F475796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 695 | 312 | 1390 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1001861|Ga0436364_1001861_2683_3180 |
| Length | 165 |
| Sequence | VGLRLVGRAGRLWLGRLRRARQAPLVTGTDALVERILTRYAVITVVGASRAPVKAAHSVPAHMQRHGWRIIPVNPHAGQLLGEPAYRTLADVPEQVGLVDVFRPSGQTPDIARQAVAAGASALWLQLGIASAEARAIAEDAGLLYVEDRCLVIEQRRLGLDAPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 86 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 87 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 88 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 89 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 90 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 200 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 201 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 202 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 309 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 310 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 311 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 312 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.27 |
| Metatranscriptomes | 1.15 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 4.89 |
| Rhizosphere | 90.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_1001861 | 3300037853 | Bacteria | 5179 |
| 2 | rootH2_10023503 | 3300003320 | Bacteria | 1578 |
| 3 | Ga0070658_10100165 | 3300005327 | Bacteria | 2395 |
| 4 | Ga0070658_10910627 | 3300005327 | Bacteria | 765 |
| 5 | Ga0070683_100119670 | 3300005329 | Bacteria | 2487 |
| 6 | Ga0070690_100058556 | 3300005330 | Bacteria | 2474 |
| 7 | Ga0070670_100673061 | 3300005331 | Bacteria | 929 |
| 8 | Ga0070670_101006264 | 3300005331 | Bacteria | 758 |
| 9 | Ga0068869_100106552 | 3300005334 | Bacteria | 2127 |
| 10 | Ga0068869_100232617 | 3300005334 | Bacteria | 1465 |
| 11 | Ga0070680_100011567 | 3300005336 | Bacteria | 6832 |
| 12 | Ga0070682_100209505 | 3300005337 | Bacteria | 1380 |
| 13 | Ga0070682_100327288 | 3300005337 | Bacteria | 1134 |
| 14 | Ga0070682_100670086 | 3300005337 | Unclassified | 828 |
| 15 | Ga0070660_100701829 | 3300005339 | Bacteria | 848 |
| 16 | Ga0070689_100020282 | 3300005340 | Bacteria | 4930 |
| 17 | Ga0070691_10470068 | 3300005341 | Bacteria | 721 |
| 18 | Ga0070661_100083340 | 3300005344 | Bacteria | 2361 |
| 19 | Ga0070692_10167911 | 3300005345 | Bacteria | 1262 |
| 20 | Ga0070669_101095310 | 3300005353 | Bacteria | 686 |
| 21 | Ga0070675_100292912 | 3300005354 | Bacteria | 1433 |
| 22 | Ga0070671_101274366 | 3300005355 | Bacteria | 648 |
| 23 | Ga0070674_100152178 | 3300005356 | Bacteria | 1747 |
| 24 | Ga0070673_100026254 | 3300005364 | Bacteria | 4300 |
| 25 | Ga0070688_100723273 | 3300005365 | Bacteria | 773 |
| 26 | Ga0070659_100330533 | 3300005366 | Bacteria | 1275 |
| 27 | Ga0070709_10090457 | 3300005434 | Bacteria | 2017 |
| 28 | Ga0070709_10209342 | 3300005434 | Bacteria | 1385 |
| 29 | Ga0070709_10352021 | 3300005434 | Bacteria | 1088 |
| 30 | Ga0070709_10376374 | 3300005434 | Bacteria | 1055 |
| 31 | Ga0070709_10930944 | 3300005434 | Bacteria | 688 |
| 32 | Ga0070709_11462355 | 3300005434 | Unclassified | 554 |
| 33 | Ga0070714_100081480 | 3300005435 | Bacteria | 2817 |
| 34 | Ga0070714_100254618 | 3300005435 | Bacteria | 1624 |
| 35 | Ga0070714_100327285 | 3300005435 | Bacteria | 1434 |
| 36 | Ga0070714_100401607 | 3300005435 | Bacteria | 1295 |
| 37 | Ga0070714_100412502 | 3300005435 | Bacteria | 1278 |
| 38 | Ga0070714_100506431 | 3300005435 | Bacteria | 1152 |
| 39 | Ga0070714_100507649 | 3300005435 | Bacteria | 1150 |
| 40 | Ga0070714_100638275 | 3300005435 | Bacteria | 1024 |
| 41 | Ga0070714_100911612 | 3300005435 | Bacteria | 853 |
| 42 | Ga0070714_101277394 | 3300005435 | Bacteria | 716 |
| 43 | Ga0070714_101837559 | 3300005435 | Bacteria | 591 |
| 44 | Ga0070713_100043323 | 3300005436 | Bacteria | 3679 |
| 45 | Ga0070713_100067455 | 3300005436 | Bacteria | 3012 |
| 46 | Ga0070713_100368469 | 3300005436 | Bacteria | 1336 |
| 47 | Ga0070713_100469274 | 3300005436 | Bacteria | 1184 |
| 48 | Ga0070713_100614361 | 3300005436 | Bacteria | 1033 |
| 49 | Ga0070710_10052171 | 3300005437 | Bacteria | 2299 |
| 50 | Ga0070710_10122688 | 3300005437 | Bacteria | 1574 |
| 51 | Ga0070710_10134861 | 3300005437 | Bacteria | 1508 |
| 52 | Ga0070711_100199032 | 3300005439 | Bacteria | 1545 |
| 53 | Ga0070711_100372681 | 3300005439 | Bacteria | 1152 |
| 54 | Ga0070711_100381043 | 3300005439 | Bacteria | 1140 |
| 55 | Ga0070711_100439009 | 3300005439 | Bacteria | 1067 |
| 56 | Ga0070711_100474261 | 3300005439 | Bacteria | 1027 |
| 57 | Ga0070705_100126947 | 3300005440 | Bacteria | 1657 |
| 58 | Ga0070700_100161499 | 3300005441 | Bacteria | 1543 |
| 59 | Ga0070694_100225101 | 3300005444 | Bacteria | 1409 |
| 60 | Ga0070708_100004355 | 3300005445 | Bacteria | 11122 |
| 61 | Ga0070708_100004931 | 3300005445 | Bacteria | 10551 |
| 62 | Ga0070708_100033029 | 3300005445 | Bacteria | 4494 |
| 63 | Ga0070708_100481143 | 3300005445 | Bacteria | 1171 |
| 64 | Ga0070663_100163520 | 3300005455 | Bacteria | 1715 |
| 65 | Ga0070663_101240257 | 3300005455 | Bacteria | 656 |
| 66 | Ga0070678_100180938 | 3300005456 | Bacteria | 1725 |
| 67 | Ga0070678_100183359 | 3300005456 | Bacteria | 1715 |
| 68 | Ga0070681_10137395 | 3300005458 | Bacteria | 2374 |
| 69 | Ga0070685_10027294 | 3300005466 | Bacteria | 3155 |
| 70 | Ga0070706_100023023 | 3300005467 | Bacteria | 5737 |
| 71 | Ga0070706_100106567 | 3300005467 | Bacteria | 2607 |
| 72 | Ga0070706_100432005 | 3300005467 | Bacteria | 1225 |
| 73 | Ga0070706_101249003 | 3300005467 | Bacteria | 682 |
| 74 | Ga0070707_100007741 | 3300005468 | Bacteria | 9980 |
| 75 | Ga0070707_100372261 | 3300005468 | Bacteria | 1388 |
| 76 | Ga0070707_100568886 | 3300005468 | Bacteria | 1095 |
| 77 | Ga0070698_100001345 | 3300005471 | Bacteria | 27329 |
| 78 | Ga0070698_100051342 | 3300005471 | Bacteria | 4200 |
| 79 | Ga0070698_100091713 | 3300005471 | Bacteria | 3020 |
| 80 | Ga0070698_100505586 | 3300005471 | Bacteria | 1146 |
| 81 | Ga0070699_100006444 | 3300005518 | Bacteria | 10222 |
| 82 | Ga0070679_100094804 | 3300005530 | Bacteria | 2972 |
| 83 | Ga0070679_100992385 | 3300005530 | Bacteria | 784 |
| 84 | Ga0070684_100128148 | 3300005535 | Bacteria | 2288 |
| 85 | Ga0070684_100396473 | 3300005535 | Bacteria | 1272 |
| 86 | Ga0070684_100974526 | 3300005535 | Bacteria | 795 |
| 87 | Ga0070684_101307323 | 3300005535 | Bacteria | 682 |
| 88 | Ga0070697_100019940 | 3300005536 | Bacteria | 5299 |
| 89 | Ga0070697_100280084 | 3300005536 | Bacteria | 1431 |
| 90 | Ga0070697_100399123 | 3300005536 | Bacteria | 1193 |
| 91 | Ga0068853_100052780 | 3300005539 | Bacteria | 3501 |
| 92 | Ga0068853_100567458 | 3300005539 | Bacteria | 1076 |
| 93 | Ga0068853_100942832 | 3300005539 | Bacteria | 830 |
| 94 | Ga0070686_100004561 | 3300005544 | Bacteria | 7643 |
| 95 | Ga0070695_100131834 | 3300005545 | Bacteria | 1723 |
| 96 | Ga0070696_100079628 | 3300005546 | Bacteria | 2318 |
| 97 | Ga0070693_100031934 | 3300005547 | Bacteria | 2891 |
| 98 | Ga0070665_100111979 | 3300005548 | Bacteria | 2732 |
| 99 | Ga0070665_100308743 | 3300005548 | Bacteria | 1585 |
| 100 | Ga0070665_100314440 | 3300005548 | Bacteria | 1570 |
| 101 | Ga0070665_100330020 | 3300005548 | Bacteria | 1530 |
| 102 | Ga0070704_100153250 | 3300005549 | Bacteria | 1814 |
| 103 | Ga0068855_100185231 | 3300005563 | Bacteria | 2352 |
| 104 | Ga0068855_101065753 | 3300005563 | Bacteria | 846 |
| 105 | Ga0068855_102173536 | 3300005563 | Bacteria | 557 |
| 106 | Ga0068857_100102439 | 3300005577 | Bacteria | 2570 |
| 107 | Ga0068857_100619906 | 3300005577 | Bacteria | 1024 |
| 108 | Ga0068856_100099294 | 3300005614 | Bacteria | 2902 |
| 109 | Ga0068856_100118753 | 3300005614 | Bacteria | 2645 |
| 110 | Ga0068856_100284665 | 3300005614 | Bacteria | 1670 |
| 111 | Ga0068856_100608682 | 3300005614 | Bacteria | 1113 |
| 112 | Ga0068852_100266274 | 3300005616 | Bacteria | 1647 |
| 113 | Ga0068852_100452038 | 3300005616 | Bacteria | 1272 |
| 114 | Ga0068859_100000835 | 3300005617 | Bacteria | 31291 |
| 115 | Ga0068859_100131592 | 3300005617 | Bacteria | 2573 |
| 116 | Ga0068864_100554267 | 3300005618 | Bacteria | 1111 |
| 117 | Ga0068864_100744185 | 3300005618 | Unclassified | 960 |
| 118 | Ga0068866_10005846 | 3300005718 | Bacteria | 5107 |
| 119 | Ga0068861_100197437 | 3300005719 | Bacteria | 1686 |
| 120 | Ga0068851_10034145 | 3300005834 | Bacteria | 2538 |
| 121 | Ga0068870_10022361 | 3300005840 | Bacteria | 3106 |
| 122 | Ga0068858_100396634 | 3300005842 | Bacteria | 1325 |
| 123 | Ga0068860_100347346 | 3300005843 | Bacteria | 1459 |
| 124 | Ga0068860_100734821 | 3300005843 | Bacteria | 998 |
| 125 | Ga0068862_100500596 | 3300005844 | Bacteria | 1153 |
| 126 | Ga0081540_1003217 | 3300005983 | Bacteria | 13015 |
| 127 | Ga0070717_10174233 | 3300006028 | Bacteria | 1872 |
| 128 | Ga0070717_10188469 | 3300006028 | Bacteria | 1801 |
| 129 | Ga0070717_10202715 | 3300006028 | Bacteria | 1738 |
| 130 | Ga0070717_10402165 | 3300006028 | Bacteria | 1230 |
| 131 | Ga0070717_10802122 | 3300006028 | Bacteria | 856 |
| 132 | Ga0070717_10825411 | 3300006028 | Bacteria | 843 |
| 133 | Ga0070717_11277129 | 3300006028 | Bacteria | 668 |
| 134 | Ga0070715_10051068 | 3300006163 | Bacteria | 1778 |
| 135 | Ga0070715_10103915 | 3300006163 | Bacteria | 1330 |
| 136 | Ga0070716_100055349 | 3300006173 | Bacteria | 2270 |
| 137 | Ga0070716_100387731 | 3300006173 | Bacteria | 1001 |
| 138 | Ga0070716_100510639 | 3300006173 | Bacteria | 888 |
| 139 | Ga0070716_101410765 | 3300006173 | Bacteria | 566 |
| 140 | Ga0070712_100054704 | 3300006175 | Bacteria | 2791 |
| 141 | Ga0070712_100321531 | 3300006175 | Bacteria | 1258 |
| 142 | Ga0070712_100382826 | 3300006175 | Bacteria | 1158 |
| 143 | Ga0097621_100249899 | 3300006237 | Bacteria | 1552 |
| 144 | Ga0068871_100474454 | 3300006358 | Bacteria | 1124 |
| 145 | Ga0075434_100376960 | 3300006871 | Bacteria | 1440 |
| 146 | Ga0075436_100178689 | 3300006914 | Bacteria | 1500 |
| 147 | Ga0097620_100000835 | 3300006931 | Bacteria | 31291 |
| 148 | Ga0097620_100131585 | 3300006931 | Bacteria | 2573 |
| 149 | Ga0105251_10025103 | 3300009011 | Bacteria | 3052 |
| 150 | Ga0105240_10300477 | 3300009093 | Bacteria | 1836 |
| 151 | Ga0105245_10147161 | 3300009098 | Bacteria | 2223 |
| 152 | Ga0105245_10435926 | 3300009098 | Bacteria | 1316 |
| 153 | Ga0105245_10589018 | 3300009098 | Bacteria | 1137 |
| 154 | Ga0105247_10021132 | 3300009101 | Bacteria | 3915 |
| 155 | Ga0105247_10148114 | 3300009101 | Bacteria | 1544 |
| 156 | Ga0105243_10822406 | 3300009148 | Bacteria | 917 |
| 157 | Ga0105241_10118932 | 3300009174 | Bacteria | 2125 |
| 158 | Ga0105242_10118512 | 3300009176 | Bacteria | 2268 |
| 159 | Ga0105248_10199453 | 3300009177 | Bacteria | 2254 |
| 160 | Ga0105248_10336942 | 3300009177 | Bacteria | 1698 |
| 161 | Ga0105237_10110865 | 3300009545 | Bacteria | 2736 |
| 162 | Ga0105237_10209434 | 3300009545 | Bacteria | 1950 |
| 163 | Ga0105237_10416382 | 3300009545 | Bacteria | 1349 |
| 164 | Ga0105238_10327732 | 3300009551 | Bacteria | 1518 |
| 165 | Ga0105238_11410463 | 3300009551 | Bacteria | 724 |
| 166 | Ga0105249_10129973 | 3300009553 | Bacteria | 2403 |
| 167 | Ga0105249_10934810 | 3300009553 | Bacteria | 935 |
| 168 | Ga0105239_10076942 | 3300010375 | Bacteria | 3671 |
| 169 | Ga0105239_10282170 | 3300010375 | Bacteria | 1870 |
| 170 | Ga0105239_13374034 | 3300010375 | Bacteria | 520 |
| 171 | Ga0105246_10179005 | 3300011119 | Bacteria | 1631 |
| 172 | Ga0157337_1020314 | 3300012483 | Bacteria | 608 |
| 173 | Ga0157329_1000718 | 3300012491 | Bacteria | 1438 |
| 174 | Ga0157314_1008772 | 3300012500 | Bacteria | 842 |
| 175 | Ga0157324_1034397 | 3300012506 | Bacteria | 591 |
| 176 | Ga0157342_1000128 | 3300012507 | Bacteria | 3705 |
| 177 | Ga0157338_1017854 | 3300012515 | Bacteria | 798 |
| 178 | Ga0157373_10573755 | 3300013100 | Bacteria | 820 |
| 179 | Ga0157371_10031125 | 3300013102 | Bacteria | 3844 |
| 180 | Ga0157369_11959196 | 3300013105 | Bacteria | 594 |
| 181 | Ga0157374_10006641 | 3300013296 | Bacteria | 9825 |
| 182 | Ga0157372_10730662 | 3300013307 | Bacteria | 1151 |
| 183 | Ga0157372_10871673 | 3300013307 | Bacteria | 1045 |
| 184 | Ga0157372_11015540 | 3300013307 | Bacteria | 960 |
| 185 | Ga0157375_10224067 | 3300013308 | Bacteria | 2039 |
| 186 | Ga0157375_10665612 | 3300013308 | Bacteria | 1196 |
| 187 | Ga0163163_10390077 | 3300014325 | Bacteria | 1450 |
| 188 | Ga0163163_10431211 | 3300014325 | Bacteria | 1377 |
| 189 | Ga0157379_10019950 | 3300014968 | Bacteria | 5922 |
| 190 | Ga0157379_10505193 | 3300014968 | Bacteria | 1121 |
| 191 | Ga0157376_10048776 | 3300014969 | Bacteria | 3504 |
| 192 | Ga0163161_10048989 | 3300017792 | Bacteria | 3052 |
| 193 | Ga0206356_11553540 | 3300020070 | Bacteria | 2591 |
| 194 | Ga0206353_10057171 | 3300020082 | Bacteria | 2536 |
| 195 | Ga0206353_10551325 | 3300020082 | Bacteria | 1503 |
| 196 | Ga0206353_11480393 | 3300020082 | Bacteria | 4891 |
| 197 | Ga0206353_11915281 | 3300020082 | Bacteria | 2650 |
| 198 | Ga0206353_11966324 | 3300020082 | Bacteria | 782 |
| 199 | Ga0213875_10000160 | 3300021388 | Bacteria | 71044 |
| 200 | Ga0213875_10002622 | 3300021388 | Bacteria | 10661 |
| 201 | Ga0213875_10203490 | 3300021388 | Bacteria | 931 |
| 202 | Ga0213875_10284640 | 3300021388 | Bacteria | 781 |
| 203 | Ga0224712_10178743 | 3300022467 | Bacteria | 955 |
| 204 | Ga0207656_10026789 | 3300025321 | Bacteria | 2353 |
| 205 | Ga0207653_10006120 | 3300025885 | Bacteria | 3751 |
| 206 | Ga0207692_10031806 | 3300025898 | Bacteria | 2530 |
| 207 | Ga0207692_10058721 | 3300025898 | Bacteria | 1983 |
| 208 | Ga0207692_10153255 | 3300025898 | Bacteria | 1322 |
| 209 | Ga0207642_10449757 | 3300025899 | Bacteria | 780 |
| 210 | Ga0207710_10036185 | 3300025900 | Bacteria | 2175 |
| 211 | Ga0207680_10692733 | 3300025903 | Bacteria | 730 |
| 212 | Ga0207647_10074583 | 3300025904 | Unclassified | 2043 |
| 213 | Ga0207647_10075188 | 3300025904 | Bacteria | 2034 |
| 214 | Ga0207647_10184325 | 3300025904 | Bacteria | 1211 |
| 215 | Ga0207647_10290078 | 3300025904 | Bacteria | 933 |
| 216 | Ga0207685_10086010 | 3300025905 | Bacteria | 1313 |
| 217 | Ga0207685_10154594 | 3300025905 | Bacteria | 1042 |
| 218 | Ga0207685_10222814 | 3300025905 | Bacteria | 898 |
| 219 | Ga0207699_10015551 | 3300025906 | Bacteria | 3955 |
| 220 | Ga0207699_10028211 | 3300025906 | Bacteria | 3117 |
| 221 | Ga0207699_10811386 | 3300025906 | Bacteria | 688 |
| 222 | Ga0207699_11147788 | 3300025906 | Bacteria | 575 |
| 223 | Ga0207705_10047040 | 3300025909 | Bacteria | 3101 |
| 224 | Ga0207705_10427593 | 3300025909 | Bacteria | 1026 |
| 225 | Ga0207684_10011430 | 3300025910 | Bacteria | 7767 |
| 226 | Ga0207684_10035311 | 3300025910 | Bacteria | 4245 |
| 227 | Ga0207684_10064069 | 3300025910 | Bacteria | 3120 |
| 228 | Ga0207684_10066700 | 3300025910 | Bacteria | 3057 |
| 229 | Ga0207654_10132512 | 3300025911 | Bacteria | 1579 |
| 230 | Ga0207654_10351760 | 3300025911 | Bacteria | 1015 |
| 231 | Ga0207707_10220237 | 3300025912 | Bacteria | 1652 |
| 232 | Ga0207671_10262352 | 3300025914 | Bacteria | 1360 |
| 233 | Ga0207671_10313909 | 3300025914 | Bacteria | 1239 |
| 234 | Ga0207693_10015973 | 3300025915 | Bacteria | 6010 |
| 235 | Ga0207663_10050071 | 3300025916 | Bacteria | 2594 |
| 236 | Ga0207663_10146629 | 3300025916 | Bacteria | 1651 |
| 237 | Ga0207663_10196181 | 3300025916 | Bacteria | 1453 |
| 238 | Ga0207660_10393597 | 3300025917 | Bacteria | 1115 |
| 239 | Ga0207662_10005260 | 3300025918 | Bacteria | 6874 |
| 240 | Ga0207657_10010213 | 3300025919 | Bacteria | 9377 |
| 241 | Ga0207657_10524161 | 3300025919 | Bacteria | 927 |
| 242 | Ga0207649_10040928 | 3300025920 | Bacteria | 2819 |
| 243 | Ga0207646_10011465 | 3300025922 | Bacteria | 8586 |
| 244 | Ga0207646_10454033 | 3300025922 | Bacteria | 1156 |
| 245 | Ga0207694_10173720 | 3300025924 | Bacteria | 1745 |
| 246 | Ga0207650_10151791 | 3300025925 | Bacteria | 1829 |
| 247 | Ga0207687_10098026 | 3300025927 | Bacteria | 2151 |
| 248 | Ga0207700_10049136 | 3300025928 | Bacteria | 3136 |
| 249 | Ga0207700_10074764 | 3300025928 | Bacteria | 2623 |
| 250 | Ga0207700_10089984 | 3300025928 | Bacteria | 2421 |
| 251 | Ga0207700_10243625 | 3300025928 | Bacteria | 1533 |
| 252 | Ga0207700_10272836 | 3300025928 | Bacteria | 1452 |
| 253 | Ga0207700_10714518 | 3300025928 | Bacteria | 895 |
| 254 | Ga0207700_11134331 | 3300025928 | Bacteria | 699 |
| 255 | Ga0207700_11274038 | 3300025928 | Bacteria | 655 |
| 256 | Ga0207664_10048722 | 3300025929 | Bacteria | 3333 |
| 257 | Ga0207664_10055010 | 3300025929 | Bacteria | 3156 |
| 258 | Ga0207664_10070195 | 3300025929 | Bacteria | 2819 |
| 259 | Ga0207664_10100555 | 3300025929 | Bacteria | 2388 |
| 260 | Ga0207664_10132698 | 3300025929 | Bacteria | 2098 |
| 261 | Ga0207664_10148383 | 3300025929 | Bacteria | 1990 |
| 262 | Ga0207664_10174992 | 3300025929 | Bacteria | 1839 |
| 263 | Ga0207664_10215450 | 3300025929 | Bacteria | 1663 |
| 264 | Ga0207664_10299567 | 3300025929 | Bacteria | 1414 |
| 265 | Ga0207664_11256635 | 3300025929 | Bacteria | 659 |
| 266 | Ga0207686_10024646 | 3300025934 | Bacteria | 3489 |
| 267 | Ga0207709_10203176 | 3300025935 | Bacteria | 1417 |
| 268 | Ga0207670_11331471 | 3300025936 | Bacteria | 609 |
| 269 | Ga0207669_10565291 | 3300025937 | Bacteria | 920 |
| 270 | Ga0207665_10007909 | 3300025939 | Bacteria | 7025 |
| 271 | Ga0207665_10008012 | 3300025939 | Bacteria | 6969 |
| 272 | Ga0207665_10294620 | 3300025939 | Bacteria | 1211 |
| 273 | Ga0207665_10457518 | 3300025939 | Bacteria | 980 |
| 274 | Ga0207691_10038381 | 3300025940 | Bacteria | 4433 |
| 275 | Ga0207711_10103166 | 3300025941 | Bacteria | 2525 |
| 276 | Ga0207711_10717785 | 3300025941 | Bacteria | 932 |
| 277 | Ga0207689_10013895 | 3300025942 | Bacteria | 6858 |
| 278 | Ga0207679_10947762 | 3300025945 | Bacteria | 788 |
| 279 | Ga0207667_10170709 | 3300025949 | Bacteria | 2235 |
| 280 | Ga0207712_10231000 | 3300025961 | Bacteria | 1485 |
| 281 | Ga0207658_10147161 | 3300025986 | Bacteria | 1915 |
| 282 | Ga0207677_10157773 | 3300026023 | Bacteria | 1759 |
| 283 | Ga0207703_10513348 | 3300026035 | Bacteria | 1126 |
| 284 | Ga0207639_10261494 | 3300026041 | Bacteria | 1514 |
| 285 | Ga0207639_10703372 | 3300026041 | Bacteria | 938 |
| 286 | Ga0207639_10733942 | 3300026041 | Bacteria | 918 |
| 287 | Ga0207678_10013076 | 3300026067 | Bacteria | 7282 |
| 288 | Ga0207678_10125306 | 3300026067 | Bacteria | 2192 |
| 289 | Ga0207678_10776492 | 3300026067 | Bacteria | 845 |
| 290 | Ga0207708_10052090 | 3300026075 | Bacteria | 3118 |
| 291 | Ga0207702_10130440 | 3300026078 | Bacteria | 2261 |
| 292 | Ga0207702_10182912 | 3300026078 | Bacteria | 1931 |
| 293 | Ga0207702_10595993 | 3300026078 | Bacteria | 1084 |
| 294 | Ga0207702_10729926 | 3300026078 | Bacteria | 977 |
| 295 | Ga0207641_10081544 | 3300026088 | Bacteria | 2809 |
| 296 | Ga0207648_10799801 | 3300026089 | Bacteria | 878 |
| 297 | Ga0207676_10185399 | 3300026095 | Bacteria | 1826 |
| 298 | Ga0207674_10019026 | 3300026116 | Bacteria | 7442 |
| 299 | Ga0207674_10205593 | 3300026116 | Bacteria | 1918 |
| 300 | Ga0207675_100025028 | 3300026118 | Bacteria | 5555 |
| 301 | Ga0207683_10014371 | 3300026121 | Bacteria | 6744 |
| 302 | Ga0207698_10488362 | 3300026142 | Bacteria | 1196 |
| 303 | Ga0268266_10296170 | 3300028379 | Bacteria | 1508 |
| 304 | Ga0268266_11310571 | 3300028379 | Bacteria | 699 |
| 305 | Ga0373930_0009124 | 3300034816 | Bacteria | 1749 |
| 306 | Ga0373950_0063571 | 3300034818 | Bacteria | 745 |
| 307 | Ga0373938_0041886 | 3300034957 | Bacteria | 1020 |
| 308 | Ga0373926_0002888 | 3300035083 | Bacteria | 5505 |
| 309 | Ga0373926_0005963 | 3300035083 | Bacteria | 4032 |
| 310 | Ga0373928_0029374 | 3300035084 | Bacteria | 1209 |
| 311 | Ga0373934_0037522 | 3300035086 | Bacteria | 1908 |
| 312 | Ga0373934_0077032 | 3300035086 | Bacteria | 1337 |
| 313 | Ga0373940_0007051 | 3300035088 | Bacteria | 2522 |
| 314 | Ga0373944_0000349 | 3300035089 | Bacteria | 10418 |
| 315 | Ga0373944_0002650 | 3300035089 | Bacteria | 4560 |
| 316 | Ga0373951_0026081 | 3300035091 | Bacteria | 1360 |
| 317 | Ga0373952_0010787 | 3300035092 | Bacteria | 1772 |
| 318 | Ga0373923_0002644 | 3300035111 | Bacteria | 5563 |
| 319 | Ga0373923_0032028 | 3300035111 | Bacteria | 2122 |
| 320 | Ga0373932_0051658 | 3300035112 | Bacteria | 1222 |
| 321 | Ga0373936_0000220 | 3300035113 | Bacteria | 18777 |
| 322 | Ga0373936_0002061 | 3300035113 | Bacteria | 7452 |
| 323 | Ga0373939_0160164 | 3300035114 | Bacteria | 826 |
| 324 | Ga0373941_0498303 | 3300035115 | Bacteria | 518 |
| 325 | Ga0373945_0000244 | 3300035116 | Bacteria | 15102 |
| 326 | Ga0373945_0010337 | 3300035116 | Bacteria | 3071 |
| 327 | Ga0373945_0458300 | 3300035116 | Bacteria | 564 |
| 328 | Ga0373953_0004307 | 3300035117 | Bacteria | 4525 |
| 329 | Ga0373953_0100713 | 3300035117 | Bacteria | 1215 |
| 330 | Ga0373954_0036710 | 3300035118 | Bacteria | 2275 |
| 331 | Ga0373954_0038359 | 3300035118 | Bacteria | 2228 |
| 332 | Ga0373956_0029995 | 3300035119 | Bacteria | 2374 |
| 333 | Ga0373956_0068649 | 3300035119 | Bacteria | 1615 |
| 334 | Ga0373957_0028958 | 3300035120 | Bacteria | 2020 |
| 335 | Ga0373960_0066620 | 3300035121 | Bacteria | 1104 |
| 336 | Ga0373960_0102143 | 3300035121 | Bacteria | 931 |
| 337 | Ga0373943_0000328 | 3300035170 | Bacteria | 19825 |
| 338 | Ga0373943_0095592 | 3300035170 | Bacteria | 1545 |
| 339 | Ga0373943_0400356 | 3300035170 | Bacteria | 792 |
| 340 | Ga0373946_0003022 | 3300035171 | Bacteria | 5961 |
| 341 | Ga0373946_0005982 | 3300035171 | Bacteria | 4411 |
| 342 | Ga0373955_0069219 | 3300035172 | Bacteria | 1968 |
| 343 | Ga0373955_0218255 | 3300035172 | Bacteria | 1138 |
| 344 | Ga0373942_0034436 | 3300035207 | Bacteria | 1355 |
| 345 | Ga0373962_0117907 | 3300035242 | Bacteria | 844 |
| 346 | Ga0373924_0002268 | 3300035410 | Bacteria | 6452 |
| 347 | Ga0373924_0013650 | 3300035410 | Bacteria | 3055 |
| 348 | Ga0373924_0250202 | 3300035410 | Bacteria | 784 |
| 349 | Ga0373931_0052813 | 3300035691 | Bacteria | 2168 |
| 350 | Ga0373931_0453216 | 3300035691 | Bacteria | 821 |
| 351 | Ga0373935_0030952 | 3300035692 | Bacteria | 3317 |
| 352 | Ga0373935_0477346 | 3300035692 | Bacteria | 903 |
| 353 | Ga0373935_0860706 | 3300035692 | Bacteria | 670 |
| 354 | Ga0373927_0001015 | 3300035695 | Bacteria | 21352 |
| 355 | Ga0373927_0021392 | 3300035695 | Bacteria | 4239 |
| 356 | Ga0373927_0106195 | 3300035695 | Bacteria | 1828 |
| 357 | Ga0373927_0228918 | 3300035695 | Bacteria | 1221 |
| 358 | Ga0373927_0413735 | 3300035695 | Bacteria | 890 |
| 359 | Ga0373933_0090983 | 3300035724 | Bacteria | 1882 |
| 360 | Ga0373933_0677664 | 3300035724 | Bacteria | 678 |
| 361 | Ga0373947_0004111 | 3300035725 | Bacteria | 8555 |
| 362 | Ga0373947_0141480 | 3300035725 | Bacteria | 1543 |
| 363 | Ga0373947_0221585 | 3300035725 | Bacteria | 1243 |
| 364 | Ga0373937_0084844 | 3300036401 | Bacteria | 2930 |
| 365 | Ga0373937_0494278 | 3300036401 | Bacteria | 1162 |
| 366 | Ga0373937_0656521 | 3300036401 | Bacteria | 994 |
| 367 | Ga0373937_0968466 | 3300036401 | Bacteria | 799 |
| 368 | Ga0373937_1069770 | 3300036401 | Bacteria | 755 |
| 369 | Ga0373937_1104962 | 3300036401 | Bacteria | 741 |
| 370 | Ga0373937_1821175 | 3300036401 | Bacteria | 555 |
| 371 | Ga0372808_003311 | 3300036459 | Bacteria | 1962 |
| 372 | Ga0373925_0006981 | 3300037068 | Bacteria | 8255 |
| 373 | Ga0373925_0014178 | 3300037068 | Bacteria | 5767 |
| 374 | Ga0373925_0022145 | 3300037068 | Bacteria | 4633 |
| 375 | Ga0373925_0209558 | 3300037068 | Bacteria | 1552 |
| 376 | Ga0373925_0996029 | 3300037068 | Bacteria | 690 |
| 377 | Ga0373925_1633668 | 3300037068 | Bacteria | 526 |
| 378 | Ga0373925_1637137 | 3300037068 | Bacteria | 526 |
| 379 | Ga0436364_0013975 | 3300037853 | Bacteria | 25101 |
| 380 | Ga0436364_0330208 | 3300037853 | Bacteria | 1727 |
| 381 | Ga0436364_0330965 | 3300037853 | Bacteria | 247749 |
| 382 | Ga0436364_0523777 | 3300037853 | Bacteria | 1285 |
| 383 | Ga0436364_0568233 | 3300037853 | Bacteria | 710 |
| 384 | Ga0436364_0822474 | 3300037853 | Bacteria | 1075 |
| 385 | Ga0436364_1219808 | 3300037853 | Bacteria | 755 |
| 386 | Ga0451791_1882902 | 3300041451 | Bacteria | 4587 |
| 387 | Ga0451793_0891137 | 3300041452 | Bacteria | 5995 |
| 388 | Ga0451797_0767417 | 3300041453 | Bacteria | 4595 |
| 389 | Ga0451800_0306817 | 3300041459 | Bacteria | 2356 |
| 390 | Ga0451800_1679606 | 3300041459 | Bacteria | 607 |
| 391 | Ga0451802_0325693 | 3300041460 | Bacteria | 2135 |
| 392 | Ga0451807_0387374 | 3300041486 | Unclassified | 667 |
| 393 | Ga0451807_1940652 | 3300041486 | Bacteria | 2617 |
| 394 | Ga0451833_1256610 | 3300041491 | Bacteria | 1443 |
| 395 | Ga0451839_0327400 | 3300041496 | Bacteria | 4141 |
| 396 | Ga0451851_0921811 | 3300041507 | Bacteria | 1754 |
| 397 | Ga0451843_0308118 | 3300041509 | Bacteria | 3730 |
| 398 | Ga0451843_0789792 | 3300041509 | Bacteria | 574 |
| 399 | Ga0451855_1054667 | 3300041511 | Bacteria | 2565 |
| 400 | Ga0451853_0078570 | 3300041512 | Bacteria | 5893 |
| 401 | Ga0466969_0044242 | 3300044656 | Bacteria | 2216 |
| 402 | Ga0466969_0056950 | 3300044656 | Bacteria | 1907 |
| 403 | Ga0466969_0088483 | 3300044656 | Bacteria | 1470 |
| 404 | Ga0466972_0001928 | 3300044658 | Bacteria | 10180 |
| 405 | Ga0466972_0094327 | 3300044658 | Bacteria | 1418 |
| 406 | Ga0466972_0373940 | 3300044658 | Bacteria | 667 |
| 407 | Ga0466965_0019568 | 3300044683 | Bacteria | 3251 |
| 408 | Ga0466965_0308165 | 3300044683 | Bacteria | 860 |
| 409 | Ga0466966_0018194 | 3300044684 | Bacteria | 4636 |
| 410 | Ga0466966_0032574 | 3300044684 | Bacteria | 3377 |
| 411 | Ga0466966_0045518 | 3300044684 | Bacteria | 2805 |
| 412 | Ga0466966_0045717 | 3300044684 | Bacteria | 2798 |
| 413 | Ga0466966_0085305 | 3300044684 | Bacteria | 1963 |
| 414 | Ga0466966_0216308 | 3300044684 | Bacteria | 1157 |
| 415 | Ga0466966_0228031 | 3300044684 | Bacteria | 1124 |
| 416 | Ga0466966_0394600 | 3300044684 | Bacteria | 831 |
| 417 | Ga0466961_0013613 | 3300044693 | Bacteria | 5211 |
| 418 | Ga0466961_0013774 | 3300044693 | Bacteria | 5182 |
| 419 | Ga0466961_0045731 | 3300044693 | Bacteria | 2800 |
| 420 | Ga0466961_0046415 | 3300044693 | Bacteria | 2778 |
| 421 | Ga0466961_0057207 | 3300044693 | Bacteria | 2483 |
| 422 | Ga0466961_0076854 | 3300044693 | Bacteria | 2115 |
| 423 | Ga0466961_0162939 | 3300044693 | Bacteria | 1390 |
| 424 | Ga0466961_0279809 | 3300044693 | Bacteria | 1021 |
| 425 | Ga0466961_0282563 | 3300044693 | Bacteria | 1015 |
| 426 | Ga0466961_0294270 | 3300044693 | Bacteria | 992 |
| 427 | Ga0466961_0591652 | 3300044693 | Bacteria | 667 |
| 428 | Ga0466961_0813556 | 3300044693 | Bacteria | 557 |
| 429 | Ga0466963_0003782 | 3300044694 | Bacteria | 8723 |
| 430 | Ga0466963_0009176 | 3300044694 | Bacteria | 5949 |
| 431 | Ga0466963_0015878 | 3300044694 | Bacteria | 4674 |
| 432 | Ga0466963_0064176 | 3300044694 | Bacteria | 2460 |
| 433 | Ga0466963_0087549 | 3300044694 | Bacteria | 2118 |
| 434 | Ga0466963_0105200 | 3300044694 | Bacteria | 1934 |
| 435 | Ga0466963_0149388 | 3300044694 | Bacteria | 1622 |
| 436 | Ga0466963_0228342 | 3300044694 | Bacteria | 1304 |
| 437 | Ga0466963_0461598 | 3300044694 | Bacteria | 896 |
| 438 | Ga0466963_0526167 | 3300044694 | Bacteria | 835 |
| 439 | Ga0466964_0056936 | 3300044706 | Bacteria | 1617 |
| 440 | Ga0466964_0108360 | 3300044706 | Bacteria | 1235 |
| 441 | Ga0466964_0237389 | 3300044706 | Bacteria | 893 |
| 442 | Ga0466971_0003749 | 3300044719 | Bacteria | 6507 |
| 443 | Ga0466971_0010319 | 3300044719 | Bacteria | 4080 |
| 444 | Ga0466971_0044272 | 3300044719 | Bacteria | 1999 |
| 445 | Ga0466971_0053248 | 3300044719 | Bacteria | 1824 |
| 446 | Ga0466971_0181085 | 3300044719 | Bacteria | 991 |
| 447 | Ga0466971_0292082 | 3300044719 | Bacteria | 782 |
| 448 | Ga0466970_0017937 | 3300044765 | Bacteria | 3662 |
| 449 | Ga0466970_0085045 | 3300044765 | Bacteria | 1713 |
| 450 | Ga0466957_0023089 | 3300044842 | Bacteria | 3673 |
| 451 | Ga0466957_0036271 | 3300044842 | Bacteria | 2964 |
| 452 | Ga0466957_0067924 | 3300044842 | Bacteria | 2200 |
| 453 | Ga0466957_0070187 | 3300044842 | Bacteria | 2165 |
| 454 | Ga0466957_0101781 | 3300044842 | Bacteria | 1812 |
| 455 | Ga0466957_0103868 | 3300044842 | Bacteria | 1795 |
| 456 | Ga0466957_0126574 | 3300044842 | Bacteria | 1633 |
| 457 | Ga0466957_0140355 | 3300044842 | Bacteria | 1556 |
| 458 | Ga0466957_0142365 | 3300044842 | Bacteria | 1546 |
| 459 | Ga0466960_0001543 | 3300044901 | Bacteria | 8413 |
| 460 | Ga0466960_0013370 | 3300044901 | Bacteria | 3486 |
| 461 | Ga0466960_0288210 | 3300044901 | Bacteria | 922 |
| 462 | Ga0466960_0331690 | 3300044901 | Bacteria | 864 |
| 463 | Ga0466959_0012675 | 3300045049 | Bacteria | 6098 |
| 464 | Ga0466959_0023498 | 3300045049 | Bacteria | 4561 |
| 465 | Ga0466959_0088762 | 3300045049 | Bacteria | 2222 |
| 466 | Ga0466959_0114210 | 3300045049 | Bacteria | 1925 |
| 467 | Ga0466959_0147517 | 3300045049 | Bacteria | 1659 |
| 468 | Ga0466959_0190809 | 3300045049 | Bacteria | 1430 |
| 469 | Ga0466959_0289632 | 3300045049 | Bacteria | 1123 |
| 470 | Ga0466959_0331075 | 3300045049 | Bacteria | 1040 |
| 471 | Ga0466959_0784926 | 3300045049 | Bacteria | 637 |
| 472 | Ga0466958_0007363 | 3300045836 | Bacteria | 6048 |
| 473 | Ga0466958_0011657 | 3300045836 | Bacteria | 4956 |
| 474 | Ga0466958_0014164 | 3300045836 | Bacteria | 4551 |
| 475 | Ga0466958_0015139 | 3300045836 | Bacteria | 4414 |
| 476 | Ga0466958_0152919 | 3300045836 | Bacteria | 1456 |
| 477 | Ga0466958_0256570 | 3300045836 | Bacteria | 1119 |
| 478 | Ga0466958_0558598 | 3300045836 | Bacteria | 744 |
| 479 | Ga0466958_0853147 | 3300045836 | Unclassified | 594 |
| 480 | Ga0466967_0002591 | 3300045976 | Bacteria | 11366 |
| 481 | Ga0466967_0003155 | 3300045976 | Bacteria | 10623 |
| 482 | Ga0466967_0008682 | 3300045976 | Bacteria | 7477 |
| 483 | Ga0466967_0009725 | 3300045976 | Bacteria | 7161 |
| 484 | Ga0466967_0040529 | 3300045976 | Bacteria | 4010 |
| 485 | Ga0466967_0051580 | 3300045976 | Bacteria | 3606 |
| 486 | Ga0466967_0124968 | 3300045976 | Bacteria | 2382 |
| 487 | Ga0466967_0126909 | 3300045976 | Bacteria | 2364 |
| 488 | Ga0466967_0145372 | 3300045976 | Bacteria | 2212 |
| 489 | Ga0466967_0190693 | 3300045976 | Bacteria | 1937 |
| 490 | Ga0466967_0218976 | 3300045976 | Bacteria | 1808 |
| 491 | Ga0466967_0228620 | 3300045976 | Bacteria | 1770 |
| 492 | Ga0466967_0250890 | 3300045976 | Bacteria | 1690 |
| 493 | Ga0466967_0266909 | 3300045976 | Bacteria | 1639 |
| 494 | Ga0466967_0281027 | 3300045976 | Bacteria | 1597 |
| 495 | Ga0466967_0522630 | 3300045976 | Bacteria | 1166 |
| 496 | Ga0466967_0641029 | 3300045976 | Unclassified | 1050 |
| 497 | Ga0466967_0746450 | 3300045976 | Bacteria | 970 |
| 498 | Ga0466967_0828858 | 3300045976 | Bacteria | 919 |
| 499 | Ga0495592_0011533 | 3300046454 | Bacteria | 6691 |
| 500 | Ga0495592_0683676 | 3300046454 | Bacteria | 619 |
| 501 | Ga0495603_0018166 | 3300046455 | Bacteria | 4254 |
| 502 | Ga0495629_0001817 | 3300046459 | Bacteria | 16723 |
| 503 | Ga0495641_0009894 | 3300046461 | Bacteria | 5611 |
| 504 | Ga0495651_0008481 | 3300046462 | Bacteria | 7875 |
| 505 | Ga0495651_0013256 | 3300046462 | Bacteria | 6375 |
| 506 | Ga0495651_0130257 | 3300046462 | Bacteria | 1837 |
| 507 | Ga0495653_0041530 | 3300046463 | Bacteria | 3589 |
| 508 | Ga0495653_0041616 | 3300046463 | Bacteria | 3585 |
| 509 | Ga0495653_0313028 | 3300046463 | Bacteria | 1020 |
| 510 | Ga0495653_0437813 | 3300046463 | Bacteria | 824 |
| 511 | Ga0495653_0486187 | 3300046463 | Bacteria | 771 |
| 512 | Ga0495580_0003452 | 3300046472 | Bacteria | 13458 |
| 513 | Ga0495580_0344299 | 3300046472 | Bacteria | 1011 |
| 514 | Ga0495582_0001974 | 3300046473 | Bacteria | 11516 |
| 515 | Ga0495582_0127185 | 3300046473 | Bacteria | 1438 |
| 516 | Ga0495639_0001194 | 3300046475 | Bacteria | 11725 |
| 517 | Ga0495639_0034631 | 3300046475 | Bacteria | 2259 |
| 518 | Ga0495662_0000398 | 3300046476 | Bacteria | 19448 |
| 519 | Ga0495662_0005224 | 3300046476 | Bacteria | 6509 |
| 520 | Ga0495664_0000170 | 3300046477 | Bacteria | 31859 |
| 521 | Ga0495664_0105775 | 3300046477 | Bacteria | 1696 |
| 522 | Ga0495664_0374450 | 3300046477 | Bacteria | 856 |
| 523 | Ga0495594_0059990 | 3300046499 | Bacteria | 2104 |
| 524 | Ga0495608_0015028 | 3300046511 | Bacteria | 5370 |
| 525 | Ga0495608_0057961 | 3300046511 | Bacteria | 2554 |
| 526 | Ga0495608_0175594 | 3300046511 | Bacteria | 1357 |
| 527 | Ga0495608_0340904 | 3300046511 | Bacteria | 923 |
| 528 | Ga0495618_0004682 | 3300046514 | Bacteria | 8368 |
| 529 | Ga0495618_0010066 | 3300046514 | Bacteria | 5719 |
| 530 | Ga0495618_0111389 | 3300046514 | Bacteria | 1752 |
| 531 | Ga0495628_0023071 | 3300046516 | Bacteria | 5108 |
| 532 | Ga0495628_0099518 | 3300046516 | Bacteria | 2245 |
| 533 | Ga0495628_0100173 | 3300046516 | Bacteria | 2237 |
| 534 | Ga0495628_0225188 | 3300046516 | Bacteria | 1407 |
| 535 | Ga0495628_0247287 | 3300046516 | Bacteria | 1332 |
| 536 | Ga0495630_0003909 | 3300046517 | Bacteria | 10416 |
| 537 | Ga0495630_0010026 | 3300046517 | Bacteria | 6824 |
| 538 | Ga0495666_0000939 | 3300046526 | Bacteria | 13683 |
| 539 | Ga0495652_0029193 | 3300046529 | Bacteria | 4845 |
| 540 | Ga0495652_0038612 | 3300046529 | Bacteria | 4135 |
| 541 | Ga0495652_0171940 | 3300046529 | Bacteria | 1671 |
| 542 | Ga0495665_0004598 | 3300046531 | Bacteria | 7446 |
| 543 | Ga0495665_0011845 | 3300046531 | Bacteria | 4722 |
| 544 | Ga0495665_0167735 | 3300046531 | Bacteria | 1143 |
| 545 | Ga0495640_0013776 | 3300046533 | Bacteria | 6144 |
| 546 | Ga0495640_0033054 | 3300046533 | Bacteria | 3678 |
| 547 | Ga0495586_0008699 | 3300046535 | Bacteria | 5405 |
| 548 | Ga0495587_0029523 | 3300046536 | Bacteria | 3328 |
| 549 | Ga0495587_0055643 | 3300046536 | Bacteria | 2329 |
| 550 | Ga0495645_0008023 | 3300046543 | Bacteria | 7351 |
| 551 | Ga0495645_0025282 | 3300046543 | Bacteria | 4309 |
| 552 | Ga0495645_0204804 | 3300046543 | Bacteria | 1336 |
| 553 | Ga0495645_0770122 | 3300046543 | Bacteria | 579 |
| 554 | Ga0495622_0107181 | 3300046557 | Bacteria | 1280 |
| 555 | Ga0495667_0019737 | 3300046559 | Bacteria | 4548 |
| 556 | Ga0495667_0057085 | 3300046559 | Bacteria | 2566 |
| 557 | Ga0495667_0094988 | 3300046559 | Bacteria | 1930 |
| 558 | Ga0495634_0005420 | 3300046642 | Bacteria | 9821 |
| 559 | Ga0495635_0006037 | 3300046663 | Bacteria | 8445 |
| 560 | Ga0495635_0006196 | 3300046663 | Bacteria | 8335 |
| 561 | Ga0495635_0028640 | 3300046663 | Bacteria | 3871 |
| 562 | Ga0495588_0022428 | 3300046674 | Bacteria | 3121 |
| 563 | Ga0495657_0017348 | 3300046675 | Bacteria | 5227 |
| 564 | Ga0495657_0018258 | 3300046675 | Bacteria | 5081 |
| 565 | Ga0495657_0022575 | 3300046675 | Bacteria | 4505 |
| 566 | Ga0495657_0046655 | 3300046675 | Bacteria | 2932 |
| 567 | Ga0495657_0330797 | 3300046675 | Bacteria | 904 |
| 568 | Ga0495599_0013984 | 3300046678 | Bacteria | 4969 |
| 569 | Ga0495599_0043570 | 3300046678 | Bacteria | 2816 |
| 570 | Ga0495599_0168814 | 3300046678 | Bacteria | 1350 |
| 571 | Ga0495623_0007854 | 3300046679 | Bacteria | 6938 |
| 572 | Ga0495623_0048096 | 3300046679 | Bacteria | 2706 |
| 573 | Ga0495646_0004595 | 3300046680 | Bacteria | 8701 |
| 574 | Ga0495646_0116881 | 3300046680 | Bacteria | 1512 |
| 575 | Ga0495647_0004707 | 3300046681 | Bacteria | 4451 |
| 576 | Ga0495647_0234265 | 3300046681 | Bacteria | 814 |
| 577 | Ga0495658_0001230 | 3300046683 | Bacteria | 13450 |
| 578 | Ga0495658_0048932 | 3300046683 | Bacteria | 2386 |
| 579 | Ga0495613_0018898 | 3300046689 | Bacteria | 5133 |
| 580 | Ga0495624_0012799 | 3300046690 | Bacteria | 5728 |
| 581 | Ga0495624_0030650 | 3300046690 | Bacteria | 3501 |
| 582 | Ga0495600_0009486 | 3300046809 | Bacteria | 6016 |
| 583 | Ga0495600_0020614 | 3300046809 | Bacteria | 4215 |
| 584 | Ga0495600_0084737 | 3300046809 | Bacteria | 2068 |
| 585 | Ga0495581_0004566 | 3300047315 | Bacteria | 8001 |
| 586 | Ga0495581_0024300 | 3300047315 | Bacteria | 3512 |
| 587 | Ga0495581_0359569 | 3300047315 | Bacteria | 850 |
| 588 | Ga0495581_0535547 | 3300047315 | Bacteria | 680 |
| 589 | Ga0495604_0008319 | 3300047317 | Bacteria | 8204 |
| 590 | Ga0495604_0875481 | 3300047317 | Bacteria | 562 |
| 591 | Ga0495674_0002355 | 3300047319 | Bacteria | 18525 |
| 592 | Ga0495674_0048120 | 3300047319 | Bacteria | 3775 |
| 593 | Ga0495674_0051728 | 3300047319 | Bacteria | 3620 |
| 594 | Ga0495674_0163269 | 3300047319 | Bacteria | 1862 |
| 595 | Ga0495674_0285600 | 3300047319 | Bacteria | 1351 |
| 596 | Ga0495676_0011421 | 3300047321 | Bacteria | 8017 |
| 597 | Ga0495676_0045228 | 3300047321 | Bacteria | 3585 |
| 598 | Ga0495680_0038103 | 3300047322 | Bacteria | 3845 |
| 599 | Ga0495680_0063651 | 3300047322 | Bacteria | 2831 |
| 600 | Ga0495675_0004769 | 3300047444 | Bacteria | 8237 |
| 601 | Ga0495675_0068466 | 3300047444 | Bacteria | 2242 |
| 602 | Ga0495675_0320457 | 3300047444 | Bacteria | 917 |
| 603 | Ga0495675_0625907 | 3300047444 | Bacteria | 608 |
| 604 | Ga0495684_0002594 | 3300047471 | Bacteria | 14368 |
| 605 | Ga0495684_0020457 | 3300047471 | Bacteria | 5100 |
| 606 | Ga0495684_0037890 | 3300047471 | Bacteria | 3698 |
| 607 | Ga0495684_0058809 | 3300047471 | Bacteria | 2927 |
| 608 | Ga0495684_0593354 | 3300047471 | Bacteria | 748 |
| 609 | Ga0495593_0019075 | 3300047673 | Bacteria | 3849 |
| 610 | Ga0495593_0190687 | 3300047673 | Bacteria | 1031 |
| 611 | Ga0495602_0058577 | 3300048088 | Bacteria | 3370 |
| 612 | Ga0495602_0098847 | 3300048088 | Bacteria | 2400 |
| 613 | Ga0495602_0276032 | 3300048088 | Bacteria | 1240 |
| 614 | Ga0495614_0022151 | 3300048089 | Bacteria | 2743 |
| 615 | Ga0495614_0094067 | 3300048089 | Bacteria | 1306 |
| 616 | Ga0496102_0000207 | 3300048905 | Bacteria | 79241 |
| 617 | Ga0496102_0000319 | 3300048905 | Bacteria | 60314 |
| 618 | Ga0496102_0109280 | 3300048905 | Bacteria | 2576 |
| 619 | Ga0496102_0359697 | 3300048905 | Bacteria | 1370 |
| 620 | Ga0496103_0000212 | 3300048906 | Bacteria | 58038 |
| 621 | Ga0496103_0068858 | 3300048906 | Bacteria | 2211 |
| 622 | Ga0496104_0278850 | 3300048907 | Bacteria | 1584 |
| 623 | Ga0496105_0010201 | 3300048908 | Bacteria | 7384 |
| 624 | Ga0496105_0103406 | 3300048908 | Bacteria | 2352 |
| 625 | Ga0496105_0316586 | 3300048908 | Bacteria | 1251 |
| 626 | Ga0496105_0923488 | 3300048908 | Bacteria | 657 |
| 627 | Ga0496106_0087074 | 3300048909 | Bacteria | 2406 |
| 628 | Ga0496107_0229073 | 3300048910 | Bacteria | 1382 |
| 629 | Ga0496108_0014756 | 3300048911 | Bacteria | 6377 |
| 630 | Ga0496108_0816283 | 3300048911 | Bacteria | 804 |
| 631 | Ga0496108_1623043 | 3300048911 | Bacteria | 534 |
| 632 | Ga0496109_0310718 | 3300048912 | Bacteria | 1487 |
| 633 | Ga0496110_0994283 | 3300048913 | Bacteria | 746 |
| 634 | Ga0496111_0080816 | 3300048914 | Bacteria | 2372 |
| 635 | Ga0496111_0263606 | 3300048914 | Bacteria | 1278 |
| 636 | Ga0496111_0265016 | 3300048914 | Bacteria | 1275 |
| 637 | Ga0496113_0513786 | 3300048916 | Bacteria | 961 |
| 638 | Ga0496114_0144837 | 3300048917 | Bacteria | 2059 |
| 639 | Ga0496114_0211022 | 3300048917 | Bacteria | 1703 |
| 640 | Ga0496114_0312725 | 3300048917 | Bacteria | 1387 |
| 641 | Ga0496115_0279677 | 3300048918 | Bacteria | 1370 |
| 642 | Ga0496119_0002555 | 3300048922 | Bacteria | 19813 |
| 643 | Ga0496119_0022658 | 3300048922 | Bacteria | 4487 |
| 644 | Ga0496121_0039876 | 3300048924 | Bacteria | 4130 |
| 645 | Ga0496126_0100931 | 3300048929 | Bacteria | 2525 |
| 646 | Ga0496126_0428739 | 3300048929 | Bacteria | 1068 |
| 647 | Ga0501031_0095666 | 3300049568 | Bacteria | 1938 |
| 648 | Ga0501032_0057737 | 3300049569 | Bacteria | 2607 |
| 649 | Ga0501033_0069431 | 3300049570 | Bacteria | 2590 |
| 650 | Ga0501033_0276513 | 3300049570 | Bacteria | 1186 |
| 651 | Ga0501033_0671739 | 3300049570 | Bacteria | 706 |
| 652 | Ga0501034_0227328 | 3300049571 | Bacteria | 1816 |
| 653 | Ga0501034_1366245 | 3300049571 | Bacteria | 584 |
| 654 | Ga0501036_0692631 | 3300049572 | Bacteria | 842 |
| 655 | Ga0501037_0205911 | 3300049573 | Bacteria | 1389 |
| 656 | Ga0501038_0086346 | 3300049574 | Bacteria | 2636 |
| 657 | Ga0501038_0309134 | 3300049574 | Bacteria | 1239 |
| 658 | Ga0501038_0413228 | 3300049574 | Bacteria | 1042 |
| 659 | Ga0501043_0057869 | 3300049579 | Bacteria | 3043 |
| 660 | Ga0501046_0103946 | 3300049580 | Bacteria | 2177 |
| 661 | Ga0501047_0025144 | 3300049581 | Bacteria | 5721 |
| 662 | Ga0501047_0043554 | 3300049581 | Bacteria | 4336 |
| 663 | Ga0501047_0075259 | 3300049581 | Bacteria | 3249 |
| 664 | Ga0501047_0345922 | 3300049581 | Bacteria | 1324 |
| 665 | Ga0501048_0003895 | 3300049582 | Bacteria | 11349 |
| 666 | Ga0501069_0637513 | 3300049585 | Bacteria | 641 |
| 667 | Ga0501070_0007806 | 3300049586 | Bacteria | 9072 |
| 668 | Ga0501070_0540134 | 3300049586 | Bacteria | 934 |
| 669 | Ga0501074_0202457 | 3300049590 | Bacteria | 1415 |
| 670 | Ga0501080_0143356 | 3300049742 | Bacteria | 2209 |
| 671 | Ga0501081_0074720 | 3300049743 | Bacteria | 2365 |
| 672 | Ga0501035_0091395 | 3300049822 | Bacteria | 2679 |
| 673 | Ga0501035_0179648 | 3300049822 | Bacteria | 1824 |
| 674 | Ga0501044_0140530 | 3300049823 | Bacteria | 2404 |
| 675 | Ga0501044_0189961 | 3300049823 | Bacteria | 2017 |
| 676 | nmdc:mga0n895_397088_c1 | 3300050512 | Bacteria | 1395 |
| 677 | nmdc:mga0rr50_248139_c1 | 3300050513 | Bacteria | 1477 |
| 678 | nmdc:mga0rr50_349966_c1 | 3300050513 | Bacteria | 1242 |
| 679 | nmdc:mga0a205_144637_c1 | 3300050515 | Bacteria | 2277 |
| 680 | Ga0495601_0369456 | 3300053077 | Bacteria | 932 |
| 681 | Ga0495595_0027287 | 3300053084 | Bacteria | 2543 |
| 682 | Ga0495595_0229197 | 3300053084 | Bacteria | 928 |
| 683 | Ga0495619_0001376 | 3300053085 | Bacteria | 16004 |
| 684 | Ga0495619_0024304 | 3300053085 | Bacteria | 3885 |
| 685 | Ga0500568_0079433 | 3300053139 | Bacteria | 1247 |
| 686 | Ga0500636_0244260 | 3300053177 | Unclassified | 920 |
| 687 | Ga0501082_1441313 | 3300060353 | Bacteria | 601 |
| 688 | Ga0466962_0003981 | 3300061719 | Bacteria | 7073 |
| 689 | Ga0466962_0006353 | 3300061719 | Bacteria | 5674 |
| 690 | Ga0466962_0013272 | 3300061719 | Bacteria | 3962 |
| 691 | Ga0466962_0115753 | 3300061719 | Bacteria | 1292 |
| 692 | 2523387526 | 2523231044 | Bacteria | 6434991 |
| 693 | 2753037632 | 2751185725 | Bacteria | 5740550 |
| 694 | 2753325500 | 2751185792 | Bacteria | 5739090 |
| 695 | 2842890389 | 2842888712 | Bacteria | 4279094 |
| 696 | Ga0436364_1001861 | |||
| 697 | rootH2_10023503 | |||
| 698 | Ga0070658_10100165 | |||
| 699 | Ga0070658_10910627 | |||
| 700 | Ga0070683_100119670 | |||
| 701 | Ga0070690_100058556 | |||
| 702 | Ga0070670_100673061 | |||
| 703 | Ga0070670_101006264 | |||
| 704 | Ga0068869_100106552 | |||
| 705 | Ga0068869_100232617 | |||
| 706 | Ga0070680_100011567 | |||
| 707 | Ga0070682_100209505 | |||
| 708 | Ga0070682_100327288 | |||
| 709 | Ga0070682_100670086 | |||
| 710 | Ga0070660_100701829 | |||
| 711 | Ga0070689_100020282 | |||
| 712 | Ga0070691_10470068 | |||
| 713 | Ga0070661_100083340 | |||
| 714 | Ga0070692_10167911 | |||
| 715 | Ga0070669_101095310 | |||
| 716 | Ga0070675_100292912 | |||
| 717 | Ga0070671_101274366 | |||
| 718 | Ga0070674_100152178 | |||
| 719 | Ga0070673_100026254 | |||
| 720 | Ga0070688_100723273 | |||
| 721 | Ga0070659_100330533 | |||
| 722 | Ga0070709_10090457 | |||
| 723 | Ga0070709_10209342 | |||
| 724 | Ga0070709_10352021 | |||
| 725 | Ga0070709_10376374 | |||
| 726 | Ga0070709_10930944 | |||
| 727 | Ga0070709_11462355 | |||
| 728 | Ga0070714_100081480 | |||
| 729 | Ga0070714_100254618 | |||
| 730 | Ga0070714_100327285 | |||
| 731 | Ga0070714_100401607 | |||
| 732 | Ga0070714_100412502 | |||
| 733 | Ga0070714_100506431 | |||
| 734 | Ga0070714_100507649 | |||
| 735 | Ga0070714_100638275 | |||
| 736 | Ga0070714_100911612 | |||
| 737 | Ga0070714_101277394 | |||
| 738 | Ga0070714_101837559 | |||
| 739 | Ga0070713_100043323 | |||
| 740 | Ga0070713_100067455 | |||
| 741 | Ga0070713_100368469 | |||
| 742 | Ga0070713_100469274 | |||
| 743 | Ga0070713_100614361 | |||
| 744 | Ga0070710_10052171 | |||
| 745 | Ga0070710_10122688 | |||
| 746 | Ga0070710_10134861 | |||
| 747 | Ga0070711_100199032 | |||
| 748 | Ga0070711_100372681 | |||
| 749 | Ga0070711_100381043 | |||
| 750 | Ga0070711_100439009 | |||
| 751 | Ga0070711_100474261 | |||
| 752 | Ga0070705_100126947 | |||
| 753 | Ga0070700_100161499 | |||
| 754 | Ga0070694_100225101 | |||
| 755 | Ga0070708_100004355 | |||
| 756 | Ga0070708_100004931 | |||
| 757 | Ga0070708_100033029 | |||
| 758 | Ga0070708_100481143 | |||
| 759 | Ga0070663_100163520 | |||
| 760 | Ga0070663_101240257 | |||
| 761 | Ga0070678_100180938 | |||
| 762 | Ga0070678_100183359 | |||
| 763 | Ga0070681_10137395 | |||
| 764 | Ga0070685_10027294 | |||
| 765 | Ga0070706_100023023 | |||
| 766 | Ga0070706_100106567 | |||
| 767 | Ga0070706_100432005 | |||
| 768 | Ga0070706_101249003 | |||
| 769 | Ga0070707_100007741 | |||
| 770 | Ga0070707_100372261 | |||
| 771 | Ga0070707_100568886 | |||
| 772 | Ga0070698_100001345 | |||
| 773 | Ga0070698_100051342 | |||
| 774 | Ga0070698_100091713 | |||
| 775 | Ga0070698_100505586 | |||
| 776 | Ga0070699_100006444 | |||
| 777 | Ga0070679_100094804 | |||
| 778 | Ga0070679_100992385 | |||
| 779 | Ga0070684_100128148 | |||
| 780 | Ga0070684_100396473 | |||
| 781 | Ga0070684_100974526 | |||
| 782 | Ga0070684_101307323 | |||
| 783 | Ga0070697_100019940 | |||
| 784 | Ga0070697_100280084 | |||
| 785 | Ga0070697_100399123 | |||
| 786 | Ga0068853_100052780 | |||
| 787 | Ga0068853_100567458 | |||
| 788 | Ga0068853_100942832 | |||
| 789 | Ga0070686_100004561 | |||
| 790 | Ga0070695_100131834 | |||
| 791 | Ga0070696_100079628 | |||
| 792 | Ga0070693_100031934 | |||
| 793 | Ga0070665_100111979 | |||
| 794 | Ga0070665_100308743 | |||
| 795 | Ga0070665_100314440 | |||
| 796 | Ga0070665_100330020 | |||
| 797 | Ga0070704_100153250 | |||
| 798 | Ga0068855_100185231 | |||
| 799 | Ga0068855_101065753 | |||
| 800 | Ga0068855_102173536 | |||
| 801 | Ga0068857_100102439 | |||
| 802 | Ga0068857_100619906 | |||
| 803 | Ga0068856_100099294 | |||
| 804 | Ga0068856_100118753 | |||
| 805 | Ga0068856_100284665 | |||
| 806 | Ga0068856_100608682 | |||
| 807 | Ga0068852_100266274 | |||
| 808 | Ga0068852_100452038 | |||
| 809 | Ga0068859_100000835 | |||
| 810 | Ga0068859_100131592 | |||
| 811 | Ga0068864_100554267 | |||
| 812 | Ga0068864_100744185 | |||
| 813 | Ga0068866_10005846 | |||
| 814 | Ga0068861_100197437 | |||
| 815 | Ga0068851_10034145 | |||
| 816 | Ga0068870_10022361 | |||
| 817 | Ga0068858_100396634 | |||
| 818 | Ga0068860_100347346 | |||
| 819 | Ga0068860_100734821 | |||
| 820 | Ga0068862_100500596 | |||
| 821 | Ga0081540_1003217 | |||
| 822 | Ga0070717_10174233 | |||
| 823 | Ga0070717_10188469 | |||
| 824 | Ga0070717_10202715 | |||
| 825 | Ga0070717_10402165 | |||
| 826 | Ga0070717_10802122 | |||
| 827 | Ga0070717_10825411 | |||
| 828 | Ga0070717_11277129 | |||
| 829 | Ga0070715_10051068 | |||
| 830 | Ga0070715_10103915 | |||
| 831 | Ga0070716_100055349 | |||
| 832 | Ga0070716_100387731 | |||
| 833 | Ga0070716_100510639 | |||
| 834 | Ga0070716_101410765 | |||
| 835 | Ga0070712_100054704 | |||
| 836 | Ga0070712_100321531 | |||
| 837 | Ga0070712_100382826 | |||
| 838 | Ga0097621_100249899 | |||
| 839 | Ga0068871_100474454 | |||
| 840 | Ga0075434_100376960 | |||
| 841 | Ga0075436_100178689 | |||
| 842 | Ga0097620_100000835 | |||
| 843 | Ga0097620_100131585 | |||
| 844 | Ga0105251_10025103 | |||
| 845 | Ga0105240_10300477 | |||
| 846 | Ga0105245_10147161 | |||
| 847 | Ga0105245_10435926 | |||
| 848 | Ga0105245_10589018 | |||
| 849 | Ga0105247_10021132 | |||
| 850 | Ga0105247_10148114 | |||
| 851 | Ga0105243_10822406 | |||
| 852 | Ga0105241_10118932 | |||
| 853 | Ga0105242_10118512 | |||
| 854 | Ga0105248_10199453 | |||
| 855 | Ga0105248_10336942 | |||
| 856 | Ga0105237_10110865 | |||
| 857 | Ga0105237_10209434 | |||
| 858 | Ga0105237_10416382 | |||
| 859 | Ga0105238_10327732 | |||
| 860 | Ga0105238_11410463 | |||
| 861 | Ga0105249_10129973 | |||
| 862 | Ga0105249_10934810 | |||
| 863 | Ga0105239_10076942 | |||
| 864 | Ga0105239_10282170 | |||
| 865 | Ga0105239_13374034 | |||
| 866 | Ga0105246_10179005 | |||
| 867 | Ga0157337_1020314 | |||
| 868 | Ga0157329_1000718 | |||
| 869 | Ga0157314_1008772 | |||
| 870 | Ga0157324_1034397 | |||
| 871 | Ga0157342_1000128 | |||
| 872 | Ga0157338_1017854 | |||
| 873 | Ga0157373_10573755 | |||
| 874 | Ga0157371_10031125 | |||
| 875 | Ga0157369_11959196 | |||
| 876 | Ga0157374_10006641 | |||
| 877 | Ga0157372_10730662 | |||
| 878 | Ga0157372_10871673 | |||
| 879 | Ga0157372_11015540 | |||
| 880 | Ga0157375_10224067 | |||
| 881 | Ga0157375_10665612 | |||
| 882 | Ga0163163_10390077 | |||
| 883 | Ga0163163_10431211 | |||
| 884 | Ga0157379_10019950 | |||
| 885 | Ga0157379_10505193 | |||
| 886 | Ga0157376_10048776 | |||
| 887 | Ga0163161_10048989 | |||
| 888 | Ga0206356_11553540 | |||
| 889 | Ga0206353_10057171 | |||
| 890 | Ga0206353_10551325 | |||
| 891 | Ga0206353_11480393 | |||
| 892 | Ga0206353_11915281 | |||
| 893 | Ga0206353_11966324 | |||
| 894 | Ga0213875_10000160 | |||
| 895 | Ga0213875_10002622 | |||
| 896 | Ga0213875_10203490 | |||
| 897 | Ga0213875_10284640 | |||
| 898 | Ga0224712_10178743 | |||
| 899 | Ga0207656_10026789 | |||
| 900 | Ga0207653_10006120 | |||
| 901 | Ga0207692_10031806 | |||
| 902 | Ga0207692_10058721 | |||
| 903 | Ga0207692_10153255 | |||
| 904 | Ga0207642_10449757 | |||
| 905 | Ga0207710_10036185 | |||
| 906 | Ga0207680_10692733 | |||
| 907 | Ga0207647_10074583 | |||
| 908 | Ga0207647_10075188 | |||
| 909 | Ga0207647_10184325 | |||
| 910 | Ga0207647_10290078 | |||
| 911 | Ga0207685_10086010 | |||
| 912 | Ga0207685_10154594 | |||
| 913 | Ga0207685_10222814 | |||
| 914 | Ga0207699_10015551 | |||
| 915 | Ga0207699_10028211 | |||
| 916 | Ga0207699_10811386 | |||
| 917 | Ga0207699_11147788 | |||
| 918 | Ga0207705_10047040 | |||
| 919 | Ga0207705_10427593 | |||
| 920 | Ga0207684_10011430 | |||
| 921 | Ga0207684_10035311 | |||
| 922 | Ga0207684_10064069 | |||
| 923 | Ga0207684_10066700 | |||
| 924 | Ga0207654_10132512 | |||
| 925 | Ga0207654_10351760 | |||
| 926 | Ga0207707_10220237 | |||
| 927 | Ga0207671_10262352 | |||
| 928 | Ga0207671_10313909 | |||
| 929 | Ga0207693_10015973 | |||
| 930 | Ga0207663_10050071 | |||
| 931 | Ga0207663_10146629 | |||
| 932 | Ga0207663_10196181 | |||
| 933 | Ga0207660_10393597 | |||
| 934 | Ga0207662_10005260 | |||
| 935 | Ga0207657_10010213 | |||
| 936 | Ga0207657_10524161 | |||
| 937 | Ga0207649_10040928 | |||
| 938 | Ga0207646_10011465 | |||
| 939 | Ga0207646_10454033 | |||
| 940 | Ga0207694_10173720 | |||
| 941 | Ga0207650_10151791 | |||
| 942 | Ga0207687_10098026 | |||
| 943 | Ga0207700_10049136 | |||
| 944 | Ga0207700_10074764 | |||
| 945 | Ga0207700_10089984 | |||
| 946 | Ga0207700_10243625 | |||
| 947 | Ga0207700_10272836 | |||
| 948 | Ga0207700_10714518 | |||
| 949 | Ga0207700_11134331 | |||
| 950 | Ga0207700_11274038 | |||
| 951 | Ga0207664_10048722 | |||
| 952 | Ga0207664_10055010 | |||
| 953 | Ga0207664_10070195 | |||
| 954 | Ga0207664_10100555 | |||
| 955 | Ga0207664_10132698 | |||
| 956 | Ga0207664_10148383 | |||
| 957 | Ga0207664_10174992 | |||
| 958 | Ga0207664_10215450 | |||
| 959 | Ga0207664_10299567 | |||
| 960 | Ga0207664_11256635 | |||
| 961 | Ga0207686_10024646 | |||
| 962 | Ga0207709_10203176 | |||
| 963 | Ga0207670_11331471 | |||
| 964 | Ga0207669_10565291 | |||
| 965 | Ga0207665_10007909 | |||
| 966 | Ga0207665_10008012 | |||
| 967 | Ga0207665_10294620 | |||
| 968 | Ga0207665_10457518 | |||
| 969 | Ga0207691_10038381 | |||
| 970 | Ga0207711_10103166 | |||
| 971 | Ga0207711_10717785 | |||
| 972 | Ga0207689_10013895 | |||
| 973 | Ga0207679_10947762 | |||
| 974 | Ga0207667_10170709 | |||
| 975 | Ga0207712_10231000 | |||
| 976 | Ga0207658_10147161 | |||
| 977 | Ga0207677_10157773 | |||
| 978 | Ga0207703_10513348 | |||
| 979 | Ga0207639_10261494 | |||
| 980 | Ga0207639_10703372 | |||
| 981 | Ga0207639_10733942 | |||
| 982 | Ga0207678_10013076 | |||
| 983 | Ga0207678_10125306 | |||
| 984 | Ga0207678_10776492 | |||
| 985 | Ga0207708_10052090 | |||
| 986 | Ga0207702_10130440 | |||
| 987 | Ga0207702_10182912 | |||
| 988 | Ga0207702_10595993 | |||
| 989 | Ga0207702_10729926 | |||
| 990 | Ga0207641_10081544 | |||
| 991 | Ga0207648_10799801 | |||
| 992 | Ga0207676_10185399 | |||
| 993 | Ga0207674_10019026 | |||
| 994 | Ga0207674_10205593 | |||
| 995 | Ga0207675_100025028 | |||
| 996 | Ga0207683_10014371 | |||
| 997 | Ga0207698_10488362 | |||
| 998 | Ga0268266_10296170 | |||
| 999 | Ga0268266_11310571 | |||
| 1000 | Ga0373930_0009124 | |||
| 1001 | Ga0373950_0063571 | |||
| 1002 | Ga0373938_0041886 | |||
| 1003 | Ga0373926_0002888 | |||
| 1004 | Ga0373926_0005963 | |||
| 1005 | Ga0373928_0029374 | |||
| 1006 | Ga0373934_0037522 | |||
| 1007 | Ga0373934_0077032 | |||
| 1008 | Ga0373940_0007051 | |||
| 1009 | Ga0373944_0000349 | |||
| 1010 | Ga0373944_0002650 | |||
| 1011 | Ga0373951_0026081 | |||
| 1012 | Ga0373952_0010787 | |||
| 1013 | Ga0373923_0002644 | |||
| 1014 | Ga0373923_0032028 | |||
| 1015 | Ga0373932_0051658 | |||
| 1016 | Ga0373936_0000220 | |||
| 1017 | Ga0373936_0002061 | |||
| 1018 | Ga0373939_0160164 | |||
| 1019 | Ga0373941_0498303 | |||
| 1020 | Ga0373945_0000244 | |||
| 1021 | Ga0373945_0010337 | |||
| 1022 | Ga0373945_0458300 | |||
| 1023 | Ga0373953_0004307 | |||
| 1024 | Ga0373953_0100713 | |||
| 1025 | Ga0373954_0036710 | |||
| 1026 | Ga0373954_0038359 | |||
| 1027 | Ga0373956_0029995 | |||
| 1028 | Ga0373956_0068649 | |||
| 1029 | Ga0373957_0028958 | |||
| 1030 | Ga0373960_0066620 | |||
| 1031 | Ga0373960_0102143 | |||
| 1032 | Ga0373943_0000328 | |||
| 1033 | Ga0373943_0095592 | |||
| 1034 | Ga0373943_0400356 | |||
| 1035 | Ga0373946_0003022 | |||
| 1036 | Ga0373946_0005982 | |||
| 1037 | Ga0373955_0069219 | |||
| 1038 | Ga0373955_0218255 | |||
| 1039 | Ga0373942_0034436 | |||
| 1040 | Ga0373962_0117907 | |||
| 1041 | Ga0373924_0002268 | |||
| 1042 | Ga0373924_0013650 | |||
| 1043 | Ga0373924_0250202 | |||
| 1044 | Ga0373931_0052813 | |||
| 1045 | Ga0373931_0453216 | |||
| 1046 | Ga0373935_0030952 | |||
| 1047 | Ga0373935_0477346 | |||
| 1048 | Ga0373935_0860706 | |||
| 1049 | Ga0373927_0001015 | |||
| 1050 | Ga0373927_0021392 | |||
| 1051 | Ga0373927_0106195 | |||
| 1052 | Ga0373927_0228918 | |||
| 1053 | Ga0373927_0413735 | |||
| 1054 | Ga0373933_0090983 | |||
| 1055 | Ga0373933_0677664 | |||
| 1056 | Ga0373947_0004111 | |||
| 1057 | Ga0373947_0141480 | |||
| 1058 | Ga0373947_0221585 | |||
| 1059 | Ga0373937_0084844 | |||
| 1060 | Ga0373937_0494278 | |||
| 1061 | Ga0373937_0656521 | |||
| 1062 | Ga0373937_0968466 | |||
| 1063 | Ga0373937_1069770 | |||
| 1064 | Ga0373937_1104962 | |||
| 1065 | Ga0373937_1821175 | |||
| 1066 | Ga0372808_003311 | |||
| 1067 | Ga0373925_0006981 | |||
| 1068 | Ga0373925_0014178 | |||
| 1069 | Ga0373925_0022145 | |||
| 1070 | Ga0373925_0209558 | |||
| 1071 | Ga0373925_0996029 | |||
| 1072 | Ga0373925_1633668 | |||
| 1073 | Ga0373925_1637137 | |||
| 1074 | Ga0436364_0013975 | |||
| 1075 | Ga0436364_0330208 | |||
| 1076 | Ga0436364_0330965 | |||
| 1077 | Ga0436364_0523777 | |||
| 1078 | Ga0436364_0568233 | |||
| 1079 | Ga0436364_0822474 | |||
| 1080 | Ga0436364_1219808 | |||
| 1081 | Ga0451791_1882902 | |||
| 1082 | Ga0451793_0891137 | |||
| 1083 | Ga0451797_0767417 | |||
| 1084 | Ga0451800_0306817 | |||
| 1085 | Ga0451800_1679606 | |||
| 1086 | Ga0451802_0325693 | |||
| 1087 | Ga0451807_0387374 | |||
| 1088 | Ga0451807_1940652 | |||
| 1089 | Ga0451833_1256610 | |||
| 1090 | Ga0451839_0327400 | |||
| 1091 | Ga0451851_0921811 | |||
| 1092 | Ga0451843_0308118 | |||
| 1093 | Ga0451843_0789792 | |||
| 1094 | Ga0451855_1054667 | |||
| 1095 | Ga0451853_0078570 | |||
| 1096 | Ga0466969_0044242 | |||
| 1097 | Ga0466969_0056950 | |||
| 1098 | Ga0466969_0088483 | |||
| 1099 | Ga0466972_0001928 | |||
| 1100 | Ga0466972_0094327 | |||
| 1101 | Ga0466972_0373940 | |||
| 1102 | Ga0466965_0019568 | |||
| 1103 | Ga0466965_0308165 | |||
| 1104 | Ga0466966_0018194 | |||
| 1105 | Ga0466966_0032574 | |||
| 1106 | Ga0466966_0045518 | |||
| 1107 | Ga0466966_0045717 | |||
| 1108 | Ga0466966_0085305 | |||
| 1109 | Ga0466966_0216308 | |||
| 1110 | Ga0466966_0228031 | |||
| 1111 | Ga0466966_0394600 | |||
| 1112 | Ga0466961_0013613 | |||
| 1113 | Ga0466961_0013774 | |||
| 1114 | Ga0466961_0045731 | |||
| 1115 | Ga0466961_0046415 | |||
| 1116 | Ga0466961_0057207 | |||
| 1117 | Ga0466961_0076854 | |||
| 1118 | Ga0466961_0162939 | |||
| 1119 | Ga0466961_0279809 | |||
| 1120 | Ga0466961_0282563 | |||
| 1121 | Ga0466961_0294270 | |||
| 1122 | Ga0466961_0591652 | |||
| 1123 | Ga0466961_0813556 | |||
| 1124 | Ga0466963_0003782 | |||
| 1125 | Ga0466963_0009176 | |||
| 1126 | Ga0466963_0015878 | |||
| 1127 | Ga0466963_0064176 | |||
| 1128 | Ga0466963_0087549 | |||
| 1129 | Ga0466963_0105200 | |||
| 1130 | Ga0466963_0149388 | |||
| 1131 | Ga0466963_0228342 | |||
| 1132 | Ga0466963_0461598 | |||
| 1133 | Ga0466963_0526167 | |||
| 1134 | Ga0466964_0056936 | |||
| 1135 | Ga0466964_0108360 | |||
| 1136 | Ga0466964_0237389 | |||
| 1137 | Ga0466971_0003749 | |||
| 1138 | Ga0466971_0010319 | |||
| 1139 | Ga0466971_0044272 | |||
| 1140 | Ga0466971_0053248 | |||
| 1141 | Ga0466971_0181085 | |||
| 1142 | Ga0466971_0292082 | |||
| 1143 | Ga0466970_0017937 | |||
| 1144 | Ga0466970_0085045 | |||
| 1145 | Ga0466957_0023089 | |||
| 1146 | Ga0466957_0036271 | |||
| 1147 | Ga0466957_0067924 | |||
| 1148 | Ga0466957_0070187 | |||
| 1149 | Ga0466957_0101781 | |||
| 1150 | Ga0466957_0103868 | |||
| 1151 | Ga0466957_0126574 | |||
| 1152 | Ga0466957_0140355 | |||
| 1153 | Ga0466957_0142365 | |||
| 1154 | Ga0466960_0001543 | |||
| 1155 | Ga0466960_0013370 | |||
| 1156 | Ga0466960_0288210 | |||
| 1157 | Ga0466960_0331690 | |||
| 1158 | Ga0466959_0012675 | |||
| 1159 | Ga0466959_0023498 | |||
| 1160 | Ga0466959_0088762 | |||
| 1161 | Ga0466959_0114210 | |||
| 1162 | Ga0466959_0147517 | |||
| 1163 | Ga0466959_0190809 | |||
| 1164 | Ga0466959_0289632 | |||
| 1165 | Ga0466959_0331075 | |||
| 1166 | Ga0466959_0784926 | |||
| 1167 | Ga0466958_0007363 | |||
| 1168 | Ga0466958_0011657 | |||
| 1169 | Ga0466958_0014164 | |||
| 1170 | Ga0466958_0015139 | |||
| 1171 | Ga0466958_0152919 | |||
| 1172 | Ga0466958_0256570 | |||
| 1173 | Ga0466958_0558598 | |||
| 1174 | Ga0466958_0853147 | |||
| 1175 | Ga0466967_0002591 | |||
| 1176 | Ga0466967_0003155 | |||
| 1177 | Ga0466967_0008682 | |||
| 1178 | Ga0466967_0009725 | |||
| 1179 | Ga0466967_0040529 | |||
| 1180 | Ga0466967_0051580 | |||
| 1181 | Ga0466967_0124968 | |||
| 1182 | Ga0466967_0126909 | |||
| 1183 | Ga0466967_0145372 | |||
| 1184 | Ga0466967_0190693 | |||
| 1185 | Ga0466967_0218976 | |||
| 1186 | Ga0466967_0228620 | |||
| 1187 | Ga0466967_0250890 | |||
| 1188 | Ga0466967_0266909 | |||
| 1189 | Ga0466967_0281027 | |||
| 1190 | Ga0466967_0522630 | |||
| 1191 | Ga0466967_0641029 | |||
| 1192 | Ga0466967_0746450 | |||
| 1193 | Ga0466967_0828858 | |||
| 1194 | Ga0495592_0011533 | |||
| 1195 | Ga0495592_0683676 | |||
| 1196 | Ga0495603_0018166 | |||
| 1197 | Ga0495629_0001817 | |||
| 1198 | Ga0495641_0009894 | |||
| 1199 | Ga0495651_0008481 | |||
| 1200 | Ga0495651_0013256 | |||
| 1201 | Ga0495651_0130257 | |||
| 1202 | Ga0495653_0041530 | |||
| 1203 | Ga0495653_0041616 | |||
| 1204 | Ga0495653_0313028 | |||
| 1205 | Ga0495653_0437813 | |||
| 1206 | Ga0495653_0486187 | |||
| 1207 | Ga0495580_0003452 | |||
| 1208 | Ga0495580_0344299 | |||
| 1209 | Ga0495582_0001974 | |||
| 1210 | Ga0495582_0127185 | |||
| 1211 | Ga0495639_0001194 | |||
| 1212 | Ga0495639_0034631 | |||
| 1213 | Ga0495662_0000398 | |||
| 1214 | Ga0495662_0005224 | |||
| 1215 | Ga0495664_0000170 | |||
| 1216 | Ga0495664_0105775 | |||
| 1217 | Ga0495664_0374450 | |||
| 1218 | Ga0495594_0059990 | |||
| 1219 | Ga0495608_0015028 | |||
| 1220 | Ga0495608_0057961 | |||
| 1221 | Ga0495608_0175594 | |||
| 1222 | Ga0495608_0340904 | |||
| 1223 | Ga0495618_0004682 | |||
| 1224 | Ga0495618_0010066 | |||
| 1225 | Ga0495618_0111389 | |||
| 1226 | Ga0495628_0023071 | |||
| 1227 | Ga0495628_0099518 | |||
| 1228 | Ga0495628_0100173 | |||
| 1229 | Ga0495628_0225188 | |||
| 1230 | Ga0495628_0247287 | |||
| 1231 | Ga0495630_0003909 | |||
| 1232 | Ga0495630_0010026 | |||
| 1233 | Ga0495666_0000939 | |||
| 1234 | Ga0495652_0029193 | |||
| 1235 | Ga0495652_0038612 | |||
| 1236 | Ga0495652_0171940 | |||
| 1237 | Ga0495665_0004598 | |||
| 1238 | Ga0495665_0011845 | |||
| 1239 | Ga0495665_0167735 | |||
| 1240 | Ga0495640_0013776 | |||
| 1241 | Ga0495640_0033054 | |||
| 1242 | Ga0495586_0008699 | |||
| 1243 | Ga0495587_0029523 | |||
| 1244 | Ga0495587_0055643 | |||
| 1245 | Ga0495645_0008023 | |||
| 1246 | Ga0495645_0025282 | |||
| 1247 | Ga0495645_0204804 | |||
| 1248 | Ga0495645_0770122 | |||
| 1249 | Ga0495622_0107181 | |||
| 1250 | Ga0495667_0019737 | |||
| 1251 | Ga0495667_0057085 | |||
| 1252 | Ga0495667_0094988 | |||
| 1253 | Ga0495634_0005420 | |||
| 1254 | Ga0495635_0006037 | |||
| 1255 | Ga0495635_0006196 | |||
| 1256 | Ga0495635_0028640 | |||
| 1257 | Ga0495588_0022428 | |||
| 1258 | Ga0495657_0017348 | |||
| 1259 | Ga0495657_0018258 | |||
| 1260 | Ga0495657_0022575 | |||
| 1261 | Ga0495657_0046655 | |||
| 1262 | Ga0495657_0330797 | |||
| 1263 | Ga0495599_0013984 | |||
| 1264 | Ga0495599_0043570 | |||
| 1265 | Ga0495599_0168814 | |||
| 1266 | Ga0495623_0007854 | |||
| 1267 | Ga0495623_0048096 | |||
| 1268 | Ga0495646_0004595 | |||
| 1269 | Ga0495646_0116881 | |||
| 1270 | Ga0495647_0004707 | |||
| 1271 | Ga0495647_0234265 | |||
| 1272 | Ga0495658_0001230 | |||
| 1273 | Ga0495658_0048932 | |||
| 1274 | Ga0495613_0018898 | |||
| 1275 | Ga0495624_0012799 | |||
| 1276 | Ga0495624_0030650 | |||
| 1277 | Ga0495600_0009486 | |||
| 1278 | Ga0495600_0020614 | |||
| 1279 | Ga0495600_0084737 | |||
| 1280 | Ga0495581_0004566 | |||
| 1281 | Ga0495581_0024300 | |||
| 1282 | Ga0495581_0359569 | |||
| 1283 | Ga0495581_0535547 | |||
| 1284 | Ga0495604_0008319 | |||
| 1285 | Ga0495604_0875481 | |||
| 1286 | Ga0495674_0002355 | |||
| 1287 | Ga0495674_0048120 | |||
| 1288 | Ga0495674_0051728 | |||
| 1289 | Ga0495674_0163269 | |||
| 1290 | Ga0495674_0285600 | |||
| 1291 | Ga0495676_0011421 | |||
| 1292 | Ga0495676_0045228 | |||
| 1293 | Ga0495680_0038103 | |||
| 1294 | Ga0495680_0063651 | |||
| 1295 | Ga0495675_0004769 | |||
| 1296 | Ga0495675_0068466 | |||
| 1297 | Ga0495675_0320457 | |||
| 1298 | Ga0495675_0625907 | |||
| 1299 | Ga0495684_0002594 | |||
| 1300 | Ga0495684_0020457 | |||
| 1301 | Ga0495684_0037890 | |||
| 1302 | Ga0495684_0058809 | |||
| 1303 | Ga0495684_0593354 | |||
| 1304 | Ga0495593_0019075 | |||
| 1305 | Ga0495593_0190687 | |||
| 1306 | Ga0495602_0058577 | |||
| 1307 | Ga0495602_0098847 | |||
| 1308 | Ga0495602_0276032 | |||
| 1309 | Ga0495614_0022151 | |||
| 1310 | Ga0495614_0094067 | |||
| 1311 | Ga0496102_0000207 | |||
| 1312 | Ga0496102_0000319 | |||
| 1313 | Ga0496102_0109280 | |||
| 1314 | Ga0496102_0359697 | |||
| 1315 | Ga0496103_0000212 | |||
| 1316 | Ga0496103_0068858 | |||
| 1317 | Ga0496104_0278850 | |||
| 1318 | Ga0496105_0010201 | |||
| 1319 | Ga0496105_0103406 | |||
| 1320 | Ga0496105_0316586 | |||
| 1321 | Ga0496105_0923488 | |||
| 1322 | Ga0496106_0087074 | |||
| 1323 | Ga0496107_0229073 | |||
| 1324 | Ga0496108_0014756 | |||
| 1325 | Ga0496108_0816283 | |||
| 1326 | Ga0496108_1623043 | |||
| 1327 | Ga0496109_0310718 | |||
| 1328 | Ga0496110_0994283 | |||
| 1329 | Ga0496111_0080816 | |||
| 1330 | Ga0496111_0263606 | |||
| 1331 | Ga0496111_0265016 | |||
| 1332 | Ga0496113_0513786 | |||
| 1333 | Ga0496114_0144837 | |||
| 1334 | Ga0496114_0211022 | |||
| 1335 | Ga0496114_0312725 | |||
| 1336 | Ga0496115_0279677 | |||
| 1337 | Ga0496119_0002555 | |||
| 1338 | Ga0496119_0022658 | |||
| 1339 | Ga0496121_0039876 | |||
| 1340 | Ga0496126_0100931 | |||
| 1341 | Ga0496126_0428739 | |||
| 1342 | Ga0501031_0095666 | |||
| 1343 | Ga0501032_0057737 | |||
| 1344 | Ga0501033_0069431 | |||
| 1345 | Ga0501033_0276513 | |||
| 1346 | Ga0501033_0671739 | |||
| 1347 | Ga0501034_0227328 | |||
| 1348 | Ga0501034_1366245 | |||
| 1349 | Ga0501036_0692631 | |||
| 1350 | Ga0501037_0205911 | |||
| 1351 | Ga0501038_0086346 | |||
| 1352 | Ga0501038_0309134 | |||
| 1353 | Ga0501038_0413228 | |||
| 1354 | Ga0501043_0057869 | |||
| 1355 | Ga0501046_0103946 | |||
| 1356 | Ga0501047_0025144 | |||
| 1357 | Ga0501047_0043554 | |||
| 1358 | Ga0501047_0075259 | |||
| 1359 | Ga0501047_0345922 | |||
| 1360 | Ga0501048_0003895 | |||
| 1361 | Ga0501069_0637513 | |||
| 1362 | Ga0501070_0007806 | |||
| 1363 | Ga0501070_0540134 | |||
| 1364 | Ga0501074_0202457 | |||
| 1365 | Ga0501080_0143356 | |||
| 1366 | Ga0501081_0074720 | |||
| 1367 | Ga0501035_0091395 | |||
| 1368 | Ga0501035_0179648 | |||
| 1369 | Ga0501044_0140530 | |||
| 1370 | Ga0501044_0189961 | |||
| 1371 | nmdc:mga0n895_397088_c1 | |||
| 1372 | nmdc:mga0rr50_248139_c1 | |||
| 1373 | nmdc:mga0rr50_349966_c1 | |||
| 1374 | nmdc:mga0a205_144637_c1 | |||
| 1375 | Ga0495601_0369456 | |||
| 1376 | Ga0495595_0027287 | |||
| 1377 | Ga0495595_0229197 | |||
| 1378 | Ga0495619_0001376 | |||
| 1379 | Ga0495619_0024304 | |||
| 1380 | Ga0500568_0079433 | |||
| 1381 | Ga0500636_0244260 | |||
| 1382 | Ga0501082_1441313 | |||
| 1383 | Ga0466962_0003981 | |||
| 1384 | Ga0466962_0006353 | |||
| 1385 | Ga0466962_0013272 | |||
| 1386 | Ga0466962_0115753 | |||
| 1387 | 2523387526 | |||
| 1388 | 2753037632 | |||
| 1389 | 2753325500 | |||
| 1390 | 2842890389 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qa9-assembly1.cif.gz_A | crystal structure of prb (ph1109 protein redesigned for binding) | 0.9437 | 1 | 130 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.9375 | 1 | 130 |
| 3q9n-assembly1.cif.gz_A | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.9349 | 1 | 130 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.9278 | 1 | 130 |
| 1y81-assembly1.cif.gz_A | conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus | 0.925 | 14 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9278 | 1 | 130 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9186 | 14 | 126 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8964 | 14 | 126 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.895 | 1 | 130 | 3.40.50.720 |
| 3q9nB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8933 | 1 | 130 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M3VJB1-F1-model_v4 | CoA-binding domain-containing protein | 0.9931 | 1 | 136 |
|
| AF-A0A3P8L5E1-F1-model_v4 | Acetyl coenzyme A synthetase (ADP forming), alpha domain | 0.9894 | 1 | 134 |
|
| AF-A0A840F5E6-F1-model_v4 | CoA-binding domain-containing protein | 0.9884 | 2 | 136 |
|
| AF-A0A318RQP0-F1-model_v4 | CoA-binding domain-containing protein | 0.9846 | 1 | 135 |
|
| AF-A0A7Y5B604-F1-model_v4 | CoA-binding protein | 0.9828 | 4 | 130 |
|