269242
1093 Ga0207703_10358106
1094 Ga0207703_11867809
1095 Ga0207639_10706251
1096 Ga0207639_10877079
1097 Ga0207678_10294203
1098 Ga0207678_10774973
1099 Ga0207678_11187071
1100 Ga0207708_10118576
1101 Ga0207708_10506646
1102 Ga0207708_10702402
1103 Ga0207641_10031891
1104 Ga0207641_10134247
1105 Ga0207641_10280527
1106 Ga0207641_10367342
1107 Ga0207641_12386421
1108 Ga0207648_10062357
1109 Ga0207648_10287719
1110 Ga0207648_11948832
1111 Ga0207676_10073351
1112 Ga0207676_10611078
1113 Ga0207674_10235642
1114 Ga0207674_10787483
1115 Ga0207674_11818072
1116 Ga0207675_100009143
1117 Ga0207675_100074037
1118 Ga0207675_100171892
1119 Ga0207675_100195591
1120 Ga0207675_100212364
1121 Ga0207675_100815585
1122 Ga0207683_10098090
1123 Ga0207683_11203726
1124 Ga0207698_11734146
1125 Ga0207428_10129586
1126 Ga0268266_10007953
1127 Ga0268266_10022791
1128 Ga0268266_10324134
1129 Ga0268266_10477236
1130 Ga0268266_10943865
1131 Ga0268266_10996400
1132 Ga0268265_10151055
1133 Ga0268265_10183623
1134 Ga0268265_10220746
1135 Ga0268265_10287122
1136 Ga0268265_10517377
1137 Ga0268265_10874126
1138 Ga0268265_10949240
1139 Ga0268265_11021699
1140 Ga0268265_11098880
1141 Ga0268264_10030995
1142 Ga0268264_10073430
1143 Ga0268264_11322158
1144 Ga0265334_10143691
1145 Ga0307515_10207922
1146 Ga0307515_10506357
1147 Ga0265338_11034509
1148 Ga0265331_10010845
1149 Ga0307513_10013985
1150 Ga0307513_10028805
1151 Ga0307513_10044949
1152 Ga0307513_10156325
1153 Ga0307513_10418758
1154 Ga0307513_10437799
1155 Ga0307513_10800424
1156 Ga0307509_10000017
1157 Ga0307509_10029840
1158 Ga0307509_10136691
1159 Ga0307509_10256419
1160 Ga0307509_10474064
1161 Ga0307408_100027435
1162 Ga0307408_100596442
1163 Ga0307408_101066035
1164 Ga0307408_101319416
1165 Ga0265313_10147353
1166 Ga0307514_10275174
1167 Ga0307514_10500090
1168 Ga0307516_10291658
1169 Ga0307516_10809104
1170 Ga0307405_10039958
1171 Ga0307405_10085671
1172 Ga0307413_10025090
1173 Ga0307410_10000500
1174 Ga0307410_10153623
1175 Ga0307406_10370800
1176 Ga0307407_10021514
1177 Ga0307407_10394372
1178 Ga0307407_11002725
1179 Ga0307407_11090269
1180 Ga0307407_11098075
1181 Ga0307407_11716344
1182 Ga0307412_10077641
1183 Ga0307412_10604922
1184 Ga0307412_12054259
1185 Ga0307409_100000732
1186 Ga0307409_100185521
1187 Ga0307409_100819533
1188 Ga0307409_102059425
1189 Ga0307416_100146625
1190 Ga0307416_100539515
1191 Ga0307416_101118897
1192 Ga0307416_101617955
1193 Ga0307411_10060016
1194 Ga0307411_10319141
1195 Ga0307411_10385563
1196 Ga0307411_10873556
1197 Ga0307411_11197540
1198 Ga0307411_12009336
1199 Ga0307415_100272207
1200 Ga0307415_100304741
1201 Ga0307415_101581648
1202 Ga0307510_10063197
1203 Ga0373936_0033970
1204 Ga0373942_0207187
1205 Ga0373937_0188738
1206 Ga0395905_1394930
1207 Ga0436365_0755364
1208 Ga0436365_1414349
1209 Ga0436360_1216741
1210 Ga0436361_0806503
1211 Ga0436363_0384404
1212 Ga0436363_0582684
1213 Ga0436363_1050128
1214 Ga0451789_0231863
1215 Ga0451791_1020835
1216 Ga0451791_1150992
1217 Ga0451791_1280237
1218 Ga0451797_0036704
1219 Ga0451797_1259277
1220 Ga0451795_0253039
1221 Ga0451795_0606969
1222 Ga0451798_0990137
1223 Ga0451800_0618373
1224 Ga0451800_1063276
1225 Ga0451802_1051117
1226 Ga0451802_1324941
1227 Ga0451802_1342131
1228 Ga0451802_1528997
1229 Ga0451807_0611469
1230 Ga0451807_1539539
1231 Ga0451807_1960503
1232 Ga0451807_2462356
1233 Ga0451807_2614589
1234 Ga0451833_0828448
1235 Ga0451837_0466646
1236 Ga0451839_0890507
1237 Ga0451839_1473046
1238 Ga0451841_0916763
1239 Ga0451845_0289016
1240 Ga0451847_0040389
1241 Ga0451847_1019890
1242 Ga0451843_1678960
1243 Ga0451855_1859765
1244 Ga0451853_0103031
1245 Ga0451853_0211150
1246 Ga0451853_1174884
1247 Ga0451853_1558326
1248 Ga0451853_3559535
1249 Ga0451853_3835823
1250 Ga0451853_3917417
1251 Ga0450896_020730
1252 Ga0439459_0141539
1253 Ga0439459_0214563
1254 Ga0466969_0000960
1255 Ga0466969_0005735
1256 Ga0466972_0088570
1257 Ga0466966_0328088
1258 Ga0466970_0046170
1259 Ga0466970_0182566
1260 Ga0466959_0034640
1261 Ga0466959_0036175
1262 Ga0466959_0250908
1263 Ga0466958_0036183
1264 Ga0466967_2431252
1265 Ga0495617_063110
1266 Ga0495603_0433702
1267 Ga0495590_0002047
1268 Ga0495590_0165748
1269 Ga0495591_016735
1270 Ga0495629_0362955
1271 Ga0495638_0076082
1272 Ga0495638_0106227
1273 Ga0495641_0383844
1274 Ga0495650_0118621
1275 Ga0495580_0055985
1276 Ga0495662_0237413
1277 Ga0495664_0614081
1278 Ga0495584_0023980
1279 Ga0495594_0384733
1280 Ga0495596_0312402
1281 Ga0495583_0021099
1282 Ga0495583_0263795
1283 Ga0495616_0001603
1284 Ga0495616_0454743
1285 Ga0495616_0456389
1286 Ga0495620_0222914
1287 Ga0495632_0026552
1288 Ga0495632_0044195
1289 Ga0495643_0364882
1290 Ga0495644_0051138
1291 Ga0495648_0276990
1292 Ga0495663_0075748
1293 Ga0495586_0059053
1294 Ga0495598_0014800
1295 Ga0495621_0008964
1296 Ga0495633_0391444
1297 Ga0495656_0011521
1298 Ga0495656_0149864
1299 Ga0495668_0148242
1300 Ga0495625_0029133
1301 Ga0495625_0029573
1302 Ga0495625_0048436
1303 Ga0495625_0101406
1304 Ga0495625_0174873
1305 Ga0495661_0314427
1306 Ga0495647_0001869
1307 Ga0495658_0066866
1308 Ga0495669_0323548
1309 Ga0495613_0395806
1310 Ga0495649_0003326
1311 Ga0495649_0248526
1312 Ga0495589_0065449
1313 Ga0495589_0106596
1314 Ga0495600_0415128
1315 Ga0495604_0196784
1316 Ga0495674_0929608
1317 Ga0495672_0484035
1318 Ga0495676_0351220
1319 Ga0495680_0790183
1320 Ga0495675_0324599
1321 Ga0495677_0199685
1322 Ga0495673_0364839
1323 Ga0495681_0035604
1324 Ga0496101_0331384
1325 Ga0496104_0004867
1326 Ga0496105_0195108
1327 Ga0496107_1159279
1328 Ga0496108_0009689
1329 Ga0496109_0101258
1330 Ga0496110_0035167
1331 Ga0496111_0013088
1332 Ga0496114_0034713
1333 Ga0496114_0075481
1334 Ga0496124_0781465
1335 Ga0496126_0026477
1336 Ga0496126_0393763
1337 Ga0496126_0755265
1338 Ga0501036_0366690
1339 Ga0501042_0050315
1340 Ga0501042_0222689
1341 Ga0501068_0650927
1342 Ga0501071_0299362
1343 Ga0501073_0239520
1344 Ga0501074_1139571
1345 Ga0501075_0426400
1346 Ga0501077_0755553
1347 Ga0501079_1101034
1348 Ga0501081_0854872
1349 Ga0501083_0897808
1350 Ga0501035_1202366
1351 Ga0501044_0310096
1352 Ga0501044_1013348
1353 Ga0501045_0175636
1354 nmdc:mga0k408_896682_c1
1355 nmdc:mga08y16_1120747_c1
1356 nmdc:mga08y16_218811_c1
1357 Ga0495612_0126252
1358 Ga0500578_0393278
1359 Ga0500646_0064808
1360 Ga0500647_0377316
1361 Ga0500583_0042636
1362 Ga0500583_0314422
1363 Ga0500641_0021511
1364 Ga0500641_0063851
1365 Ga0500556_0283382
1366 Ga0500558_117718
1367 Ga0500572_215656
1368 Ga0500594_0010636
1369 Ga0500597_202235
1370 Ga0500614_056638
1371 Ga0500617_019162
1372 Ga0500628_261720
1373 Ga0500642_0136163
1374 Ga0500642_0174958
1375 Ga0500658_0015386
1376 Ga0500559_0187582
1377 Ga0500568_0044626
1378 Ga0500588_0173679
1379 Ga0500604_0171034
1380 Ga0500616_0000018
1381 Ga0500616_0040981
1382 Ga0500627_0103054
1383 Ga0500627_0396354
1384 Ga0500633_0007765
1385 Ga0500639_361555
1386 Ga0500636_0256896
1387 Ga0500637_0005616
1388 Ga0500637_0041588
1389 Ga0500637_0174463
1390 Ga0500637_0624179
1391 Ga0501084_0325899
1392 Ga0501082_0826478
1393 Ga0466962_0124315
1394 Ga0530510_0700263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04999

FtsL

Cell division protein FtsL

39

114

0.97

Map