F475888

General Info

Members Datasets Scaffolds Average Seq Length
697 299 538 195

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000849|Ga0079104_10008496
Length 213
Sequence MLNLTVNPARPNKRGFIMAEDRHQQRQQRLKEQVDARITAAQEVRGLLLVFTGNGKGKTTAAFGTVTRAVGHGMKAGVIQFIKGEWPNGEKNLLQQHGVEFQVMATGFTWETQDKASDTAACQAVWQHGKRMLADSSLDLVLLDELTYMVSYGYLELDELLEALRQRPAHQTVIITGRGCHRDLLELADTVTEMRPVKHAFDAGIKAQQGIDW

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
62 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
63 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
64 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
65 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
66 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
67 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
68 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
69 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
70 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
71 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
72 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
73 2751185917 Enterobacter sp. HK169 Isolate Unclassified
74 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
75 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
76 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
77 2775507074 Klebsiella sp. D5A Isolate Unclassified
78 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
79 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
80 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
81 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
82 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
83 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
84 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
85 2821118458 Enterobacter asburiae 609 Isolate Unclassified
86 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
87 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
88 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
89 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
90 2847085930 Erwinia persicina B64 Isolate Bulb
91 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
92 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
93 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
94 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
95 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
96 2865014394 Pantoea sp. R-71966 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2876601092 Pantoea endophytica 596 Isolate Unclassified
101 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
102 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
103 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
104 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
105 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
106 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
107 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
108 2904504865 Serratia marcescens 1822 Isolate Unclassified
109 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
110 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
111 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
112 2919150387 Rahnella aceris 1817 Isolate Unclassified
113 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
114 2927143783 Rahnella sp. 2050 Isolate Unclassified
115 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
116 2932406140 Serratia sp. 2723 Isolate Rhizosphere
117 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
118 2937539931 Pantoea sp. LS15 Isolate Unclassified
119 2937967321 Serratia sp. YC16 Isolate Unclassified
120 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
121 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
122 2939577877 Serratia sp. 509 Isolate Rhizosphere
123 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
124 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
125 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
126 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
127 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
128 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
129 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
130 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
131 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
132 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
133 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
134 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
135 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
136 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
137 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
138 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
139 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
140 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
141 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
142 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
143 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
144 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
145 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
146 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
147 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
148 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
149 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
154 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
155 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
156 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
157 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
158 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
159 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
160 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
175 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
176 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
177 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
210 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
211 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
228 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
229 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
285 640753048 Serratia proteamaculans 568 Isolate Endosphere
286 8004592986 Serratia sp. S119 Isolate Unclassified
287 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
288 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
289 8018221730 Enterobacter sp. CM29 Isolate Unclassified
290 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
291 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
292 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
293 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
294 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
295 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
296 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
297 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
298 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
299 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.18
Metatranscriptomes 1
Isolates 22.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0.14
Endosphere 4.73
Nodule 3.16
Rhizoplane 10.62
Rhizosphere 52.51
Stem 0.14
Stem Tuber 0.86
Unclassified 27.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C815 2010549000 Bacteria 4306
2 JGI24739J22299_10009922 3300001989 Bacteria 3540
3 JGI25162J39368_1000033 3300002737 Bacteria 194080
4 JGI25162J39368_1001878 3300002737 Bacteria 9652
5 JGI25163J39215_1000004 3300002771 Bacteria 136984
6 JGI25164J39214_1000017 3300002772 Bacteria 200566
7 rootH2_10047075 3300003320 Bacteria 10330
8 Ga0055538_1000035 3300003751 Bacteria 194080
9 Ga0055539_1000046 3300003752 Bacteria 194080
10 Ga0055533_1000056 3300003756 Bacteria 194080
11 Ga0055525_1000067 3300003759 Bacteria 194080
12 Ga0055541_1000033 3300003841 Bacteria 194080
13 Ga0058692_1000084 3300003856 Bacteria 65638
14 Ga0058692_1000137 3300003856 Bacteria 46529
15 Ga0058692_1000160 3300003856 Bacteria 42011
16 Ga0058692_1000259 3300003856 Bacteria 28696
17 Ga0058692_1000501 3300003856 Bacteria 17375
18 Ga0058692_1002470 3300003856 Bacteria 6172
19 Ga0058692_1004501 3300003856 Bacteria 4121
20 Ga0058692_1005179 3300003856 Bacteria 3749
21 Ga0058692_1008787 3300003856 Bacteria 2591
22 Ga0058692_1013888 3300003856 Bacteria 1861
23 Ga0058692_1016829 3300003856 Bacteria 1615
24 Ga0058692_1016836 3300003856 Bacteria 1615
25 Ga0065704_10000015 3300005289 Bacteria 105766
26 Ga0065704_10000267 3300005289 Bacteria 81463
27 Ga0065704_10002126 3300005289 Bacteria 5808
28 Ga0065704_10003217 3300005289 Bacteria 6380
29 Ga0065704_10078988 3300005289 Bacteria 4277
30 Ga0065704_10095018 3300005289 Bacteria 2503
31 Ga0065704_10183575 3300005289 Bacteria 1225
32 Ga0070668_100000380 3300005347 Bacteria 29310
33 Ga0070665_100002112 3300005548 Bacteria 22207
34 Ga0070665_100613136 3300005548 Bacteria 1101
35 Ga0068857_100004106 3300005577 Bacteria 12270
36 Ga0075364_10004782 3300006051 Bacteria 7832
37 Ga0075364_10031201 3300006051 Bacteria 3423
38 Ga0075364_10082350 3300006051 Bacteria 2129
39 Ga0075364_10121980 3300006051 Bacteria 1745
40 Ga0075366_10006968 3300006195 Bacteria 6224
41 Ga0075436_100224309 3300006914 Bacteria 1334
42 Ga0075436_100378355 3300006914 Unclassified 1023
43 Ga0079104_1000021 3300006946 Bacteria 247219
44 Ga0079104_1000030 3300006946 Bacteria 207526
45 Ga0079104_1000649 3300006946 Bacteria 33539
46 Ga0079104_1000800 3300006946 Bacteria 26572
47 Ga0079104_1000849 3300006946 Bacteria 25404
48 Ga0079104_1001986 3300006946 Bacteria 11997
49 Ga0079104_1006913 3300006946 Bacteria 4196
50 Ga0079104_1006961 3300006946 Bacteria 4173
51 Ga0079104_1014003 3300006946 Bacteria 2441
52 Ga0079104_1027844 3300006946 Bacteria 1443
53 Ga0105251_10000116 3300009011 Bacteria 79645
54 Ga0105251_10001825 3300009011 Bacteria 17590
55 Ga0105251_10002028 3300009011 Bacteria 16430
56 Ga0105251_10002948 3300009011 Bacteria 12754
57 Ga0105251_10003004 3300009011 Bacteria 12591
58 Ga0105251_10004341 3300009011 Bacteria 9702
59 Ga0105251_10004962 3300009011 Bacteria 8851
60 Ga0105251_10008236 3300009011 Bacteria 6300
61 Ga0105251_10009180 3300009011 Bacteria 5870
62 Ga0105251_10014615 3300009011 Bacteria 4329
63 Ga0105251_10029558 3300009011 Bacteria 2760
64 Ga0105251_10095272 3300009011 Bacteria 1364
65 Ga0105251_10117901 3300009011 Bacteria 1206
66 Ga0105251_10142517 3300009011 Bacteria 1084
67 Ga0105244_10000015 3300009036 Bacteria 256814
68 Ga0105244_10000028 3300009036 Bacteria 201928
69 Ga0105244_10000070 3300009036 Bacteria 119389
70 Ga0105244_10000173 3300009036 Bacteria 65370
71 Ga0105244_10000321 3300009036 Bacteria 45946
72 Ga0105244_10000898 3300009036 Bacteria 25131
73 Ga0105244_10001228 3300009036 Bacteria 21024
74 Ga0105244_10001647 3300009036 Bacteria 17682
75 Ga0105244_10006584 3300009036 Bacteria 7491
76 Ga0105244_10006638 3300009036 Bacteria 7453
77 Ga0105244_10022029 3300009036 Bacteria 3513
78 Ga0105244_10045052 3300009036 Bacteria 2270
79 Ga0105244_10062851 3300009036 Bacteria 1865
80 Ga0105244_10069519 3300009036 Bacteria 1758
81 Ga0105244_10091614 3300009036 Bacteria 1494
82 Ga0105244_10176573 3300009036 Bacteria 1014
83 Ga0105244_10181651 3300009036 Bacteria 997
84 Ga0105250_10000001 3300009092 Bacteria 617357
85 Ga0105250_10000060 3300009092 Bacteria 106781
86 Ga0105250_10000070 3300009092 Bacteria 96227
87 Ga0105250_10000455 3300009092 Bacteria 29419
88 Ga0105250_10000770 3300009092 Bacteria 19414
89 Ga0105250_10000856 3300009092 Bacteria 17965
90 Ga0105250_10001707 3300009092 Bacteria 11611
91 Ga0105250_10002900 3300009092 Bacteria 8378
92 Ga0105250_10012964 3300009092 Bacteria 3431
93 Ga0105250_10063455 3300009092 Bacteria 1487
94 Ga0105247_10000012 3300009101 Bacteria 292188
95 Ga0105243_10095834 3300009148 Bacteria 2453
96 Ga0105243_10455698 3300009148 Bacteria 1201
97 Ga0105241_10000002 3300009174 Bacteria 869480
98 Ga0105237_10087214 3300009545 Bacteria 3110
99 Ga0105246_10435865 3300011119 Bacteria 1097
100 Ga0105246_10811352 3300011119 Bacteria 831
101 Ga0157373_10000504 3300013100 Bacteria 30735
102 Ga0157373_10011372 3300013100 Bacteria 6545
103 Ga0157373_10028424 3300013100 Bacteria 4033
104 Ga0157373_10030456 3300013100 Bacteria 3884
105 Ga0157373_10054554 3300013100 Bacteria 2839
106 Ga0157373_10093095 3300013100 Bacteria 2123
107 Ga0157371_10000061 3300013102 Bacteria 170142
108 Ga0157371_10000424 3300013102 Bacteria 51829
109 Ga0157371_10001362 3300013102 Bacteria 25641
110 Ga0157371_10039095 3300013102 Bacteria 3393
111 Ga0157371_10044447 3300013102 Bacteria 3162
112 Ga0157371_10064983 3300013102 Bacteria 2584
113 Ga0157371_10154226 3300013102 Bacteria 1639
114 Ga0157370_10000254 3300013104 Bacteria 67990
115 Ga0157370_10002814 3300013104 Bacteria 20787
116 Ga0157370_10003986 3300013104 Bacteria 17166
117 Ga0157370_10628438 3300013104 Bacteria 982
118 Ga0157369_10006092 3300013105 Bacteria 13999
119 Ga0157369_10013883 3300013105 Bacteria 9099
120 Ga0157369_10308262 3300013105 Bacteria 1646
121 Ga0157369_10332022 3300013105 Bacteria 1580
122 Ga0163162_10012432 3300013306 Bacteria 8315
123 Ga0163162_10514053 3300013306 Bacteria 1327
124 Ga0163162_10535350 3300013306 Bacteria 1300
125 Ga0157372_10007319 3300013307 Bacteria 11749
126 Ga0157372_10015985 3300013307 Bacteria 8050
127 Ga0157372_10018487 3300013307 Bacteria 7493
128 Ga0157372_10128537 3300013307 Bacteria 2914
129 Ga0157372_10133713 3300013307 Bacteria 2855
130 Ga0157372_10305748 3300013307 Bacteria 1850
131 Ga0157372_10428395 3300013307 Bacteria 1542
132 Ga0182008_10001533 3300014497 Bacteria 15379
133 Ga0182008_10199004 3300014497 Bacteria 1019
134 Ga0182006_1000051 3300015261 Bacteria 183089
135 Ga0182006_1014597 3300015261 Bacteria 3382
136 Ga0183366_1001 3300015679 Bacteria 2743932
137 Ga0183370_1001 3300015680 Bacteria 2743932
138 Ga0183369_1001 3300015685 Bacteria 2743932
139 Ga0183368_1001 3300015687 Bacteria 2743932
140 Ga0163161_10000001 3300017792 Bacteria 2041488
141 Ga0163161_10001963 3300017792 Bacteria 14943
142 Ga0163161_10173179 3300017792 Bacteria 1651
143 Ga0213876_10000069 3300021384 Bacteria 125594
144 Ga0209760_100073 3300025207 Bacteria 81377
145 Ga0209784_100001 3300025224 Bacteria 3600592
146 Ga0209566_100001 3300025225 Bacteria 3600765
147 Ga0209674_100002 3300025226 Bacteria 3600592
148 Ga0209563_100002 3300025230 Bacteria 2045675
149 Ga0207427_100032 3300025231 Bacteria 349939
150 Ga0209437_100001 3300025233 Bacteria 2045675
151 Ga0209437_100073 3300025233 Bacteria 302948
152 Ga0209677_100002 3300025253 Bacteria 2045675
153 Ga0209129_1000004 3300025258 Bacteria 884499
154 Ga0209233_1000789 3300025261 Bacteria 14248
155 Ga0207696_1000001 3300025711 Bacteria 2579611
156 Ga0207696_1000028 3300025711 Bacteria 400424
157 Ga0207696_1000038 3300025711 Bacteria 328221
158 Ga0207696_1000190 3300025711 Bacteria 95127
159 Ga0207696_1000280 3300025711 Bacteria 60106
160 Ga0207696_1000520 3300025711 Bacteria 31938
161 Ga0207696_1000579 3300025711 Bacteria 28553
162 Ga0207696_1000735 3300025711 Bacteria 21903
163 Ga0207696_1002222 3300025711 Bacteria 9693
164 Ga0207696_1019801 3300025711 Bacteria 2181
165 Ga0207696_1032167 3300025711 Bacteria 1582
166 Ga0207655_1000001 3300025728 Bacteria 1866413
167 Ga0207655_1000002 3300025728 Bacteria 1148694
168 Ga0207655_1000007 3300025728 Bacteria 773492
169 Ga0207655_1000061 3300025728 Bacteria 258893
170 Ga0207655_1000091 3300025728 Bacteria 203263
171 Ga0207655_1000110 3300025728 Bacteria 171137
172 Ga0207655_1000168 3300025728 Bacteria 119343
173 Ga0207655_1000343 3300025728 Bacteria 67627
174 Ga0207655_1001840 3300025728 Bacteria 18349
175 Ga0207655_1002042 3300025728 Bacteria 17063
176 Ga0207655_1003199 3300025728 Bacteria 12320
177 Ga0207655_1004038 3300025728 Bacteria 10572
178 Ga0207655_1004854 3300025728 Bacteria 9339
179 Ga0207655_1011041 3300025728 Bacteria 5416
180 Ga0207713_1000001 3300025735 Bacteria 2295391
181 Ga0207713_1000002 3300025735 Bacteria 1061749
182 Ga0207713_1000004 3300025735 Bacteria 702781
183 Ga0207713_1000008 3300025735 Bacteria 553952
184 Ga0207713_1000035 3300025735 Bacteria 263228
185 Ga0207713_1000039 3300025735 Bacteria 247140
186 Ga0207713_1003855 3300025735 Bacteria 10010
187 Ga0207713_1011670 3300025735 Bacteria 4757
188 Ga0207713_1015218 3300025735 Bacteria 3959
189 Ga0207713_1017789 3300025735 Bacteria 3543
190 Ga0207713_1069120 3300025735 Bacteria 1310
191 Ga0207710_10000354 3300025900 Bacteria 32964
192 Ga0207654_10000005 3300025911 Bacteria 869492
193 Ga0207709_10610450 3300025935 Bacteria 865
194 Ga0207668_10010321 3300025972 Bacteria 5642
195 Ga0207674_10009629 3300026116 Bacteria 11021
196 Ga0209281_1000001 3300027111 Bacteria 1933496
197 Ga0209281_1000003 3300027111 Bacteria 1260089
198 Ga0209281_1000004 3300027111 Bacteria 1253949
199 Ga0209281_1000006 3300027111 Bacteria 1170244
200 Ga0209281_1000012 3300027111 Bacteria 684886
201 Ga0209281_1000024 3300027111 Bacteria 499062
202 Ga0209281_1000124 3300027111 Bacteria 202831
203 Ga0209281_1000616 3300027111 Bacteria 40110
204 Ga0209281_1000680 3300027111 Bacteria 35553
205 Ga0209281_1001084 3300027111 Bacteria 20073
206 Ga0209281_1002491 3300027111 Bacteria 7280
207 Ga0209371_1000001 3300027312 Bacteria 2771503
208 Ga0209371_1000002 3300027312 Bacteria 1551985
209 Ga0209371_1000005 3300027312 Bacteria 1061740
210 Ga0209371_1000039 3300027312 Bacteria 350081
211 Ga0209371_1000060 3300027312 Bacteria 235042
212 Ga0209371_1000110 3300027312 Bacteria 141059
213 Ga0209371_1000157 3300027312 Bacteria 106573
214 Ga0209371_1000455 3300027312 Bacteria 40435
215 Ga0209371_1001035 3300027312 Bacteria 21040
216 Ga0209371_1001336 3300027312 Bacteria 17146
217 Ga0209371_1001747 3300027312 Bacteria 13699
218 Ga0209371_1001871 3300027312 Bacteria 12930
219 Ga0209371_1004317 3300027312 Bacteria 6280
220 Ga0209371_1004354 3300027312 Bacteria 6222
221 Ga0209371_1005891 3300027312 Bacteria 4714
222 Ga0209371_1008756 3300027312 Bacteria 3311
223 Ga0209371_1016326 3300027312 Bacteria 1963
224 Ga0209371_1018417 3300027312 Bacteria 1776
225 Ga0209371_1018666 3300027312 Bacteria 1754
226 Ga0209371_1022847 3300027312 Bacteria 1486
227 Ga0209371_1043546 3300027312 Bacteria 897
228 Ga0268266_10006659 3300028379 Bacteria 10543
229 Ga0268256_1000001 3300030500 Bacteria 2771065
230 Ga0268256_1000002 3300030500 Bacteria 1535763
231 Ga0268256_1000006 3300030500 Bacteria 1063991
232 Ga0268256_1000033 3300030500 Bacteria 420973
233 Ga0268256_1000084 3300030500 Bacteria 164658
234 Ga0268256_1000280 3300030500 Bacteria 52883
235 Ga0268256_1000870 3300030500 Bacteria 21040
236 Ga0268256_1000979 3300030500 Bacteria 19418
237 Ga0268256_1001145 3300030500 Bacteria 17146
238 Ga0268256_1001523 3300030500 Bacteria 13699
239 Ga0268256_1004103 3300030500 Bacteria 6223
240 Ga0268256_1006264 3300030500 Bacteria 4460
241 Ga0268256_1008895 3300030500 Bacteria 3394
242 Ga0268256_1009199 3300030500 Bacteria 3311
243 Ga0268256_1014188 3300030500 Bacteria 2378
244 Ga0268256_1018142 3300030500 Bacteria 1963
245 Ga0268256_1018954 3300030500 Bacteria 1896
246 Ga0268256_1020575 3300030500 Bacteria 1776
247 Ga0268256_1025337 3300030500 Bacteria 1508
248 Ga0268256_1042089 3300030500 Bacteria 1016
249 Ga0265330_10014137 3300031235 Bacteria 3706
250 Ga0265331_10008630 3300031250 Bacteria 5778
251 Ga0316575_10000441 3300031665 Bacteria 11845
252 Ga0316579_10000053 3300031691 Bacteria 27868
253 Ga0316579_10144465 3300031691 Bacteria 1147
254 Ga0316576_10000471 3300031727 Bacteria 18895
255 Ga0316576_10002152 3300031727 Bacteria 11102
256 Ga0316576_10007398 3300031727 Bacteria 6914
257 Ga0316576_10051496 3300031727 Bacteria 2997
258 Ga0316578_10001447 3300031728 Bacteria 9646
259 Ga0316578_10002742 3300031728 Bacteria 7834
260 Ga0316578_10019705 3300031728 Bacteria 3718
261 Ga0316577_10000771 3300031733 Bacteria 13789
262 Ga0316577_10045541 3300031733 Bacteria 2451
263 Ga0316585_10000244 3300032137 Bacteria 11585
264 Ga0316580_10000011 3300032139 Bacteria 29061
265 Ga0316580_10121717 3300032139 Bacteria 799
266 Ga0316593_10016166 3300032168 Bacteria 2258
267 Ga0316592_1007057 3300033524 Bacteria 2182
268 Ga0316592_1024344 3300033524 Bacteria 1302
269 Ga0316588_1012500 3300033528 Bacteria 1831
270 Ga0316587_1036367 3300033529 Bacteria 882
271 Ga0316596_1020038 3300033541 Bacteria 1700
272 Ga0316596_1028931 3300033541 Bacteria 1433
273 Ga0316582_0000761 3300036647 Bacteria 12967
274 Ga0316582_0072845 3300036647 Bacteria 2228
275 Ga0316584_0016798 3300036712 Bacteria 5250
276 Ga0316584_0028751 3300036712 Bacteria 4102
277 Ga0316584_0140218 3300036712 Bacteria 1803
278 Ga0400483_240478 3300039062 Bacteria 5467
279 Ga0436365_0368505 3300039437 Bacteria 454216
280 Ga0436360_0825266 3300039438 Bacteria 1332
281 Ga0436360_1342071 3300039438 Bacteria 2788
282 Ga0436362_0702670 3300039453 Bacteria 3277
283 Ga0439438_000001 3300041405 Bacteria 1263568
284 Ga0439438_001732 3300041405 Bacteria 9598
285 Ga0439438_002808 3300041405 Bacteria 7280
286 Ga0439438_046865 3300041405 Bacteria 1109
287 Ga0439438_069501 3300041405 Bacteria 873
288 Ga0439447_006450 3300041407 Bacteria 3809
289 Ga0439447_008540 3300041407 Bacteria 3166
290 Ga0439447_015611 3300041407 Bacteria 2104
291 Ga0439466_0000191 3300041411 Bacteria 24528
292 Ga0451853_1618359 3300041512 Bacteria 5575
293 Ga0439432_003559 3300042006 Bacteria 5764
294 Ga0439432_004687 3300042006 Bacteria 4983
295 Ga0439432_006030 3300042006 Bacteria 4349
296 Ga0439432_006564 3300042006 Bacteria 4148
297 Ga0439432_051484 3300042006 Bacteria 1283
298 Ga0439452_000001 3300042010 Bacteria 1725439
299 Ga0439452_000002 3300042010 Bacteria 1377577
300 Ga0439452_000016 3300042010 Bacteria 338131
301 Ga0439452_000025 3300042010 Bacteria 228862
302 Ga0439452_001935 3300042010 Bacteria 7926
303 Ga0439452_006079 3300042010 Bacteria 3813
304 Ga0450902_028098 3300042137 Bacteria 944
305 Ga0450907_000581 3300042146 Bacteria 9839
306 Ga0439464_0000106 3300042439 Bacteria 12680
307 Ga0439464_0035960 3300042439 Bacteria 1400
308 Ga0466981_0000007 3300044669 Bacteria 155983
309 Ga0495627_000122 3300046453 Bacteria 95389
310 Ga0495591_000003 3300046458 Bacteria 449825
311 Ga0495591_000007 3300046458 Bacteria 366385
312 Ga0495591_002756 3300046458 Bacteria 9488
313 Ga0495591_003841 3300046458 Bacteria 7591
314 Ga0495650_0000005 3300046471 Bacteria 766553
315 Ga0495650_0000026 3300046471 Bacteria 476029
316 Ga0495650_0000126 3300046471 Bacteria 178143
317 Ga0495650_0007292 3300046471 Bacteria 6684
318 Ga0495605_0028484 3300046474 Bacteria 2882
319 Ga0495584_0024791 3300046491 Bacteria 3041
320 Ga0495585_0023029 3300046492 Bacteria 3574
321 Ga0495596_0028838 3300046500 Bacteria 2226
322 Ga0495607_0013647 3300046501 Bacteria 5315
323 Ga0495606_0006343 3300046507 Bacteria 10941
324 Ga0495616_0009541 3300046513 Bacteria 5667
325 Ga0495620_0013940 3300046515 Bacteria 4101
326 Ga0495632_0200684 3300046519 Bacteria 908
327 Ga0495643_0044341 3300046522 Bacteria 2417
328 Ga0495643_0220065 3300046522 Bacteria 901
329 Ga0495644_0019392 3300046523 Bacteria 2597
330 Ga0495648_0017403 3300046524 Bacteria 5137
331 Ga0495654_0000007 3300046530 Bacteria 403529
332 Ga0495654_0000136 3300046530 Bacteria 76653
333 Ga0495654_0001577 3300046530 Bacteria 15472
334 Ga0495654_0005868 3300046530 Bacteria 7064
335 Ga0495654_0110705 3300046530 Bacteria 1253
336 Ga0495597_0000925 3300046542 Bacteria 22776
337 Ga0495597_0003478 3300046542 Bacteria 9147
338 Ga0495625_0003517 3300046660 Bacteria 15510
339 Ga0495588_0013277 3300046674 Bacteria 3922
340 Ga0495588_0016021 3300046674 Bacteria 3617
341 Ga0495671_0007381 3300046692 Bacteria 6272
342 Ga0495671_0051391 3300046692 Bacteria 2050
343 Ga0495649_0002406 3300046694 Bacteria 13200
344 Ga0495649_0021288 3300046694 Bacteria 3633
345 Ga0495649_0028410 3300046694 Bacteria 3100
346 Ga0495649_0082049 3300046694 Bacteria 1723
347 Ga0495589_0000001 3300046794 Bacteria 888100
348 Ga0495589_0042863 3300046794 Bacteria 2254
349 Ga0495660_0000014 3300046810 Bacteria 337328
350 Ga0495660_0000016 3300046810 Bacteria 321859
351 Ga0495660_0004742 3300046810 Bacteria 8209
352 Ga0495672_0000001 3300047320 Bacteria 1458820
353 Ga0495672_0000015 3300047320 Bacteria 502855
354 Ga0495683_0026332 3300047323 Bacteria 2976
355 Ga0495679_000005 3300047446 Bacteria 455007
356 Ga0495679_004572 3300047446 Bacteria 6323
357 Ga0495679_024612 3300047446 Bacteria 2025
358 Ga0495679_032686 3300047446 Bacteria 1666
359 Ga0495673_0000007 3300047469 Bacteria 796722
360 Ga0495673_0000669 3300047469 Bacteria 33746
361 Ga0495681_0005952 3300047470 Bacteria 8090
362 Ga0495681_0009508 3300047470 Bacteria 5981
363 Ga0495681_0251040 3300047470 Bacteria 698
364 Ga0496100_0004926 3300048903 Bacteria 7135
365 Ga0496100_0016946 3300048903 Bacteria 4289
366 Ga0496100_0121470 3300048903 Bacteria 1828
367 Ga0496101_0000058 3300048904 Bacteria 131047
368 Ga0496101_0105566 3300048904 Bacteria 2114
369 Ga0496101_0705542 3300048904 Bacteria 796
370 Ga0496102_0001157 3300048905 Bacteria 24094
371 Ga0496102_0747580 3300048905 Bacteria 901
372 Ga0496104_0000472 3300048907 Bacteria 34674
373 Ga0496104_0000944 3300048907 Bacteria 24982
374 Ga0496104_0160979 3300048907 Bacteria 2153
375 Ga0496104_0691048 3300048907 Bacteria 928
376 Ga0496104_0729163 3300048907 Bacteria 898
377 Ga0496105_0007725 3300048908 Bacteria 8343
378 Ga0496105_0015763 3300048908 Bacteria 6030
379 Ga0496106_0156525 3300048909 Bacteria 1800
380 Ga0496110_0418714 3300048913 Bacteria 1221
381 Ga0496111_0522039 3300048914 Bacteria 873
382 Ga0496116_0000001 3300048919 Bacteria 1501681
383 Ga0496116_0000048 3300048919 Bacteria 314562
384 Ga0496116_0000086 3300048919 Bacteria 217597
385 Ga0496116_0000087 3300048919 Bacteria 217284
386 Ga0496116_0000347 3300048919 Bacteria 73563
387 Ga0496116_0010868 3300048919 Bacteria 7590
388 Ga0496116_0027309 3300048919 Bacteria 4157
389 Ga0496116_0038010 3300048919 Bacteria 3348
390 Ga0496116_0047869 3300048919 Bacteria 2874
391 Ga0496116_0079099 3300048919 Bacteria 2047
392 Ga0496116_0101663 3300048919 Bacteria 1715
393 Ga0496117_0000022 3300048920 Bacteria 439512
394 Ga0496117_0000058 3300048920 Bacteria 264132
395 Ga0496117_0001297 3300048920 Bacteria 36808
396 Ga0496117_0002199 3300048920 Bacteria 25311
397 Ga0496117_0002670 3300048920 Bacteria 22066
398 Ga0496117_0008253 3300048920 Bacteria 9924
399 Ga0496117_0012234 3300048920 Bacteria 7588
400 Ga0496117_0017464 3300048920 Bacteria 5990
401 Ga0496117_0019157 3300048920 Bacteria 5631
402 Ga0496117_0025019 3300048920 Bacteria 4703
403 Ga0496117_0026047 3300048920 Bacteria 4583
404 Ga0496117_0045816 3300048920 Bacteria 3153
405 Ga0496117_0212079 3300048920 Bacteria 1085
406 Ga0496117_0223914 3300048920 Bacteria 1044
407 Ga0496118_0000007 3300048921 Bacteria 650986
408 Ga0496118_0000328 3300048921 Bacteria 81811
409 Ga0496118_0001170 3300048921 Bacteria 40478
410 Ga0496118_0002772 3300048921 Bacteria 22949
411 Ga0496118_0004411 3300048921 Bacteria 16711
412 Ga0496118_0012515 3300048921 Bacteria 8135
413 Ga0496118_0024072 3300048921 Bacteria 5267
414 Ga0496118_0050806 3300048921 Bacteria 3177
415 Ga0496118_0050946 3300048921 Bacteria 3171
416 Ga0496118_0081193 3300048921 Bacteria 2277
417 Ga0496118_0111225 3300048921 Bacteria 1816
418 Ga0496118_0202558 3300048921 Bacteria 1174
419 Ga0496118_0210751 3300048921 Bacteria 1140
420 Ga0496118_0337029 3300048921 Bacteria 810
421 Ga0496119_0000018 3300048922 Bacteria 306476
422 Ga0496119_0000089 3300048922 Bacteria 134344
423 Ga0496119_0003158 3300048922 Bacteria 17306
424 Ga0496119_0003931 3300048922 Bacteria 15070
425 Ga0496119_0005203 3300048922 Bacteria 12567
426 Ga0496119_0009326 3300048922 Bacteria 8442
427 Ga0496119_0010807 3300048922 Bacteria 7639
428 Ga0496119_0023269 3300048922 Bacteria 4403
429 Ga0496119_0047870 3300048922 Bacteria 2656
430 Ga0496119_0065865 3300048922 Bacteria 2143
431 Ga0496119_0066723 3300048922 Bacteria 2124
432 Ga0496119_0066941 3300048922 Bacteria 2120
433 Ga0496119_0070868 3300048922 Bacteria 2042
434 Ga0496119_0071024 3300048922 Bacteria 2040
435 Ga0496119_0318943 3300048922 Bacteria 761
436 Ga0496119_0412391 3300048922 Bacteria 642
437 Ga0496120_0000002 3300048923 Bacteria 547999
438 Ga0496120_0000091 3300048923 Bacteria 149829
439 Ga0496120_0000117 3300048923 Bacteria 134343
440 Ga0496120_0000601 3300048923 Bacteria 54492
441 Ga0496120_0000848 3300048923 Bacteria 43392
442 Ga0496120_0000957 3300048923 Bacteria 39360
443 Ga0496120_0001288 3300048923 Bacteria 31240
444 Ga0496120_0002505 3300048923 Bacteria 18407
445 Ga0496120_0003932 3300048923 Bacteria 12953
446 Ga0496120_0005988 3300048923 Bacteria 9472
447 Ga0496120_0006739 3300048923 Bacteria 8727
448 Ga0496120_0007512 3300048923 Bacteria 8092
449 Ga0496120_0018777 3300048923 Bacteria 4442
450 Ga0496120_0025172 3300048923 Bacteria 3698
451 Ga0496120_0047891 3300048923 Bacteria 2462
452 Ga0496120_0063197 3300048923 Bacteria 2060
453 Ga0496120_0074205 3300048923 Bacteria 1859
454 Ga0496120_0094906 3300048923 Bacteria 1586
455 Ga0496120_0114136 3300048923 Bacteria 1406
456 Ga0496120_0119781 3300048923 Bacteria 1362
457 Ga0496121_0000103 3300048924 Bacteria 194818
458 Ga0496121_0007765 3300048924 Bacteria 12846
459 Ga0496121_0010274 3300048924 Bacteria 10589
460 Ga0496121_0012064 3300048924 Bacteria 9494
461 Ga0496121_0030111 3300048924 Bacteria 4994
462 Ga0496121_0038541 3300048924 Bacteria 4228
463 Ga0496121_0111667 3300048924 Bacteria 2083
464 Ga0496121_0171952 3300048924 Bacteria 1572
465 Ga0496121_0349878 3300048924 Bacteria 984
466 Ga0496122_0000005 3300048925 Bacteria 630659
467 Ga0496122_0000086 3300048925 Bacteria 207993
468 Ga0496122_0002471 3300048925 Bacteria 26132
469 Ga0496122_0004821 3300048925 Bacteria 16444
470 Ga0496122_0005036 3300048925 Bacteria 15977
471 Ga0496122_0007494 3300048925 Bacteria 12107
472 Ga0496122_0011051 3300048925 Bacteria 9215
473 Ga0496122_0018882 3300048925 Bacteria 6335
474 Ga0496122_0025961 3300048925 Bacteria 5070
475 Ga0496122_0039036 3300048925 Bacteria 3792
476 Ga0496122_0042214 3300048925 Bacteria 3591
477 Ga0496122_0068973 3300048925 Bacteria 2535
478 Ga0496123_0000008 3300048926 Bacteria 630628
479 Ga0496123_0000014 3300048926 Bacteria 433465
480 Ga0496123_0000021 3300048926 Bacteria 378760
481 Ga0496123_0001457 3300048926 Bacteria 32945
482 Ga0496123_0001960 3300048926 Bacteria 26730
483 Ga0496123_0004786 3300048926 Bacteria 13967
484 Ga0496123_0015181 3300048926 Bacteria 6335
485 Ga0496123_0015662 3300048926 Bacteria 6204
486 Ga0496123_0033893 3300048926 Bacteria 3667
487 Ga0496123_0057221 3300048926 Bacteria 2540
488 Ga0496123_0137907 3300048926 Bacteria 1339
489 Ga0496123_0138746 3300048926 Bacteria 1333
490 Ga0496123_0155296 3300048926 Bacteria 1228
491 Ga0496123_0335409 3300048926 Bacteria 708
492 Ga0496124_0000008 3300048927 Bacteria 864372
493 Ga0496124_0000059 3300048927 Bacteria 241949
494 Ga0496124_0000092 3300048927 Bacteria 189213
495 Ga0496124_0000208 3300048927 Bacteria 115312
496 Ga0496124_0000688 3300048927 Bacteria 55683
497 Ga0496124_0001592 3300048927 Bacteria 32679
498 Ga0496124_0002242 3300048927 Bacteria 25715
499 Ga0496124_0008298 3300048927 Bacteria 10878
500 Ga0496124_0009694 3300048927 Bacteria 9858
501 Ga0496124_0015431 3300048927 Bacteria 7322
502 Ga0496124_0021326 3300048927 Bacteria 5969
503 Ga0496124_0032010 3300048927 Bacteria 4652
504 Ga0496124_0037930 3300048927 Bacteria 4186
505 Ga0496124_0080630 3300048927 Bacteria 2677
506 Ga0496124_0086542 3300048927 Bacteria 2564
507 Ga0496124_0090781 3300048927 Bacteria 2490
508 Ga0496124_0098538 3300048927 Bacteria 2371
509 Ga0496124_0133316 3300048927 Bacteria 1970
510 Ga0496124_0258094 3300048927 Bacteria 1284
511 Ga0496125_0000009 3300048928 Bacteria 677678
512 Ga0496125_0000064 3300048928 Bacteria 250104
513 Ga0496125_0014971 3300048928 Bacteria 7530
514 Ga0496125_0079199 3300048928 Bacteria 2522
515 Ga0496125_0095509 3300048928 Bacteria 2211
516 Ga0496125_0408292 3300048928 Bacteria 791
517 Ga0496126_0000229 3300048929 Bacteria 120333
518 Ga0496126_0000825 3300048929 Bacteria 55137
519 Ga0496126_0001518 3300048929 Bacteria 35794
520 Ga0496126_0029527 3300048929 Bacteria 5208
521 Ga0496126_0054713 3300048929 Bacteria 3613
522 Ga0496126_0074757 3300048929 Bacteria 3008
523 Ga0496126_0245274 3300048929 Bacteria 1494
524 Ga0496126_0260708 3300048929 Bacteria 1441
525 Ga0496126_0342731 3300048929 Bacteria 1224
526 Ga0496126_0434544 3300048929 Bacteria 1059
527 Ga0496126_0444474 3300048929 Bacteria 1044
528 Ga0496126_0764726 3300048929 Bacteria 744
529 Ga0495678_000512 3300049459 Bacteria 37765
530 Ga0495682_0000001 3300049460 Bacteria 1559116
531 nmdc:mga00v17_15663_c1 3300050491 Bacteria 4259
532 nmdc:mga00v17_24906_c1 3300050491 Bacteria 3473
533 nmdc:mga00v17_44828_c1 3300050491 Bacteria 2669
534 nmdc:mga00v17_71192_c1 3300050491 Bacteria 2155
535 nmdc:mga0k408_3445_c1 3300050493 Bacteria 8377
536 nmdc:mga08x19_207581_c1 3300050514 Bacteria 1344
537 nmdc:mga08x19_522065_c1 3300050514 Bacteria 839
538 Ga0500621_000002 3300053126 Bacteria 849473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0825266 Ga0436360_0825266_870_1316 144
2 3300031727 Ga0316576_10051496 Ga0316576_100514962 165
3 3300033529 Ga0316587_1036367 Ga0316587_10363672 165
4 3300009036 Ga0105244_10006584 Ga0105244_100065844 170
5 3300025728 Ga0207655_1011041 Ga0207655_10110414 170
6 3300009036 Ga0105244_10001228 Ga0105244_100012288 174
7 3300009092 Ga0105250_10001707 Ga0105250_1000170710 174
8 3300025711 Ga0207696_1000520 Ga0207696_100052015 174
9 3300025728 Ga0207655_1002042 Ga0207655_10020425 174
10 3300031727 Ga0316576_10002152 Ga0316576_1000215213 174
11 3300031728 Ga0316578_10001447 Ga0316578_100014474 174
12 3300036647 Ga0316582_0000761 Ga0316582_0000761_6151_6717 174
13 3300036712 Ga0316584_0016798 Ga0316584_0016798_3112_3678 174
14 3300046542 Ga0495597_0000925 Ga0495597_0000925_14231_14833 174
15 3300046674 Ga0495588_0016021 Ga0495588_0016021_49_651 174
16 3300047470 Ga0495681_0251040 Ga0495681_0251040_69_671 174
17 3300050491 nmdc:mga00v17_24906_c1 nmdc:mga00v17_24906_c1_1952_2554 174
18 3300006914 Ga0075436_100224309 Ga0075436_1002243093 176
19 3300039438 Ga0436360_1342071 Ga0436360_1342071_78_620 176
20 3300039453 Ga0436362_0702670 Ga0436362_0702670_821_1363 176
21 3300050514 nmdc:mga08x19_207581_c1 nmdc:mga08x19_207581_c1_700_1242 176
22 3300050514 nmdc:mga08x19_522065_c1 nmdc:mga08x19_522065_c1_79_621 176
23 iso_pu_bacteria 2511231025 2511380795 176
24 iso_pu_bacteria 2511231035 2511437031 176
25 iso_pu_bacteria 2876601092 2876604031 176
26 iso_pu_bacteria 2939602548 2939603164 176
27 iso_pu_bacteria 8016733728 8016735716 176
28 iso_pu_bacteria 8019499862 8019500886 176
29 3300009092 Ga0105250_10000455 Ga0105250_1000045526 177
30 3300025711 Ga0207696_1000579 Ga0207696_100057926 177
31 3300046530 Ga0495654_0005868 Ga0495654_0005868_640_1230 177
32 3300046542 Ga0495597_0003478 Ga0495597_0003478_7304_7894 177
33 3300046660 Ga0495625_0003517 Ga0495625_0003517_6679_7269 177
34 3300046674 Ga0495588_0013277 Ga0495588_0013277_1245_1835 177
35 3300047446 Ga0495679_000005 Ga0495679_000005_95791_96381 177
36 3300047470 Ga0495681_0009508 Ga0495681_0009508_958_1548 177
37 iso_pu_bacteria 2506520007 2506578725 177
38 iso_pu_bacteria 2506520008 2506583864 177
39 iso_pu_bacteria 2508501071 2508852692 177
40 iso_pu_bacteria 2537561728 2538424820 177
41 iso_pu_bacteria 2547132181 2547695824 177
42 iso_pu_bacteria 2547132416 2548649236 177
43 iso_pu_bacteria 2554235234 2555260186 177
44 iso_pu_bacteria 2561511199 2562462514 177
45 iso_pu_bacteria 2585427591 2585828286 177
46 iso_pu_bacteria 2585427592 2585833973 177
47 iso_pu_bacteria 2599185169 2599410845 177
48 iso_pu_bacteria 2599185299 2599925835 177
49 iso_pu_bacteria 2600255254 2601521640 177
50 iso_pu_bacteria 2600255255 2601526665 177
51 iso_pu_bacteria 2600255256 2601533699 177
52 iso_pu_bacteria 2600255257 2601539649 177
53 iso_pu_bacteria 2600255280 2601613495 177
54 iso_pu_bacteria 2600255281 2601622398 177
55 iso_pu_bacteria 2600255287 2601643091 177
56 iso_pu_bacteria 2600255288 2601650434 177
57 iso_pu_bacteria 2600255289 2601655723 177
58 iso_pu_bacteria 2600255290 2601656970 177
59 iso_pu_bacteria 2600255291 2601662912 177
60 iso_pu_bacteria 2600255298 2601695871 177
61 iso_pu_bacteria 2600255299 2601700545 177
62 iso_pu_bacteria 2600255300 2601704767 177
63 iso_pu_bacteria 2600255301 2601709796 177
64 iso_pu_bacteria 2600255302 2601714808 177
65 iso_pu_bacteria 2600255303 2601720896 177
66 iso_pu_bacteria 2600255304 2601725214 177
67 iso_pu_bacteria 2600255305 2601729756 177
68 iso_pu_bacteria 2600255306 2601734773 177
69 iso_pu_bacteria 2600255307 2601743795 177
70 iso_pu_bacteria 2600255309 2601754287 177
71 iso_pu_bacteria 2600255310 2601757999 177
72 iso_pu_bacteria 2600255311 2601763750 177
73 iso_pu_bacteria 2600255392 2602021714 177
74 iso_pu_bacteria 2602042046 2603637627 177
75 iso_pu_bacteria 2602042047 2603642047 177
76 iso_pu_bacteria 2602042052 2603660287 177
77 iso_pu_bacteria 2602042053 2603665562 177
78 iso_pu_bacteria 2602042066 2603698769 177
79 iso_pu_bacteria 2602042067 2603702660 177
80 iso_pu_bacteria 2602042103 2603837128 177
81 iso_pu_bacteria 2602042104 2603842204 177
82 iso_pu_bacteria 2602042105 2603847277 177
83 iso_pu_bacteria 2602042106 2603852348 177
84 iso_pu_bacteria 2602042109 2603864449 177
85 iso_pu_bacteria 2602042110 2603870401 177
86 iso_pu_bacteria 2602042111 2603875411 177
87 iso_pu_bacteria 2603880178 2606047592 177
88 iso_pu_bacteria 2603880184 2606069993 177
89 iso_pu_bacteria 2603880202 2606145905 177
90 iso_pu_bacteria 2603880211 2606174993 177
91 iso_pu_bacteria 2608642108 2608669615 177
92 iso_pu_bacteria 2609459761 2609912417 177
93 iso_pu_bacteria 2636415599 2637225739 177
94 iso_pu_bacteria 2648501693 2650899166 177
95 iso_pu_bacteria 2654587920 2656279702 177
96 iso_pu_bacteria 2667528172 2671101824 177
97 iso_pu_bacteria 2667528173 2671110121 177
98 iso_pu_bacteria 2671180115 2671584711 177
99 iso_pu_bacteria 2675903046 2676408050 177
100 iso_pu_bacteria 2681812866 2681998439 177
101 iso_pu_bacteria 2681812869 2682005711 177
102 iso_pu_bacteria 2684622997 2686353553 177
103 iso_pu_bacteria 2687453601 2689445281 177
104 iso_pu_bacteria 2706794495 2707099099 177
105 iso_pu_bacteria 2711768156 2712469656 177
106 iso_pu_bacteria 2751185917 2753856300 177
107 iso_pu_bacteria 2765235842 2765589290 177
108 iso_pu_bacteria 2772190666 2772439245 177
109 iso_pu_bacteria 2775506706 2775539372 177
110 iso_pu_bacteria 2775507074 2777023588 177
111 iso_pu_bacteria 2791354903 2791921526 177
112 iso_pu_bacteria 2791355010 2792313204 177
113 iso_pu_bacteria 2791355275 2793405386 177
114 iso_pu_bacteria 2806310673 2807176641 177
115 iso_pu_bacteria 2808606414 2809125149 177
116 iso_pu_bacteria 2811995292 2813728671 177
117 iso_pu_bacteria 2814123068 2814696192 177
118 iso_pu_bacteria 2821118458 2821122654 177
119 iso_pu_bacteria 2823373977 2823375032 177
120 iso_pu_bacteria 2844425489 2844427818 177
121 iso_pu_bacteria 2844528606 2844531090 177
122 iso_pu_bacteria 2847085930 2847087455 177
123 iso_pu_bacteria 2847797336 2847799660 177
124 iso_pu_bacteria 2852103415 2852105818 177
125 iso_pu_bacteria 2854601825 2854604041 177
126 iso_pu_bacteria 2855195626 2855200176 177
127 iso_pu_bacteria 2858466076 2858468540 177
128 iso_pu_bacteria 2865014394 2865015462 177
129 iso_pu_bacteria 2869551831 2869554718 177
130 iso_pu_bacteria 2871272651 2871272864 177
131 iso_pu_bacteria 2871282230 2871284113 177
132 iso_pu_bacteria 2881609920 2881611963 177
133 iso_pu_bacteria 2884086401 2884089180 177
134 iso_pu_bacteria 2888366609 2888369303 177
135 iso_pu_bacteria 2888373701 2888378044 177
136 iso_pu_bacteria 2891670763 2891670952 177
137 iso_pu_bacteria 2900051742 2900051939 177
138 iso_pu_bacteria 2904474040 2904478985 177
139 iso_pu_bacteria 2904504865 2904504889 177
140 iso_pu_bacteria 2904513164 2904513407 177
141 iso_pu_bacteria 2908669403 2908669557 177
142 iso_pu_bacteria 2919108558 2919112161 177
143 iso_pu_bacteria 2919150387 2919155093 177
144 iso_pu_bacteria 2923634449 2923635234 177
145 iso_pu_bacteria 2927143783 2927148676 177
146 iso_pu_bacteria 2927833300 2927833772 177
147 iso_pu_bacteria 2935625433 2935626487 177
148 iso_pu_bacteria 2937539931 2937541357 177
149 iso_pu_bacteria 2937967321 2937967874 177
150 iso_pu_bacteria 2939568625 2939569385 177
151 iso_pu_bacteria 2939573065 2939573450 177
152 iso_pu_bacteria 2939607340 2939609234 177
153 iso_pu_bacteria 2939617950 2939621294 177
154 iso_pu_bacteria 2939642701 2939643571 177
155 iso_pu_bacteria 2945874760 2945877737 177
156 iso_pu_bacteria 2945951305 2945952787 177
157 iso_pu_bacteria 2969079654 2969082735 177
158 iso_pu_bacteria 2971820967 2971824073 177
159 iso_pu_bacteria 2974310843 2974311809 177
160 iso_pu_bacteria 2974435778 2974438605 177
161 iso_pu_bacteria 2978975091 2978979363 177
162 iso_pu_bacteria 2984494565 2984496840 177
163 iso_pu_bacteria 2984559226 2984559800 177
164 iso_pu_bacteria 2984595703 2984597881 177
165 iso_pu_bacteria 2990261002 2990262257 177
166 iso_pu_bacteria 3000376612 3000379300 177
167 iso_pu_bacteria 640753048 640938200 177
168 iso_pu_bacteria 8004592986 8004597108 177
169 iso_pu_bacteria 8015394850 8015396398 177
170 iso_pu_bacteria 8018221730 8018221767 177
171 iso_pu_bacteria 8018405270 8018407495 177
172 iso_pu_bacteria 8019504834 8019507999 177
173 iso_pu_bacteria 8054844752 8054846072 177
174 iso_pu_bacteria 8054849141 8054850680 177
175 iso_pu_bacteria 8055087960 8055090652 177
176 iso_pu_bacteria 8055092621 8055096693 177
177 iso_pu_bacteria 8055097453 8055098773 177
178 iso_pu_bacteria 8055693939 8055695630 177
179 iso_pu_bacteria 8055693939 8055696295 177
180 iso_pu_bacteria 8057304971 8057308876 177
181 iso_pu_bacteria 2846540461 2846545077 179
182 3300003856 Ga0058692_1000084 Ga0058692_100008425 180
183 3300003856 Ga0058692_1000137 Ga0058692_100013725 180
184 3300003856 Ga0058692_1008787 Ga0058692_10087875 180
185 3300009011 Ga0105251_10008236 Ga0105251_100082362 180
186 3300009036 Ga0105244_10000015 Ga0105244_1000001516 180
187 3300009036 Ga0105244_10000898 Ga0105244_1000089822 180
188 3300009036 Ga0105244_10091614 Ga0105244_100916142 180
189 3300009092 Ga0105250_10000060 Ga0105250_1000006069 180
190 3300009092 Ga0105250_10012964 Ga0105250_100129643 180
191 3300011119 Ga0105246_10811352 Ga0105246_108113522 180
192 3300013100 Ga0157373_10000504 Ga0157373_100005049 180
193 3300013102 Ga0157371_10000424 Ga0157371_100004246 180
194 3300013306 Ga0163162_10514053 Ga0163162_105140532 180
195 3300013307 Ga0157372_10015985 Ga0157372_100159852 180
196 3300013307 Ga0157372_10128537 Ga0157372_101285373 180
197 3300025711 Ga0207696_1000190 Ga0207696_100019056 180
198 3300025711 Ga0207696_1000280 Ga0207696_100028018 180
199 3300025728 Ga0207655_1000007 Ga0207655_100000752 180
200 3300025728 Ga0207655_1000061 Ga0207655_100006117 180
201 3300025735 Ga0207713_1015218 Ga0207713_10152185 180
202 3300027312 Ga0209371_1000039 Ga0209371_1000039100 180
203 3300027312 Ga0209371_1000455 Ga0209371_100045545 180
204 3300030500 Ga0268256_1000033 Ga0268256_1000033262 180
205 3300030500 Ga0268256_1006264 Ga0268256_10062643 180
206 3300046458 Ga0495591_000007 Ga0495591_000007_183251_183838 180
207 3300046530 Ga0495654_0000007 Ga0495654_0000007_220393_220980 180
208 3300048903 Ga0496100_0016946 Ga0496100_0016946_547_1134 180
209 3300048904 Ga0496101_0000058 Ga0496101_0000058_20653_21240 180
210 3300048904 Ga0496101_0705542 Ga0496101_0705542_27_614 180
211 3300048919 Ga0496116_0047869 Ga0496116_0047869_1134_1721 180
212 3300048922 Ga0496119_0023269 Ga0496119_0023269_2745_3332 180
213 3300048922 Ga0496119_0071024 Ga0496119_0071024_821_1408 180
214 3300048923 Ga0496120_0000601 Ga0496120_0000601_27512_28099 180
215 3300048923 Ga0496120_0000848 Ga0496120_0000848_13387_13974 180
216 3300048925 Ga0496122_0004821 Ga0496122_0004821_5360_5947 180
217 3300048926 Ga0496123_0001457 Ga0496123_0001457_31541_32128 180
218 3300048927 Ga0496124_0001592 Ga0496124_0001592_14740_15327 180
219 3300048927 Ga0496124_0015431 Ga0496124_0015431_485_1072 180
220 3300048927 Ga0496124_0032010 Ga0496124_0032010_3028_3618 180
221 3300048927 Ga0496124_0080630 Ga0496124_0080630_85_672 180
222 3300048929 Ga0496126_0054713 Ga0496126_0054713_2101_2688 180
223 2010549000 RicEn_C815 RicEn_15160 181
224 3300001989 JGI24739J22299_10009922 JGI24739J22299_100099222 181
225 3300002737 JGI25162J39368_1000033 JGI25162J39368_100003345 181
226 3300002737 JGI25162J39368_1001878 JGI25162J39368_10018782 181
227 3300002771 JGI25163J39215_1000004 JGI25163J39215_100000428 181
228 3300002772 JGI25164J39214_1000017 JGI25164J39214_100001745 181
229 3300003320 rootH2_10047075 rootH2_100470757 181
230 3300003751 Ga0055538_1000035 Ga0055538_1000035149 181
231 3300003752 Ga0055539_1000046 Ga0055539_100004645 181
232 3300003756 Ga0055533_1000056 Ga0055533_1000056149 181
233 3300003759 Ga0055525_1000067 Ga0055525_1000067149 181
234 3300003841 Ga0055541_1000033 Ga0055541_100003345 181
235 3300003856 Ga0058692_1000160 Ga0058692_10001607 181
236 3300003856 Ga0058692_1000259 Ga0058692_10002592 181
237 3300003856 Ga0058692_1000501 Ga0058692_100050111 181
238 3300003856 Ga0058692_1002470 Ga0058692_10024707 181
239 3300003856 Ga0058692_1004501 Ga0058692_10045014 181
240 3300003856 Ga0058692_1005179 Ga0058692_10051792 181
241 3300003856 Ga0058692_1013888 Ga0058692_10138882 181
242 3300003856 Ga0058692_1016829 Ga0058692_10168292 181
243 3300003856 Ga0058692_1016836 Ga0058692_10168362 181
244 3300005289 Ga0065704_10000015 Ga0065704_1000001547 181
245 3300005289 Ga0065704_10000267 Ga0065704_1000026791 181
246 3300005289 Ga0065704_10002126 Ga0065704_100021262 181
247 3300005289 Ga0065704_10003217 Ga0065704_100032175 181
248 3300005289 Ga0065704_10078988 Ga0065704_100789882 181
249 3300005289 Ga0065704_10095018 Ga0065704_100950181 181
250 3300005289 Ga0065704_10183575 Ga0065704_101835751 181
251 3300005347 Ga0070668_100000380 Ga0070668_10000038018 181
252 3300005548 Ga0070665_100002112 Ga0070665_1000021129 181
253 3300005548 Ga0070665_100613136 Ga0070665_1006131362 181
254 3300005577 Ga0068857_100004106 Ga0068857_1000041068 181
255 3300006051 Ga0075364_10004782 Ga0075364_100047826 181
256 3300006051 Ga0075364_10031201 Ga0075364_100312012 181
257 3300006051 Ga0075364_10082350 Ga0075364_100823502 181
258 3300006051 Ga0075364_10121980 Ga0075364_101219802 181
259 3300006195 Ga0075366_10006968 Ga0075366_100069684 181
260 3300006914 Ga0075436_100378355 Ga0075436_1003783552 181
261 3300006946 Ga0079104_1000021 Ga0079104_1000021208 181
262 3300006946 Ga0079104_1000030 Ga0079104_1000030192 181
263 3300006946 Ga0079104_1000649 Ga0079104_100064927 181
264 3300006946 Ga0079104_1000800 Ga0079104_100080025 181
265 3300006946 Ga0079104_1000849 Ga0079104_10008496 181
266 3300006946 Ga0079104_1001986 Ga0079104_10019868 181
267 3300006946 Ga0079104_1006913 Ga0079104_10069134 181
268 3300006946 Ga0079104_1006961 Ga0079104_10069612 181
269 3300006946 Ga0079104_1014003 Ga0079104_10140032 181
270 3300006946 Ga0079104_1027844 Ga0079104_10278442 181
271 3300009011 Ga0105251_10000116 Ga0105251_100001165 181
272 3300009011 Ga0105251_10001825 Ga0105251_100018255 181
273 3300009011 Ga0105251_10002028 Ga0105251_100020285 181
274 3300009011 Ga0105251_10002948 Ga0105251_1000294811 181
275 3300009011 Ga0105251_10003004 Ga0105251_1000300410 181
276 3300009011 Ga0105251_10004341 Ga0105251_100043418 181
277 3300009011 Ga0105251_10004962 Ga0105251_100049628 181
278 3300009011 Ga0105251_10009180 Ga0105251_100091805 181
279 3300009011 Ga0105251_10014615 Ga0105251_100146152 181
280 3300009011 Ga0105251_10029558 Ga0105251_100295582 181
281 3300009011 Ga0105251_10095272 Ga0105251_100952721 181
282 3300009011 Ga0105251_10117901 Ga0105251_101179012 181
283 3300009011 Ga0105251_10142517 Ga0105251_101425172 181
284 3300009036 Ga0105244_10000028 Ga0105244_10000028145 181
285 3300009036 Ga0105244_10000070 Ga0105244_1000007028 181
286 3300009036 Ga0105244_10000173 Ga0105244_1000017348 181
287 3300009036 Ga0105244_10000321 Ga0105244_1000032114 181
288 3300009036 Ga0105244_10001647 Ga0105244_100016473 181
289 3300009036 Ga0105244_10006638 Ga0105244_100066384 181
290 3300009036 Ga0105244_10022029 Ga0105244_100220294 181
291 3300009036 Ga0105244_10045052 Ga0105244_100450521 181
292 3300009036 Ga0105244_10062851 Ga0105244_100628512 181
293 3300009036 Ga0105244_10069519 Ga0105244_100695193 181
294 3300009036 Ga0105244_10176573 Ga0105244_101765731 181
295 3300009036 Ga0105244_10181651 Ga0105244_101816512 181
296 3300009092 Ga0105250_10000001 Ga0105250_10000001444 181
297 3300009092 Ga0105250_10000070 Ga0105250_1000007022 181
298 3300009092 Ga0105250_10000770 Ga0105250_1000077020 181
299 3300009092 Ga0105250_10000856 Ga0105250_100008569 181
300 3300009092 Ga0105250_10002900 Ga0105250_100029002 181
301 3300009092 Ga0105250_10063455 Ga0105250_100634552 181
302 3300009101 Ga0105247_10000012 Ga0105247_1000001226 181
303 3300009148 Ga0105243_10095834 Ga0105243_100958343 181
304 3300009148 Ga0105243_10455698 Ga0105243_104556982 181
305 3300009174 Ga0105241_10000002 Ga0105241_1000000238 181
306 3300009545 Ga0105237_10087214 Ga0105237_100872143 181
307 3300011119 Ga0105246_10435865 Ga0105246_104358652 181
308 3300013100 Ga0157373_10011372 Ga0157373_100113727 181
309 3300013100 Ga0157373_10028424 Ga0157373_100284242 181
310 3300013100 Ga0157373_10030456 Ga0157373_100304565 181
311 3300013100 Ga0157373_10054554 Ga0157373_100545542 181
312 3300013100 Ga0157373_10093095 Ga0157373_100930952 181
313 3300013102 Ga0157371_10000061 Ga0157371_1000006170 181
314 3300013102 Ga0157371_10001362 Ga0157371_1000136219 181
315 3300013102 Ga0157371_10039095 Ga0157371_100390953 181
316 3300013102 Ga0157371_10044447 Ga0157371_100444472 181
317 3300013102 Ga0157371_10064983 Ga0157371_100649832 181
318 3300013102 Ga0157371_10154226 Ga0157371_101542262 181
319 3300013104 Ga0157370_10000254 Ga0157370_1000025460 181
320 3300013104 Ga0157370_10002814 Ga0157370_1000281417 181
321 3300013104 Ga0157370_10003986 Ga0157370_100039869 181
322 3300013104 Ga0157370_10628438 Ga0157370_106284382 181
323 3300013105 Ga0157369_10006092 Ga0157369_1000609210 181
324 3300013105 Ga0157369_10013883 Ga0157369_100138833 181
325 3300013105 Ga0157369_10308262 Ga0157369_103082622 181
326 3300013105 Ga0157369_10332022 Ga0157369_103320221 181
327 3300013306 Ga0163162_10012432 Ga0163162_100124321 181
328 3300013306 Ga0163162_10535350 Ga0163162_105353502 181
329 3300013307 Ga0157372_10007319 Ga0157372_100073196 181
330 3300013307 Ga0157372_10018487 Ga0157372_100184876 181
331 3300013307 Ga0157372_10133713 Ga0157372_101337132 181
332 3300013307 Ga0157372_10305748 Ga0157372_103057482 181
333 3300013307 Ga0157372_10428395 Ga0157372_104283952 181
334 3300014497 Ga0182008_10001533 Ga0182008_100015333 181
335 3300014497 Ga0182008_10199004 Ga0182008_101990042 181
336 3300015261 Ga0182006_1000051 Ga0182006_100005134 181
337 3300015261 Ga0182006_1014597 Ga0182006_10145973 181
338 3300015679 Ga0183366_1001 Ga0183366_10011745 181
339 3300015680 Ga0183370_1001 Ga0183370_10011745 181
340 3300015685 Ga0183369_1001 Ga0183369_10011745 181
341 3300015687 Ga0183368_1001 Ga0183368_10011745 181
342 3300017792 Ga0163161_10000001 Ga0163161_100000011496 181
343 3300017792 Ga0163161_10001963 Ga0163161_1000196315 181
344 3300017792 Ga0163161_10173179 Ga0163161_101731792 181
345 3300021384 Ga0213876_10000069 Ga0213876_1000006945 181
346 3300025207 Ga0209760_100073 Ga0209760_1000737 181
347 3300025224 Ga0209784_100001 Ga0209784_1000011568 181
348 3300025225 Ga0209566_100001 Ga0209566_1000011568 181
349 3300025226 Ga0209674_100002 Ga0209674_1000021568 181
350 3300025230 Ga0209563_100002 Ga0209563_100002103 181
351 3300025231 Ga0207427_100032 Ga0207427_100032103 181
352 3300025233 Ga0209437_100001 Ga0209437_100001103 181
353 3300025233 Ga0209437_100073 Ga0209437_10007346 181
354 3300025253 Ga0209677_100002 Ga0209677_100002103 181
355 3300025258 Ga0209129_1000004 Ga0209129_1000004432 181
356 3300025261 Ga0209233_1000789 Ga0209233_100078911 181
357 3300025711 Ga0207696_1000001 Ga0207696_10000011565 181
358 3300025711 Ga0207696_1000028 Ga0207696_1000028241 181
359 3300025711 Ga0207696_1000038 Ga0207696_1000038135 181
360 3300025711 Ga0207696_1000735 Ga0207696_10007357 181
361 3300025711 Ga0207696_1002222 Ga0207696_10022223 181
362 3300025711 Ga0207696_1019801 Ga0207696_10198013 181
363 3300025711 Ga0207696_1032167 Ga0207696_10321672 181
364 3300025728 Ga0207655_1000001 Ga0207655_10000011622 181
365 3300025728 Ga0207655_1000002 Ga0207655_1000002837 181
366 3300025728 Ga0207655_1000091 Ga0207655_1000091146 181
367 3300025728 Ga0207655_1000110 Ga0207655_1000110141 181
368 3300025728 Ga0207655_1000168 Ga0207655_100016828 181
369 3300025728 Ga0207655_1000343 Ga0207655_100034320 181
370 3300025728 Ga0207655_1001840 Ga0207655_10018403 181
371 3300025728 Ga0207655_1003199 Ga0207655_10031994 181
372 3300025728 Ga0207655_1004038 Ga0207655_10040384 181
373 3300025728 Ga0207655_1004854 Ga0207655_10048542 181
374 3300025735 Ga0207713_1000001 Ga0207713_10000011264 181
375 3300025735 Ga0207713_1000002 Ga0207713_1000002154 181
376 3300025735 Ga0207713_1000004 Ga0207713_1000004507 181
377 3300025735 Ga0207713_1000008 Ga0207713_1000008492 181
378 3300025735 Ga0207713_1000035 Ga0207713_100003584 181
379 3300025735 Ga0207713_1000039 Ga0207713_1000039139 181
380 3300025735 Ga0207713_1003855 Ga0207713_10038556 181
381 3300025735 Ga0207713_1011670 Ga0207713_10116704 181
382 3300025735 Ga0207713_1017789 Ga0207713_10177894 181
383 3300025735 Ga0207713_1069120 Ga0207713_10691202 181
384 3300025900 Ga0207710_10000354 Ga0207710_100003544 181
385 3300025911 Ga0207654_10000005 Ga0207654_1000000538 181
386 3300025935 Ga0207709_10610450 Ga0207709_106104503 181
387 3300025972 Ga0207668_10010321 Ga0207668_100103216 181
388 3300026116 Ga0207674_10009629 Ga0207674_100096292 181
389 3300027111 Ga0209281_1000001 Ga0209281_1000001483 181
390 3300027111 Ga0209281_1000003 Ga0209281_1000003663 181
391 3300027111 Ga0209281_1000004 Ga0209281_1000004842 181
392 3300027111 Ga0209281_1000006 Ga0209281_1000006595 181
393 3300027111 Ga0209281_1000012 Ga0209281_1000012368 181
394 3300027111 Ga0209281_1000024 Ga0209281_100002425 181
395 3300027111 Ga0209281_1000124 Ga0209281_100012410 181
396 3300027111 Ga0209281_1000616 Ga0209281_100061620 181
397 3300027111 Ga0209281_1000680 Ga0209281_100068031 181
398 3300027111 Ga0209281_1001084 Ga0209281_100108422 181
399 3300027111 Ga0209281_1002491 Ga0209281_10024915 181
400 3300027312 Ga0209371_1000001 Ga0209371_10000011765 181
401 3300027312 Ga0209371_1000002 Ga0209371_1000002722 181
402 3300027312 Ga0209371_1000005 Ga0209371_1000005329 181
403 3300027312 Ga0209371_1000060 Ga0209371_1000060154 181
404 3300027312 Ga0209371_1000110 Ga0209371_100011066 181
405 3300027312 Ga0209371_1000157 Ga0209371_100015772 181
406 3300027312 Ga0209371_1001035 Ga0209371_100103515 181
407 3300027312 Ga0209371_1001336 Ga0209371_100133611 181
408 3300027312 Ga0209371_1001747 Ga0209371_10017474 181
409 3300027312 Ga0209371_1001871 Ga0209371_10018712 181
410 3300027312 Ga0209371_1004317 Ga0209371_10043172 181
411 3300027312 Ga0209371_1004354 Ga0209371_10043545 181
412 3300027312 Ga0209371_1005891 Ga0209371_10058912 181
413 3300027312 Ga0209371_1008756 Ga0209371_10087562 181
414 3300027312 Ga0209371_1016326 Ga0209371_10163262 181
415 3300027312 Ga0209371_1018417 Ga0209371_10184172 181
416 3300027312 Ga0209371_1018666 Ga0209371_10186662 181
417 3300027312 Ga0209371_1022847 Ga0209371_10228472 181
418 3300027312 Ga0209371_1043546 Ga0209371_10435462 181
419 3300028379 Ga0268266_10006659 Ga0268266_100066599 181
420 3300030500 Ga0268256_1000001 Ga0268256_1000001877 181
421 3300030500 Ga0268256_1000002 Ga0268256_1000002742 181
422 3300030500 Ga0268256_1000006 Ga0268256_1000006728 181
423 3300030500 Ga0268256_1000084 Ga0268256_100008475 181
424 3300030500 Ga0268256_1000280 Ga0268256_100028011 181
425 3300030500 Ga0268256_1000870 Ga0268256_10008707 181
426 3300030500 Ga0268256_1000979 Ga0268256_10009798 181
427 3300030500 Ga0268256_1001145 Ga0268256_100114511 181
428 3300030500 Ga0268256_1001523 Ga0268256_100152310 181
429 3300030500 Ga0268256_1004103 Ga0268256_10041034 181
430 3300030500 Ga0268256_1008895 Ga0268256_10088954 181
431 3300030500 Ga0268256_1009199 Ga0268256_10091993 181
432 3300030500 Ga0268256_1014188 Ga0268256_10141882 181
433 3300030500 Ga0268256_1018142 Ga0268256_10181422 181
434 3300030500 Ga0268256_1018954 Ga0268256_10189542 181
435 3300030500 Ga0268256_1020575 Ga0268256_10205752 181
436 3300030500 Ga0268256_1025337 Ga0268256_10253372 181
437 3300030500 Ga0268256_1042089 Ga0268256_10420892 181
438 3300031235 Ga0265330_10014137 Ga0265330_100141373 181
439 3300031250 Ga0265331_10008630 Ga0265331_100086306 181
440 3300031665 Ga0316575_10000441 Ga0316575_100004419 181
441 3300031691 Ga0316579_10000053 Ga0316579_1000005315 181
442 3300031691 Ga0316579_10144465 Ga0316579_101444652 181
443 3300031727 Ga0316576_10000471 Ga0316576_100004712 181
444 3300031727 Ga0316576_10007398 Ga0316576_100073987 181
445 3300031728 Ga0316578_10002742 Ga0316578_100027422 181
446 3300031728 Ga0316578_10019705 Ga0316578_100197052 181
447 3300031733 Ga0316577_10000771 Ga0316577_100007718 181
448 3300031733 Ga0316577_10045541 Ga0316577_100455413 181
449 3300032137 Ga0316585_10000244 Ga0316585_100002449 181
450 3300032139 Ga0316580_10000011 Ga0316580_100000117 181
451 3300032139 Ga0316580_10121717 Ga0316580_101217171 181
452 3300032168 Ga0316593_10016166 Ga0316593_100161662 181
453 3300033524 Ga0316592_1007057 Ga0316592_10070572 181
454 3300033524 Ga0316592_1024344 Ga0316592_10243442 181
455 3300033528 Ga0316588_1012500 Ga0316588_10125002 181
456 3300033541 Ga0316596_1020038 Ga0316596_10200382 181
457 3300033541 Ga0316596_1028931 Ga0316596_10289312 181
458 3300036647 Ga0316582_0072845 Ga0316582_0072845_1184_1804 181
459 3300036712 Ga0316584_0028751 Ga0316584_0028751_2712_3332 181
460 3300036712 Ga0316584_0140218 Ga0316584_0140218_315_920 181
461 3300039062 Ga0400483_240478 Ga0400483_240478_278_913 181
462 3300039437 Ga0436365_0368505 Ga0436365_0368505_113290_113880 181
463 3300041405 Ga0439438_000001 Ga0439438_000001_1043234_1043827 181
464 3300041405 Ga0439438_001732 Ga0439438_001732_3718_4308 181
465 3300041405 Ga0439438_002808 Ga0439438_002808_1149_1739 181
466 3300041405 Ga0439438_046865 Ga0439438_046865_92_682 181
467 3300041405 Ga0439438_069501 Ga0439438_069501_117_746 181
468 3300041407 Ga0439447_006450 Ga0439447_006450_1685_2278 181
469 3300041407 Ga0439447_008540 Ga0439447_008540_1144_1734 181
470 3300041407 Ga0439447_015611 Ga0439447_015611_302_892 181
471 3300041411 Ga0439466_0000191 Ga0439466_0000191_1560_2150 181
472 3300041512 Ga0451853_1618359 Ga0451853_1618359_1625_2215 181
473 3300042006 Ga0439432_003559 Ga0439432_003559_3031_3621 181
474 3300042006 Ga0439432_004687 Ga0439432_004687_3088_3681 181
475 3300042006 Ga0439432_006030 Ga0439432_006030_2659_3249 181
476 3300042006 Ga0439432_006564 Ga0439432_006564_3333_3923 181
477 3300042006 Ga0439432_051484 Ga0439432_051484_447_1037 181
478 3300042010 Ga0439452_000001 Ga0439452_000001_1081708_1082298 181
479 3300042010 Ga0439452_000002 Ga0439452_000002_897143_897733 181
480 3300042010 Ga0439452_000016 Ga0439452_000016_156110_156700 181
481 3300042010 Ga0439452_000025 Ga0439452_000025_225303_225893 181
482 3300042010 Ga0439452_001935 Ga0439452_001935_2972_3562 181
483 3300042010 Ga0439452_006079 Ga0439452_006079_2970_3560 181
484 3300042137 Ga0450902_028098 Ga0450902_028098_140_730 181
485 3300042146 Ga0450907_000581 Ga0450907_000581_6799_7389 181
486 3300042439 Ga0439464_0000106 Ga0439464_0000106_6471_7061 181
487 3300042439 Ga0439464_0035960 Ga0439464_0035960_707_1297 181
488 3300044669 Ga0466981_0000007 Ga0466981_0000007_42428_43018 181
489 3300046453 Ga0495627_000122 Ga0495627_000122_69793_70434 181
490 3300046458 Ga0495591_000003 Ga0495591_000003_28607_29197 181
491 3300046458 Ga0495591_002756 Ga0495591_002756_6066_6656 181
492 3300046458 Ga0495591_003841 Ga0495591_003841_4920_5510 181
493 3300046471 Ga0495650_0000005 Ga0495650_0000005_143157_143747 181
494 3300046471 Ga0495650_0000026 Ga0495650_0000026_291534_292124 181
495 3300046471 Ga0495650_0000126 Ga0495650_0000126_85329_85919 181
496 3300046471 Ga0495650_0007292 Ga0495650_0007292_2594_3184 181
497 3300046474 Ga0495605_0028484 Ga0495605_0028484_964_1554 181
498 3300046491 Ga0495584_0024791 Ga0495584_0024791_1456_2046 181
499 3300046492 Ga0495585_0023029 Ga0495585_0023029_154_744 181
500 3300046500 Ga0495596_0028838 Ga0495596_0028838_66_656 181
501 3300046501 Ga0495607_0013647 Ga0495607_0013647_2690_3280 181
502 3300046507 Ga0495606_0006343 Ga0495606_0006343_2720_3310 181
503 3300046513 Ga0495616_0009541 Ga0495616_0009541_517_1107 181
504 3300046515 Ga0495620_0013940 Ga0495620_0013940_3154_3744 181
505 3300046519 Ga0495632_0200684 Ga0495632_0200684_251_841 181
506 3300046522 Ga0495643_0044341 Ga0495643_0044341_1200_1790 181
507 3300046522 Ga0495643_0220065 Ga0495643_0220065_176_766 181
508 3300046523 Ga0495644_0019392 Ga0495644_0019392_1815_2405 181
509 3300046524 Ga0495648_0017403 Ga0495648_0017403_3847_4437 181
510 3300046530 Ga0495654_0000136 Ga0495654_0000136_67536_68126 181
511 3300046530 Ga0495654_0001577 Ga0495654_0001577_12416_13006 181
512 3300046530 Ga0495654_0110705 Ga0495654_0110705_83_673 181
513 3300046692 Ga0495671_0007381 Ga0495671_0007381_1624_2214 181
514 3300046692 Ga0495671_0051391 Ga0495671_0051391_150_740 181
515 3300046694 Ga0495649_0002406 Ga0495649_0002406_2479_3069 181
516 3300046694 Ga0495649_0021288 Ga0495649_0021288_565_1155 181
517 3300046694 Ga0495649_0028410 Ga0495649_0028410_1303_1893 181
518 3300046694 Ga0495649_0082049 Ga0495649_0082049_13_603 181
519 3300046794 Ga0495589_0000001 Ga0495589_0000001_393594_394184 181
520 3300046794 Ga0495589_0042863 Ga0495589_0042863_47_637 181
521 3300046810 Ga0495660_0000014 Ga0495660_0000014_17452_18042 181
522 3300046810 Ga0495660_0000016 Ga0495660_0000016_64346_64936 181
523 3300046810 Ga0495660_0004742 Ga0495660_0004742_4194_4784 181
524 3300047320 Ga0495672_0000001 Ga0495672_0000001_336875_337465 181
525 3300047320 Ga0495672_0000015 Ga0495672_0000015_38865_39455 181
526 3300047323 Ga0495683_0026332 Ga0495683_0026332_2325_2915 181
527 3300047446 Ga0495679_004572 Ga0495679_004572_2938_3528 181
528 3300047446 Ga0495679_024612 Ga0495679_024612_872_1462 181
529 3300047446 Ga0495679_032686 Ga0495679_032686_228_818 181
530 3300047469 Ga0495673_0000007 Ga0495673_0000007_531056_531646 181
531 3300047469 Ga0495673_0000669 Ga0495673_0000669_9074_9664 181
532 3300047470 Ga0495681_0005952 Ga0495681_0005952_2081_2722 181
533 3300048903 Ga0496100_0004926 Ga0496100_0004926_1421_2011 181
534 3300048903 Ga0496100_0121470 Ga0496100_0121470_940_1530 181
535 3300048904 Ga0496101_0105566 Ga0496101_0105566_244_834 181
536 3300048905 Ga0496102_0001157 Ga0496102_0001157_1257_1847 181
537 3300048905 Ga0496102_0747580 Ga0496102_0747580_53_643 181
538 3300048907 Ga0496104_0000472 Ga0496104_0000472_27540_28130 181
539 3300048907 Ga0496104_0000944 Ga0496104_0000944_23525_24115 181
540 3300048907 Ga0496104_0160979 Ga0496104_0160979_1462_2103 181
541 3300048907 Ga0496104_0691048 Ga0496104_0691048_125_715 181
542 3300048907 Ga0496104_0729163 Ga0496104_0729163_50_640 181
543 3300048908 Ga0496105_0007725 Ga0496105_0007725_7244_7834 181
544 3300048908 Ga0496105_0015763 Ga0496105_0015763_1921_2511 181
545 3300048909 Ga0496106_0156525 Ga0496106_0156525_546_1136 181
546 3300048913 Ga0496110_0418714 Ga0496110_0418714_480_1070 181
547 3300048914 Ga0496111_0522039 Ga0496111_0522039_128_718 181
548 3300048919 Ga0496116_0000001 Ga0496116_0000001_1015115_1015756 181
549 3300048919 Ga0496116_0000048 Ga0496116_0000048_73888_74478 181
550 3300048919 Ga0496116_0000086 Ga0496116_0000086_174536_175126 181
551 3300048919 Ga0496116_0000087 Ga0496116_0000087_187406_187996 181
552 3300048919 Ga0496116_0000347 Ga0496116_0000347_2809_3399 181
553 3300048919 Ga0496116_0010868 Ga0496116_0010868_1400_1990 181
554 3300048919 Ga0496116_0027309 Ga0496116_0027309_107_697 181
555 3300048919 Ga0496116_0038010 Ga0496116_0038010_2458_3048 181
556 3300048919 Ga0496116_0079099 Ga0496116_0079099_1164_1754 181
557 3300048919 Ga0496116_0101663 Ga0496116_0101663_131_721 181
558 3300048920 Ga0496117_0000022 Ga0496117_0000022_124541_125131 181
559 3300048920 Ga0496117_0000058 Ga0496117_0000058_226625_227215 181
560 3300048920 Ga0496117_0001297 Ga0496117_0001297_33372_33962 181
561 3300048920 Ga0496117_0002199 Ga0496117_0002199_19270_19911 181
562 3300048920 Ga0496117_0002670 Ga0496117_0002670_6054_6644 181
563 3300048920 Ga0496117_0008253 Ga0496117_0008253_7278_7868 181
564 3300048920 Ga0496117_0012234 Ga0496117_0012234_4668_5258 181
565 3300048920 Ga0496117_0017464 Ga0496117_0017464_1029_1619 181
566 3300048920 Ga0496117_0019157 Ga0496117_0019157_669_1259 181
567 3300048920 Ga0496117_0025019 Ga0496117_0025019_3071_3661 181
568 3300048920 Ga0496117_0026047 Ga0496117_0026047_2810_3400 181
569 3300048920 Ga0496117_0045816 Ga0496117_0045816_2125_2715 181
570 3300048920 Ga0496117_0212079 Ga0496117_0212079_223_813 181
571 3300048920 Ga0496117_0223914 Ga0496117_0223914_348_938 181
572 3300048921 Ga0496118_0000007 Ga0496118_0000007_451267_451857 181
573 3300048921 Ga0496118_0000328 Ga0496118_0000328_37013_37603 181
574 3300048921 Ga0496118_0001170 Ga0496118_0001170_2810_3400 181
575 3300048921 Ga0496118_0002772 Ga0496118_0002772_16272_16862 181
576 3300048921 Ga0496118_0004411 Ga0496118_0004411_15920_16510 181
577 3300048921 Ga0496118_0012515 Ga0496118_0012515_5255_5845 181
578 3300048921 Ga0496118_0024072 Ga0496118_0024072_588_1229 181
579 3300048921 Ga0496118_0050806 Ga0496118_0050806_834_1424 181
580 3300048921 Ga0496118_0050946 Ga0496118_0050946_1714_2304 181
581 3300048921 Ga0496118_0081193 Ga0496118_0081193_917_1507 181
582 3300048921 Ga0496118_0111225 Ga0496118_0111225_1155_1745 181
583 3300048921 Ga0496118_0202558 Ga0496118_0202558_358_948 181
584 3300048921 Ga0496118_0210751 Ga0496118_0210751_407_997 181
585 3300048921 Ga0496118_0337029 Ga0496118_0337029_62_652 181
586 3300048922 Ga0496119_0000018 Ga0496119_0000018_108611_109201 181
587 3300048922 Ga0496119_0000089 Ga0496119_0000089_34483_35073 181
588 3300048922 Ga0496119_0003158 Ga0496119_0003158_15814_16404 181
589 3300048922 Ga0496119_0003931 Ga0496119_0003931_9539_10129 181
590 3300048922 Ga0496119_0005203 Ga0496119_0005203_2809_3399 181
591 3300048922 Ga0496119_0009326 Ga0496119_0009326_6825_7415 181
592 3300048922 Ga0496119_0010807 Ga0496119_0010807_5421_6011 181
593 3300048922 Ga0496119_0047870 Ga0496119_0047870_1137_1727 181
594 3300048922 Ga0496119_0065865 Ga0496119_0065865_616_1206 181
595 3300048922 Ga0496119_0066723 Ga0496119_0066723_522_1112 181
596 3300048922 Ga0496119_0066941 Ga0496119_0066941_167_808 181
597 3300048922 Ga0496119_0070868 Ga0496119_0070868_1028_1618 181
598 3300048922 Ga0496119_0318943 Ga0496119_0318943_152_742 181
599 3300048922 Ga0496119_0412391 Ga0496119_0412391_41_631 181
600 3300048923 Ga0496120_0000002 Ga0496120_0000002_226975_227565 181
601 3300048923 Ga0496120_0000091 Ga0496120_0000091_122126_122716 181
602 3300048923 Ga0496120_0000117 Ga0496120_0000117_99271_99861 181
603 3300048923 Ga0496120_0000957 Ga0496120_0000957_33821_34411 181
604 3300048923 Ga0496120_0001288 Ga0496120_0001288_19392_19982 181
605 3300048923 Ga0496120_0002505 Ga0496120_0002505_4430_5020 181
606 3300048923 Ga0496120_0003932 Ga0496120_0003932_425_1015 181
607 3300048923 Ga0496120_0005988 Ga0496120_0005988_7692_8282 181
608 3300048923 Ga0496120_0006739 Ga0496120_0006739_7598_8188 181
609 3300048923 Ga0496120_0007512 Ga0496120_0007512_4694_5284 181
610 3300048923 Ga0496120_0018777 Ga0496120_0018777_1608_2198 181
611 3300048923 Ga0496120_0025172 Ga0496120_0025172_157_747 181
612 3300048923 Ga0496120_0047891 Ga0496120_0047891_1519_2109 181
613 3300048923 Ga0496120_0063197 Ga0496120_0063197_1046_1636 181
614 3300048923 Ga0496120_0074205 Ga0496120_0074205_634_1275 181
615 3300048923 Ga0496120_0094906 Ga0496120_0094906_766_1356 181
616 3300048923 Ga0496120_0114136 Ga0496120_0114136_51_641 181
617 3300048923 Ga0496120_0119781 Ga0496120_0119781_227_817 181
618 3300048924 Ga0496121_0000103 Ga0496121_0000103_40085_40675 181
619 3300048924 Ga0496121_0007765 Ga0496121_0007765_6335_6925 181
620 3300048924 Ga0496121_0010274 Ga0496121_0010274_2808_3398 181
621 3300048924 Ga0496121_0012064 Ga0496121_0012064_928_1518 181
622 3300048924 Ga0496121_0030111 Ga0496121_0030111_3370_3960 181
623 3300048924 Ga0496121_0038541 Ga0496121_0038541_3117_3707 181
624 3300048924 Ga0496121_0111667 Ga0496121_0111667_1192_1782 181
625 3300048924 Ga0496121_0171952 Ga0496121_0171952_33_623 181
626 3300048924 Ga0496121_0349878 Ga0496121_0349878_137_727 181
627 3300048925 Ga0496122_0000005 Ga0496122_0000005_559346_559936 181
628 3300048925 Ga0496122_0000086 Ga0496122_0000086_120443_121033 181
629 3300048925 Ga0496122_0002471 Ga0496122_0002471_3030_3620 181
630 3300048925 Ga0496122_0005036 Ga0496122_0005036_8441_9031 181
631 3300048925 Ga0496122_0007494 Ga0496122_0007494_149_739 181
632 3300048925 Ga0496122_0011051 Ga0496122_0011051_5755_6345 181
633 3300048925 Ga0496122_0018882 Ga0496122_0018882_2936_3526 181
634 3300048925 Ga0496122_0025961 Ga0496122_0025961_2169_2759 181
635 3300048925 Ga0496122_0039036 Ga0496122_0039036_2796_3386 181
636 3300048925 Ga0496122_0042214 Ga0496122_0042214_1430_2020 181
637 3300048925 Ga0496122_0068973 Ga0496122_0068973_1224_1814 181
638 3300048926 Ga0496123_0000008 Ga0496123_0000008_70693_71283 181
639 3300048926 Ga0496123_0000014 Ga0496123_0000014_180739_181329 181
640 3300048926 Ga0496123_0000021 Ga0496123_0000021_120589_121179 181
641 3300048926 Ga0496123_0001960 Ga0496123_0001960_19194_19784 181
642 3300048926 Ga0496123_0004786 Ga0496123_0004786_10070_10660 181
643 3300048926 Ga0496123_0015181 Ga0496123_0015181_2810_3400 181
644 3300048926 Ga0496123_0015662 Ga0496123_0015662_4557_5147 181
645 3300048926 Ga0496123_0033893 Ga0496123_0033893_2796_3386 181
646 3300048926 Ga0496123_0057221 Ga0496123_0057221_334_924 181
647 3300048926 Ga0496123_0137907 Ga0496123_0137907_322_912 181
648 3300048926 Ga0496123_0138746 Ga0496123_0138746_250_840 181
649 3300048926 Ga0496123_0155296 Ga0496123_0155296_341_931 181
650 3300048926 Ga0496123_0335409 Ga0496123_0335409_62_652 181
651 3300048927 Ga0496124_0000008 Ga0496124_0000008_338652_339242 181
652 3300048927 Ga0496124_0000059 Ga0496124_0000059_174990_175580 181
653 3300048927 Ga0496124_0000092 Ga0496124_0000092_53218_53808 181
654 3300048927 Ga0496124_0000208 Ga0496124_0000208_100637_101227 181
655 3300048927 Ga0496124_0000688 Ga0496124_0000688_47758_48348 181
656 3300048927 Ga0496124_0002242 Ga0496124_0002242_24098_24688 181
657 3300048927 Ga0496124_0008298 Ga0496124_0008298_8090_8680 181
658 3300048927 Ga0496124_0009694 Ga0496124_0009694_3171_3761 181
659 3300048927 Ga0496124_0021326 Ga0496124_0021326_4352_4942 181
660 3300048927 Ga0496124_0037930 Ga0496124_0037930_1029_1619 181
661 3300048927 Ga0496124_0086542 Ga0496124_0086542_1804_2394 181
662 3300048927 Ga0496124_0090781 Ga0496124_0090781_1606_2196 181
663 3300048927 Ga0496124_0098538 Ga0496124_0098538_958_1548 181
664 3300048927 Ga0496124_0133316 Ga0496124_0133316_308_898 181
665 3300048927 Ga0496124_0258094 Ga0496124_0258094_572_1162 181
666 3300048928 Ga0496125_0000009 Ga0496125_0000009_152224_152814 181
667 3300048928 Ga0496125_0000064 Ga0496125_0000064_17462_18052 181
668 3300048928 Ga0496125_0014971 Ga0496125_0014971_928_1518 181
669 3300048928 Ga0496125_0079199 Ga0496125_0079199_1498_2088 181
670 3300048928 Ga0496125_0095509 Ga0496125_0095509_75_665 181
671 3300048928 Ga0496125_0408292 Ga0496125_0408292_106_696 181
672 3300048929 Ga0496126_0000229 Ga0496126_0000229_66539_67129 181
673 3300048929 Ga0496126_0000825 Ga0496126_0000825_50326_50916 181
674 3300048929 Ga0496126_0001518 Ga0496126_0001518_26719_27309 181
675 3300048929 Ga0496126_0029527 Ga0496126_0029527_2782_3372 181
676 3300048929 Ga0496126_0074757 Ga0496126_0074757_11_601 181
677 3300048929 Ga0496126_0245274 Ga0496126_0245274_426_1016 181
678 3300048929 Ga0496126_0260708 Ga0496126_0260708_747_1337 181
679 3300048929 Ga0496126_0342731 Ga0496126_0342731_392_982 181
680 3300048929 Ga0496126_0434544 Ga0496126_0434544_457_1047 181
681 3300048929 Ga0496126_0444474 Ga0496126_0444474_386_976 181
682 3300048929 Ga0496126_0764726 Ga0496126_0764726_125_715 181
683 3300049459 Ga0495678_000512 Ga0495678_000512_5057_5647 181
684 3300049460 Ga0495682_0000001 Ga0495682_0000001_765072_765662 181
685 3300050491 nmdc:mga00v17_15663_c1 nmdc:mga00v17_15663_c1_1698_2288 181
686 3300050491 nmdc:mga00v17_44828_c1 nmdc:mga00v17_44828_c1_1980_2570 181
687 3300050491 nmdc:mga00v17_71192_c1 nmdc:mga00v17_71192_c1_1032_1622 181
688 3300050493 nmdc:mga0k408_3445_c1 nmdc:mga0k408_3445_c1_3509_4099 181
689 3300053126 Ga0500621_000002 Ga0500621_000002_776510_777100 181
690 iso_pu_bacteria 2554235234 2555258990 181
691 iso_pu_bacteria 2602042047 2603643018 181
692 iso_pu_bacteria 2775506706 2775542184 181
693 iso_pu_bacteria 2919108558 2919109473 181
694 iso_pu_bacteria 2932406140 2932407732 181
695 iso_pu_bacteria 2937539931 2937543380 181
696 iso_pu_bacteria 2939577877 2939580137 181
697 iso_pu_bacteria 2971820967 2971824825 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02572

CobA_CobO_BtuR

ATP:corrinoid adenosyltransferase BtuR/CobO/CobP

44

213

0.99

PF12557

Co_AT_N

Cob(I)alamin adenosyltransferase N terminal

18

38

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.9246 13 167
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.9075 13 167
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8693 13 181
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8642 13 181
1g64-assembly1.cif.gz_B the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex 0.8542 9 181
ID Description Score Start End Superfamily
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 13 167 3.40.50.300
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9037 13 167 3.40.50.300
1g64B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8542 9 181 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8506 13 181 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8457 13 181 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6M1HU15-F1-model_v4 deleted 0.98 8 157
AF-A0A5N7YIB8-F1-model_v4 deleted 0.9756 8 123
AF-X1P2Z9-F1-model_v4 Cob(I)alamin adenosyltransferase N-terminal domain-containing protein 0.9717 10 161 GO:0005524
GO:0008817
GO:0009236
AF-A0A227J7G0-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9705 8 138 GO:0005524
GO:0008817
GO:0009236
AF-A0A6S6UIM1-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9683 9 153 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
87.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map