F475703

General Info

Members Datasets Scaffolds Average Seq Length
694 218 694 244

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002487|Ga0070680_1000024879
Length 292
Sequence MQQSPADRKPGAWHGGISFHFTQFVAINARFVAAVAGDRDRWLLVIADERTGLHPMINKLQDSRAVLLGAVAIFGIGLTTSGYALGDGFRRSKMAEHRTVTVRGVSERNVTADLATWSVNFSHQGTELAPVQQSVDQQAGAVRAFFLHAGFRPDEVTDSNVALSREQARDRDGNPVGPQKLTVSRSIQLRTTDVMKARAAYARQAELLRDGVELSGTNITYTFTRLNALKPQMIAEATRNARDSAEQFARDSGVDVGRIKTASQGYFSVGARDGETPFQKVRVVTTIDYDLG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000860 3300001904 Bacteria 5586
2 JGI24736J21556_1011492 3300001904 Bacteria 1441
3 JGI24740J21852_10003212 3300001979 Bacteria 7212
4 JGI24740J21852_10009227 3300001979 Bacteria 3875
5 JGI24739J22299_10002407 3300001989 Bacteria 7217
6 JGI24737J22298_10000206 3300001990 Bacteria 19194
7 JGI24737J22298_10002181 3300001990 Bacteria 6973
8 JGI24737J22298_10005581 3300001990 Bacteria 4334
9 JGI24737J22298_10035006 3300001990 Unclassified 1555
10 JGI24735J21928_10065870 3300002067 Bacteria 1039
11 JGI24738J21930_10003464 3300002075 Bacteria 3974
12 JGI24751J29686_10022676 3300002459 Bacteria 1302
13 Ga0070658_10000374 3300005327 Bacteria 38937
14 Ga0070658_10078686 3300005327 Bacteria 2707
15 Ga0070658_10227861 3300005327 Bacteria 1577
16 Ga0070658_10389950 3300005327 Bacteria 1195
17 Ga0070676_10071131 3300005328 Bacteria 2089
18 Ga0070676_10109020 3300005328 Bacteria 1721
19 Ga0070683_100004192 3300005329 Bacteria 11822
20 Ga0070683_100004286 3300005329 Bacteria 11715
21 Ga0070683_100091962 3300005329 Bacteria 2849
22 Ga0070683_100268231 3300005329 Bacteria 1624
23 Ga0070690_100011455 3300005330 Bacteria 5188
24 Ga0070690_100043855 3300005330 Bacteria 2837
25 Ga0070670_100020797 3300005331 Bacteria 5643
26 Ga0070670_100035076 3300005331 Bacteria 4317
27 Ga0070670_100096550 3300005331 Bacteria 2542
28 Ga0068869_100026860 3300005334 Bacteria 4009
29 Ga0068869_100382019 3300005334 Bacteria 1154
30 Ga0070666_10002899 3300005335 Bacteria 10361
31 Ga0070666_10003596 3300005335 Bacteria 9395
32 Ga0070666_10046219 3300005335 Bacteria 2920
33 Ga0070666_10160634 3300005335 Bacteria 1570
34 Ga0070680_100002487 3300005336 Bacteria 13653
35 Ga0068868_100011585 3300005338 Bacteria 6423
36 Ga0068868_100058677 3300005338 Bacteria 3042
37 Ga0070660_100000209 3300005339 Bacteria 39223
38 Ga0070660_100008889 3300005339 Bacteria 7044
39 Ga0070660_100010377 3300005339 Bacteria 6584
40 Ga0070660_100038948 3300005339 Bacteria 3611
41 Ga0070660_100048047 3300005339 Bacteria 3276
42 Ga0070660_100068086 3300005339 Bacteria 2774
43 Ga0070660_100229713 3300005339 Bacteria 1510
44 Ga0070689_100096995 3300005340 Bacteria 2331
45 Ga0070691_10017346 3300005341 Bacteria 3312
46 Ga0070661_100000674 3300005344 Bacteria 25042
47 Ga0070661_100020645 3300005344 Bacteria 4698
48 Ga0070661_100023394 3300005344 Bacteria 4427
49 Ga0070661_100117586 3300005344 Bacteria 1989
50 Ga0070661_100289088 3300005344 Bacteria 1273
51 Ga0070661_100348981 3300005344 Bacteria 1160
52 Ga0070661_100364924 3300005344 Bacteria 1136
53 Ga0070692_10165400 3300005345 Bacteria 1271
54 Ga0070668_100290580 3300005347 Bacteria 1368
55 Ga0070668_100301499 3300005347 Bacteria 1344
56 Ga0070669_100073080 3300005353 Bacteria 2540
57 Ga0070669_100149851 3300005353 Bacteria 1805
58 Ga0070669_100242683 3300005353 Bacteria 1432
59 Ga0070669_100412754 3300005353 Unclassified 1107
60 Ga0070675_100092185 3300005354 Bacteria 2540
61 Ga0070675_100167195 3300005354 Bacteria 1895
62 Ga0070671_100000051 3300005355 Bacteria 79207
63 Ga0070671_100015829 3300005355 Bacteria 6092
64 Ga0070671_100019572 3300005355 Bacteria 5511
65 Ga0070671_100024555 3300005355 Bacteria 4936
66 Ga0070671_100086223 3300005355 Bacteria 2626
67 Ga0070671_100386390 3300005355 Bacteria 1196
68 Ga0070674_100041864 3300005356 Bacteria 3108
69 Ga0070673_100020869 3300005364 Bacteria 4734
70 Ga0070673_100084178 3300005364 Bacteria 2586
71 Ga0070673_100223968 3300005364 Bacteria 1629
72 Ga0070673_100338461 3300005364 Bacteria 1333
73 Ga0070673_100436242 3300005364 Bacteria 1176
74 Ga0070659_100002073 3300005366 Bacteria 14279
75 Ga0070659_100006211 3300005366 Bacteria 8630
76 Ga0070659_100010232 3300005366 Bacteria 6897
77 Ga0070659_100027912 3300005366 Bacteria 4353
78 Ga0070659_100054020 3300005366 Bacteria 3163
79 Ga0070659_100075531 3300005366 Bacteria 2686
80 Ga0070659_100090021 3300005366 Bacteria 2459
81 Ga0070659_100121139 3300005366 Bacteria 2119
82 Ga0070659_100152593 3300005366 Bacteria 1885
83 Ga0070667_100003327 3300005367 Bacteria 13729
84 Ga0070667_100005560 3300005367 Bacteria 10519
85 Ga0070667_100016148 3300005367 Bacteria 6176
86 Ga0070667_100017654 3300005367 Bacteria 5912
87 Ga0070667_100033003 3300005367 Bacteria 4322
88 Ga0070667_100151191 3300005367 Bacteria 2039
89 Ga0070667_100283007 3300005367 Bacteria 1489
90 Ga0070714_100072199 3300005435 Bacteria 2987
91 Ga0070714_100433266 3300005435 Bacteria 1247
92 Ga0070694_100097451 3300005444 Bacteria 2074
93 Ga0070663_100002265 3300005455 Bacteria 10780
94 Ga0070663_100005111 3300005455 Bacteria 7764
95 Ga0070663_100035009 3300005455 Bacteria 3481
96 Ga0070663_100037461 3300005455 Bacteria 3376
97 Ga0070663_100039702 3300005455 Bacteria 3291
98 Ga0070663_100164834 3300005455 Bacteria 1709
99 Ga0070678_100001634 3300005456 Bacteria 11998
100 Ga0070678_100065757 3300005456 Bacteria 2693
101 Ga0070678_100217152 3300005456 Bacteria 1587
102 Ga0070662_100000012 3300005457 Bacteria 129380
103 Ga0070662_100001989 3300005457 Bacteria 12527
104 Ga0070662_100007131 3300005457 Bacteria 7235
105 Ga0070662_100017289 3300005457 Bacteria 4859
106 Ga0070662_100030255 3300005457 Bacteria 3786
107 Ga0070662_100058990 3300005457 Bacteria 2794
108 Ga0070662_100328148 3300005457 Bacteria 1249
109 Ga0070681_10075543 3300005458 Bacteria 3329
110 Ga0070681_10100600 3300005458 Bacteria 2837
111 Ga0068867_100090339 3300005459 Bacteria 2323
112 Ga0070679_100012507 3300005530 Bacteria 8114
113 Ga0070684_100026091 3300005535 Bacteria 4918
114 Ga0070684_100050441 3300005535 Bacteria 3615
115 Ga0068853_100000032 3300005539 Bacteria 114306
116 Ga0068853_100032630 3300005539 Bacteria 4413
117 Ga0068853_100034987 3300005539 Bacteria 4265
118 Ga0068853_100063845 3300005539 Bacteria 3191
119 Ga0068853_100470551 3300005539 Bacteria 1184
120 Ga0070672_100065703 3300005543 Bacteria 2870
121 Ga0070672_100068098 3300005543 Bacteria 2823
122 Ga0070672_100093410 3300005543 Bacteria 2430
123 Ga0070686_100033806 3300005544 Bacteria 3145
124 Ga0070695_100087712 3300005545 Bacteria 2070
125 Ga0070696_100041707 3300005546 Bacteria 3171
126 Ga0070693_100000342 3300005547 Bacteria 21210
127 Ga0070665_100004860 3300005548 Bacteria 13963
128 Ga0070665_100080183 3300005548 Bacteria 3269
129 Ga0070665_100250497 3300005548 Bacteria 1772
130 Ga0068855_100000591 3300005563 Bacteria 44412
131 Ga0068855_100363437 3300005563 Bacteria 1592
132 Ga0070664_100002849 3300005564 Bacteria 13993
133 Ga0070664_100003755 3300005564 Bacteria 12249
134 Ga0070664_100033073 3300005564 Bacteria 4328
135 Ga0070664_100038934 3300005564 Bacteria 4003
136 Ga0070664_100059468 3300005564 Bacteria 3251
137 Ga0070664_100205037 3300005564 Bacteria 1761
138 Ga0068857_100030612 3300005577 Bacteria 4753
139 Ga0068857_100098701 3300005577 Bacteria 2619
140 Ga0068857_100098770 3300005577 Bacteria 2618
141 Ga0068857_100203186 3300005577 Bacteria 1806
142 Ga0068854_100003822 3300005578 Bacteria 9425
143 Ga0068854_100006478 3300005578 Bacteria 7451
144 Ga0068854_100030779 3300005578 Bacteria 3725
145 Ga0068854_100041663 3300005578 Bacteria 3245
146 Ga0068854_100111318 3300005578 Bacteria 2065
147 Ga0068854_100329468 3300005578 Unclassified 1244
148 Ga0068854_100362387 3300005578 Bacteria 1190
149 Ga0068854_100435437 3300005578 Unclassified 1092
150 Ga0068856_100000190 3300005614 Bacteria 64644
151 Ga0068856_100008997 3300005614 Bacteria 9716
152 Ga0068856_100020187 3300005614 Bacteria 6472
153 Ga0068856_100168386 3300005614 Bacteria 2202
154 Ga0068856_100288991 3300005614 Bacteria 1656
155 Ga0068856_100362644 3300005614 Bacteria 1468
156 Ga0068856_100472056 3300005614 Bacteria 1275
157 Ga0068856_100503116 3300005614 Bacteria 1233
158 Ga0068852_100000395 3300005616 Bacteria 29245
159 Ga0068852_100002073 3300005616 Bacteria 13696
160 Ga0068852_100011614 3300005616 Bacteria 6643
161 Ga0068852_100021744 3300005616 Bacteria 5131
162 Ga0068852_100033583 3300005616 Bacteria 4262
163 Ga0068852_100038929 3300005616 Bacteria 4000
164 Ga0068852_100051506 3300005616 Bacteria 3533
165 Ga0068852_100111621 3300005616 Bacteria 2486
166 Ga0068852_100144821 3300005616 Bacteria 2203
167 Ga0068852_100367013 3300005616 Bacteria 1409
168 Ga0068852_100688457 3300005616 Bacteria 1032
169 Ga0068852_100987114 3300005616 Bacteria 861
170 Ga0068859_100000685 3300005617 Bacteria 34047
171 Ga0068859_100040131 3300005617 Bacteria 4698
172 Ga0068859_100094812 3300005617 Bacteria 3037
173 Ga0068859_100134690 3300005617 Bacteria 2542
174 Ga0068864_100000847 3300005618 Bacteria 25807
175 Ga0068864_100014893 3300005618 Bacteria 6460
176 Ga0068864_100025847 3300005618 Bacteria 4947
177 Ga0068864_100027356 3300005618 Bacteria 4816
178 Ga0068864_100028530 3300005618 Bacteria 4719
179 Ga0068864_100035162 3300005618 Bacteria 4265
180 Ga0068864_100200485 3300005618 Bacteria 1833
181 Ga0068851_10156790 3300005834 Bacteria 1248
182 Ga0068851_10213467 3300005834 Bacteria 1082
183 Ga0068863_100005917 3300005841 Bacteria 11996
184 Ga0068863_100026328 3300005841 Bacteria 5549
185 Ga0068863_100095885 3300005841 Bacteria 2816
186 Ga0068863_100341354 3300005841 Bacteria 1457
187 Ga0068863_100345183 3300005841 Bacteria 1449
188 Ga0068863_100562437 3300005841 Bacteria 1127
189 Ga0068858_100002934 3300005842 Bacteria 17162
190 Ga0068858_100006170 3300005842 Bacteria 11688
191 Ga0068858_100030883 3300005842 Bacteria 4976
192 Ga0068860_100001106 3300005843 Bacteria 29651
193 Ga0068860_100006941 3300005843 Bacteria 11350
194 Ga0068860_100048248 3300005843 Bacteria 4058
195 Ga0068860_100080459 3300005843 Bacteria 3098
196 Ga0068860_100102330 3300005843 Bacteria 2733
197 Ga0068862_100007304 3300005844 Bacteria 9173
198 Ga0068862_100218759 3300005844 Bacteria 1723
199 Ga0068862_100288246 3300005844 Bacteria 1507
200 Ga0068862_100295291 3300005844 Bacteria 1489
201 Ga0081539_10013686 3300005985 Bacteria 6093
202 Ga0075364_10133843 3300006051 Bacteria 1665
203 Ga0075366_10058074 3300006195 Bacteria 2298
204 Ga0097621_100007674 3300006237 Bacteria 7737
205 Ga0097621_100010890 3300006237 Bacteria 6675
206 Ga0097621_100024788 3300006237 Bacteria 4688
207 Ga0068871_100040659 3300006358 Bacteria 3725
208 Ga0068871_100081349 3300006358 Bacteria 2683
209 Ga0075428_100052052 3300006844 Bacteria 4489
210 Ga0075433_10022199 3300006852 Bacteria 5327
211 Ga0075434_100514904 3300006871 Bacteria 1217
212 Ga0068865_100013945 3300006881 Bacteria 5097
213 Ga0068865_100122730 3300006881 Bacteria 1934
214 Ga0097620_100000685 3300006931 Bacteria 34047
215 Ga0097620_100040129 3300006931 Bacteria 4698
216 Ga0097620_100094807 3300006931 Bacteria 3037
217 Ga0097620_100134695 3300006931 Bacteria 2542
218 Ga0105250_10011311 3300009092 Bacteria 3703
219 Ga0105240_10131645 3300009093 Bacteria 2999
220 Ga0105240_10195563 3300009093 Bacteria 2375
221 Ga0105240_10199702 3300009093 Bacteria 2344
222 Ga0105240_10623354 3300009093 Bacteria 1185
223 Ga0105240_10850364 3300009093 Bacteria 985
224 Ga0111539_10010849 3300009094 Bacteria 11468
225 Ga0111539_10189288 3300009094 Bacteria 2402
226 Ga0105245_10025012 3300009098 Bacteria 5248
227 Ga0105247_10111114 3300009101 Bacteria 1764
228 Ga0105247_10250903 3300009101 Bacteria 1210
229 Ga0105241_10181613 3300009174 Bacteria 1746
230 Ga0105241_10191322 3300009174 Bacteria 1703
231 Ga0105248_10000083 3300009177 Bacteria 110619
232 Ga0105248_10001290 3300009177 Bacteria 27898
233 Ga0105248_10010504 3300009177 Bacteria 10196
234 Ga0105248_10011986 3300009177 Bacteria 9560
235 Ga0105248_10049177 3300009177 Bacteria 4729
236 Ga0105248_10161135 3300009177 Bacteria 2530
237 Ga0105248_10207723 3300009177 Bacteria 2206
238 Ga0105248_10242124 3300009177 Bacteria 2030
239 Ga0105248_10285227 3300009177 Bacteria 1859
240 Ga0105248_10309349 3300009177 Bacteria 1779
241 Ga0105237_10027386 3300009545 Bacteria 5819
242 Ga0105238_10005371 3300009551 Bacteria 12662
243 Ga0105238_10060953 3300009551 Bacteria 3776
244 Ga0105238_10243798 3300009551 Bacteria 1775
245 Ga0105238_10249062 3300009551 Bacteria 1754
246 Ga0105238_10546767 3300009551 Bacteria 1162
247 Ga0105249_10004218 3300009553 Bacteria 12422
248 Ga0105249_10037568 3300009553 Bacteria 4395
249 Ga0105249_10166104 3300009553 Bacteria 2137
250 Ga0105246_10001236 3300011119 Bacteria 14986
251 Ga0105246_10036939 3300011119 Bacteria 3275
252 Ga0105246_10076875 3300011119 Bacteria 2366
253 Ga0157373_10024739 3300013100 Bacteria 4348
254 Ga0157373_10027921 3300013100 Bacteria 4072
255 Ga0157373_10051701 3300013100 Bacteria 2925
256 Ga0157373_10092002 3300013100 Bacteria 2136
257 Ga0157373_10249882 3300013100 Bacteria 1254
258 Ga0157373_10250776 3300013100 Bacteria 1252
259 Ga0157371_10013378 3300013102 Bacteria 6234
260 Ga0157371_10031719 3300013102 Bacteria 3806
261 Ga0157371_10051752 3300013102 Bacteria 2918
262 Ga0157371_10065439 3300013102 Bacteria 2575
263 Ga0157371_10071293 3300013102 Bacteria 2459
264 Ga0157371_10114036 3300013102 Bacteria 1919
265 Ga0157371_10157227 3300013102 Bacteria 1623
266 Ga0157370_10011909 3300013104 Bacteria 9067
267 Ga0157370_10072675 3300013104 Bacteria 3245
268 Ga0157370_10215047 3300013104 Bacteria 1781
269 Ga0157370_10229904 3300013104 Bacteria 1717
270 Ga0157370_10427516 3300013104 Bacteria 1218
271 Ga0157369_10010429 3300013105 Bacteria 10588
272 Ga0157369_10273282 3300013105 Bacteria 1761
273 Ga0157369_10340916 3300013105 Bacteria 1557
274 Ga0157369_10514565 3300013105 Bacteria 1238
275 Ga0157369_10948914 3300013105 Bacteria 881
276 Ga0157374_10282994 3300013296 Bacteria 1637
277 Ga0163162_10037700 3300013306 Bacteria 4825
278 Ga0163162_10055061 3300013306 Bacteria 4003
279 Ga0163162_10076703 3300013306 Bacteria 3405
280 Ga0163162_10258811 3300013306 Bacteria 1872
281 Ga0163162_10966056 3300013306 Bacteria 962
282 Ga0157372_10006659 3300013307 Bacteria 12294
283 Ga0157372_10112642 3300013307 Bacteria 3117
284 Ga0157372_10113320 3300013307 Bacteria 3108
285 Ga0157372_10224796 3300013307 Bacteria 2176
286 Ga0157372_10425486 3300013307 Bacteria 1547
287 Ga0157375_10011059 3300013308 Bacteria 7958
288 Ga0157375_10572402 3300013308 Bacteria 1290
289 Ga0157375_10675911 3300013308 Bacteria 1187
290 Ga0157375_10779563 3300013308 Bacteria 1106
291 Ga0163163_10000307 3300014325 Bacteria 48168
292 Ga0163163_10000364 3300014325 Bacteria 43563
293 Ga0163163_10048670 3300014325 Bacteria 4169
294 Ga0182008_10040504 3300014497 Bacteria 2326
295 Ga0157377_10010129 3300014745 Bacteria 4651
296 Ga0157377_10025871 3300014745 Bacteria 3134
297 Ga0157379_10005320 3300014968 Bacteria 11057
298 Ga0157379_10029113 3300014968 Bacteria 4912
299 Ga0157376_10050828 3300014969 Bacteria 3441
300 Ga0163161_10070128 3300017792 Bacteria 2563
301 Ga0163161_10091575 3300017792 Bacteria 2250
302 Ga0213873_10000026 3300021358 Bacteria 74525
303 Ga0213876_10000149 3300021384 Bacteria 74548
304 Ga0207656_10014925 3300025321 Bacteria 3002
305 Ga0207656_10068538 3300025321 Bacteria 1572
306 Ga0207696_1009256 3300025711 Bacteria 3683
307 Ga0207682_10052406 3300025893 Bacteria 1691
308 Ga0207642_10189578 3300025899 Bacteria 1127
309 Ga0207688_10017938 3300025901 Bacteria 3851
310 Ga0207688_10051977 3300025901 Bacteria 2295
311 Ga0207688_10234151 3300025901 Bacteria 1109
312 Ga0207680_10001044 3300025903 Bacteria 13083
313 Ga0207680_10022148 3300025903 Bacteria 3451
314 Ga0207680_10049246 3300025903 Bacteria 2507
315 Ga0207647_10003750 3300025904 Bacteria 11358
316 Ga0207647_10005204 3300025904 Bacteria 9570
317 Ga0207647_10005744 3300025904 Bacteria 9057
318 Ga0207647_10008197 3300025904 Bacteria 7506
319 Ga0207647_10009701 3300025904 Bacteria 6830
320 Ga0207647_10011192 3300025904 Bacteria 6304
321 Ga0207645_10087331 3300025907 Bacteria 2004
322 Ga0207643_10279038 3300025908 Bacteria 1036
323 Ga0207705_10000072 3300025909 Bacteria 126043
324 Ga0207705_10028274 3300025909 Bacteria 3997
325 Ga0207705_10086331 3300025909 Bacteria 2293
326 Ga0207705_10150560 3300025909 Bacteria 1743
327 Ga0207705_10194114 3300025909 Bacteria 1536
328 Ga0207705_10211186 3300025909 Unclassified 1472
329 Ga0207705_10213417 3300025909 Bacteria 1464
330 Ga0207705_10466551 3300025909 Bacteria 980
331 Ga0207654_10126056 3300025911 Bacteria 1614
332 Ga0207707_10053862 3300025912 Bacteria 3502
333 Ga0207707_10256549 3300025912 Bacteria 1518
334 Ga0207695_10005583 3300025913 Bacteria 16616
335 Ga0207695_10057521 3300025913 Bacteria 4039
336 Ga0207695_10159247 3300025913 Bacteria 2190
337 Ga0207671_10062809 3300025914 Bacteria 2759
338 Ga0207671_10476750 3300025914 Unclassified 994
339 Ga0207660_10005019 3300025917 Bacteria 8627
340 Ga0207657_10000496 3300025919 Bacteria 41552
341 Ga0207657_10004492 3300025919 Bacteria 14748
342 Ga0207657_10007401 3300025919 Bacteria 11255
343 Ga0207657_10010662 3300025919 Bacteria 9153
344 Ga0207657_10016875 3300025919 Bacteria 7027
345 Ga0207657_10023986 3300025919 Bacteria 5664
346 Ga0207657_10104098 3300025919 Bacteria 2352
347 Ga0207657_10148386 3300025919 Bacteria 1912
348 Ga0207657_10206631 3300025919 Bacteria 1577
349 Ga0207657_10292917 3300025919 Bacteria 1290
350 Ga0207657_10362631 3300025919 Bacteria 1142
351 Ga0207649_10000158 3300025920 Bacteria 55609
352 Ga0207649_10015462 3300025920 Bacteria 4288
353 Ga0207649_10018836 3300025920 Bacteria 3936
354 Ga0207649_10022700 3300025920 Bacteria 3626
355 Ga0207649_10038266 3300025920 Bacteria 2903
356 Ga0207649_10069176 3300025920 Bacteria 2247
357 Ga0207649_10070606 3300025920 Bacteria 2228
358 Ga0207649_10074251 3300025920 Bacteria 2181
359 Ga0207652_10001167 3300025921 Bacteria 23590
360 Ga0207652_10392457 3300025921 Bacteria 1252
361 Ga0207681_10060659 3300025923 Bacteria 2597
362 Ga0207681_10094042 3300025923 Bacteria 2147
363 Ga0207681_10153041 3300025923 Bacteria 1730
364 Ga0207681_10487160 3300025923 Bacteria 1008
365 Ga0207694_10014607 3300025924 Bacteria 5921
366 Ga0207694_10033272 3300025924 Bacteria 3950
367 Ga0207694_10056766 3300025924 Bacteria 3042
368 Ga0207650_10035924 3300025925 Bacteria 3602
369 Ga0207650_10048060 3300025925 Bacteria 3145
370 Ga0207650_10055340 3300025925 Bacteria 2945
371 Ga0207659_10085399 3300025926 Bacteria 2345
372 Ga0207659_10462465 3300025926 Bacteria 1070
373 Ga0207687_10036409 3300025927 Bacteria 3353
374 Ga0207664_10066793 3300025929 Bacteria 2884
375 Ga0207664_10298966 3300025929 Bacteria 1416
376 Ga0207644_10000358 3300025931 Bacteria 29705
377 Ga0207644_10004758 3300025931 Bacteria 8826
378 Ga0207644_10012673 3300025931 Bacteria 5603
379 Ga0207644_10014155 3300025931 Bacteria 5335
380 Ga0207644_10017452 3300025931 Bacteria 4846
381 Ga0207644_10200857 3300025931 Bacteria 1572
382 Ga0207644_10239710 3300025931 Bacteria 1443
383 Ga0207690_10001410 3300025932 Bacteria 15127
384 Ga0207690_10005347 3300025932 Bacteria 7567
385 Ga0207690_10009277 3300025932 Bacteria 5846
386 Ga0207690_10012196 3300025932 Bacteria 5143
387 Ga0207690_10012238 3300025932 Bacteria 5133
388 Ga0207690_10061001 3300025932 Bacteria 2562
389 Ga0207690_10109229 3300025932 Bacteria 1989
390 Ga0207690_10182730 3300025932 Bacteria 1580
391 Ga0207706_10000041 3300025933 Bacteria 130090
392 Ga0207706_10003120 3300025933 Bacteria 15935
393 Ga0207706_10003298 3300025933 Bacteria 15456
394 Ga0207706_10006675 3300025933 Bacteria 10670
395 Ga0207706_10009215 3300025933 Bacteria 9068
396 Ga0207706_10120168 3300025933 Bacteria 2310
397 Ga0207706_10140011 3300025933 Bacteria 2128
398 Ga0207706_10330774 3300025933 Bacteria 1326
399 Ga0207706_10514097 3300025933 Bacteria 1033
400 Ga0207686_10118151 3300025934 Bacteria 1800
401 Ga0207670_10152691 3300025936 Bacteria 1715
402 Ga0207669_10365623 3300025937 Bacteria 1119
403 Ga0207669_10387807 3300025937 Bacteria 1090
404 Ga0207704_10025449 3300025938 Bacteria 3229
405 Ga0207704_10075647 3300025938 Bacteria 2154
406 Ga0207704_10077073 3300025938 Bacteria 2139
407 Ga0207691_10008814 3300025940 Bacteria 9676
408 Ga0207691_10036319 3300025940 Bacteria 4565
409 Ga0207691_10214401 3300025940 Bacteria 1671
410 Ga0207691_10392387 3300025940 Bacteria 1184
411 Ga0207711_10000831 3300025941 Bacteria 30006
412 Ga0207711_10001208 3300025941 Bacteria 24465
413 Ga0207711_10231617 3300025941 Bacteria 1692
414 Ga0207711_10391174 3300025941 Bacteria 1291
415 Ga0207689_10006035 3300025942 Bacteria 10707
416 Ga0207689_10273219 3300025942 Bacteria 1399
417 Ga0207661_10002967 3300025944 Bacteria 11736
418 Ga0207661_10062691 3300025944 Bacteria 3008
419 Ga0207661_10108965 3300025944 Bacteria 2339
420 Ga0207661_10327354 3300025944 Bacteria 1378
421 Ga0207661_10411280 3300025944 Bacteria 1228
422 Ga0207679_10003505 3300025945 Bacteria 9706
423 Ga0207679_10009869 3300025945 Bacteria 6130
424 Ga0207679_10032405 3300025945 Bacteria 3668
425 Ga0207679_10083585 3300025945 Bacteria 2447
426 Ga0207679_10093476 3300025945 Bacteria 2332
427 Ga0207679_10388146 3300025945 Bacteria 1225
428 Ga0207667_10002008 3300025949 Bacteria 25533
429 Ga0207667_10005995 3300025949 Bacteria 14785
430 Ga0207667_10012442 3300025949 Bacteria 9805
431 Ga0207667_10032089 3300025949 Bacteria 5662
432 Ga0207667_10176662 3300025949 Bacteria 2193
433 Ga0207651_10012725 3300025960 Bacteria 4777
434 Ga0207651_10013225 3300025960 Bacteria 4712
435 Ga0207651_10026456 3300025960 Bacteria 3625
436 Ga0207651_10099280 3300025960 Bacteria 2155
437 Ga0207651_10160391 3300025960 Bacteria 1762
438 Ga0207712_10000819 3300025961 Bacteria 22891
439 Ga0207712_10036062 3300025961 Bacteria 3365
440 Ga0207712_10132626 3300025961 Bacteria 1900
441 Ga0207668_10058871 3300025972 Bacteria 2688
442 Ga0207668_10123654 3300025972 Bacteria 1963
443 Ga0207668_10259742 3300025972 Bacteria 1415
444 Ga0207668_10336102 3300025972 Unclassified 1258
445 Ga0207640_10008226 3300025981 Bacteria 5783
446 Ga0207640_10033277 3300025981 Bacteria 3206
447 Ga0207640_10051605 3300025981 Bacteria 2674
448 Ga0207640_10055178 3300025981 Bacteria 2601
449 Ga0207640_10249382 3300025981 Bacteria 1377
450 Ga0207658_10002673 3300025986 Bacteria 12909
451 Ga0207658_10003158 3300025986 Bacteria 11766
452 Ga0207658_10006868 3300025986 Bacteria 7753
453 Ga0207658_10067674 3300025986 Bacteria 2691
454 Ga0207658_10128706 3300025986 Bacteria 2031
455 Ga0207658_10162842 3300025986 Bacteria 1830
456 Ga0207658_10194400 3300025986 Bacteria 1689
457 Ga0207658_10403866 3300025986 Bacteria 1201
458 Ga0207677_10013551 3300026023 Bacteria 4730
459 Ga0207677_10072400 3300026023 Bacteria 2436
460 Ga0207677_10082245 3300026023 Bacteria 2314
461 Ga0207677_10254093 3300026023 Bacteria 1429
462 Ga0207677_10612451 3300026023 Bacteria 957
463 Ga0207703_10001930 3300026035 Bacteria 18356
464 Ga0207703_10023804 3300026035 Bacteria 4817
465 Ga0207703_10026334 3300026035 Bacteria 4576
466 Ga0207703_10096134 3300026035 Bacteria 2500
467 Ga0207639_10000074 3300026041 Bacteria 91671
468 Ga0207639_10009793 3300026041 Bacteria 6621
469 Ga0207639_10079762 3300026041 Bacteria 2588
470 Ga0207639_10332602 3300026041 Bacteria 1352
471 Ga0207639_10381282 3300026041 Bacteria 1266
472 Ga0207639_10477176 3300026041 Bacteria 1136
473 Ga0207639_10625304 3300026041 Unclassified 995
474 Ga0207639_10655951 3300026041 Unclassified 971
475 Ga0207678_10005554 3300026067 Bacteria 11268
476 Ga0207678_10009642 3300026067 Bacteria 8492
477 Ga0207678_10015630 3300026067 Bacteria 6673
478 Ga0207678_10029713 3300026067 Bacteria 4772
479 Ga0207678_10053563 3300026067 Bacteria 3477
480 Ga0207678_10349832 3300026067 Bacteria 1274
481 Ga0207702_10003674 3300026078 Bacteria 13889
482 Ga0207702_10004666 3300026078 Bacteria 12107
483 Ga0207702_10008508 3300026078 Bacteria 8652
484 Ga0207702_10027944 3300026078 Bacteria 4687
485 Ga0207702_10033340 3300026078 Bacteria 4301
486 Ga0207702_10052679 3300026078 Bacteria 3444
487 Ga0207702_10060585 3300026078 Bacteria 3226
488 Ga0207702_10386382 3300026078 Bacteria 1347
489 Ga0207641_10000502 3300026088 Bacteria 44127
490 Ga0207641_10036006 3300026088 Bacteria 4129
491 Ga0207641_10036013 3300026088 Bacteria 4128
492 Ga0207641_10269953 3300026088 Bacteria 1596
493 Ga0207641_10801892 3300026088 Bacteria 931
494 Ga0207648_10018551 3300026089 Bacteria 6297
495 Ga0207648_10489826 3300026089 Bacteria 1124
496 Ga0207648_10713128 3300026089 Bacteria 930
497 Ga0207676_10006711 3300026095 Bacteria 8141
498 Ga0207676_10008921 3300026095 Bacteria 7134
499 Ga0207676_10015461 3300026095 Bacteria 5506
500 Ga0207676_10021484 3300026095 Bacteria 4735
501 Ga0207676_10032734 3300026095 Bacteria 3921
502 Ga0207676_10051296 3300026095 Bacteria 3220
503 Ga0207676_10069199 3300026095 Bacteria 2826
504 Ga0207676_10114033 3300026095 Bacteria 2267
505 Ga0207676_10336525 3300026095 Bacteria 1391
506 Ga0207674_10000086 3300026116 Bacteria 100722
507 Ga0207674_10001687 3300026116 Bacteria 28359
508 Ga0207674_10001715 3300026116 Bacteria 28037
509 Ga0207674_10004612 3300026116 Bacteria 16545
510 Ga0207674_10005367 3300026116 Bacteria 15246
511 Ga0207674_10011675 3300026116 Bacteria 9862
512 Ga0207674_10140847 3300026116 Bacteria 2371
513 Ga0207674_10145971 3300026116 Bacteria 2324
514 Ga0207675_100480570 3300026118 Bacteria 1235
515 Ga0207675_100527904 3300026118 Bacteria 1177
516 Ga0207683_10023087 3300026121 Bacteria 5346
517 Ga0207683_10180294 3300026121 Bacteria 1915
518 Ga0207683_10249516 3300026121 Bacteria 1620
519 Ga0207698_10001441 3300026142 Bacteria 13822
520 Ga0207698_10001717 3300026142 Bacteria 12776
521 Ga0207698_10005004 3300026142 Bacteria 8130
522 Ga0207698_10007457 3300026142 Bacteria 6849
523 Ga0207698_10040073 3300026142 Bacteria 3476
524 Ga0207698_10056284 3300026142 Bacteria 3036
525 Ga0207698_10074066 3300026142 Bacteria 2714
526 Ga0207698_10097061 3300026142 Bacteria 2431
527 Ga0207698_10144724 3300026142 Bacteria 2054
528 Ga0207698_10176080 3300026142 Bacteria 1889
529 Ga0207698_10369135 3300026142 Bacteria 1361
530 Ga0207428_10102317 3300027907 Bacteria 2212
531 Ga0268266_10002799 3300028379 Bacteria 18189
532 Ga0268266_10152684 3300028379 Bacteria 2083
533 Ga0268265_10002045 3300028380 Bacteria 15816
534 Ga0268265_10005838 3300028380 Bacteria 8396
535 Ga0268265_10063086 3300028380 Bacteria 2849
536 Ga0268265_10085025 3300028380 Bacteria 2509
537 Ga0268265_10136209 3300028380 Bacteria 2049
538 Ga0268265_10149298 3300028380 Bacteria 1969
539 Ga0268264_10000410 3300028381 Bacteria 60680
540 Ga0268264_10000418 3300028381 Bacteria 59942
541 Ga0268264_10003670 3300028381 Bacteria 13190
542 Ga0268264_10004427 3300028381 Bacteria 11983
543 Ga0268264_10049649 3300028381 Bacteria 3491
544 Ga0268264_10511985 3300028381 Bacteria 1172
545 Ga0268264_10621349 3300028381 Bacteria 1067
546 Ga0307513_10123908 3300031456 Bacteria 2544
547 Ga0307408_100232462 3300031548 Bacteria 1511
548 Ga0307408_100250383 3300031548 Bacteria 1461
549 Ga0307405_10021649 3300031731 Bacteria 3618
550 Ga0307405_10219804 3300031731 Bacteria 1393
551 Ga0307413_10264948 3300031824 Bacteria 1283
552 Ga0307410_10035163 3300031852 Bacteria 3251
553 Ga0307410_10042014 3300031852 Bacteria 3019
554 Ga0307410_10112127 3300031852 Bacteria 1975
555 Ga0307406_10102189 3300031901 Bacteria 1955
556 Ga0307412_10236533 3300031911 Bacteria 1410
557 Ga0307409_100346347 3300031995 Bacteria 1400
558 Ga0307416_100001278 3300032002 Bacteria 13552
559 Ga0307416_100177520 3300032002 Bacteria 1992
560 Ga0307416_100241703 3300032002 Bacteria 1750
561 Ga0307416_100701371 3300032002 Bacteria 1101
562 Ga0307416_100933041 3300032002 Bacteria 969
563 Ga0307411_10106225 3300032005 Bacteria 1998
564 Ga0307411_10229684 3300032005 Bacteria 1445
565 Ga0307415_100001974 3300032126 Bacteria 10092
566 Ga0307415_100056765 3300032126 Bacteria 2687
567 Ga0373931_0038155 3300035691 Bacteria 2512
568 Ga0373933_0090176 3300035724 Bacteria 1891
569 Ga0373925_0658624 3300037068 Bacteria 863
570 Ga0395899_0004923 3300037312 Bacteria 10387
571 Ga0395899_0045863 3300037312 Bacteria 3257
572 Ga0395899_0052855 3300037312 Bacteria 3010
573 Ga0395899_0098289 3300037312 Bacteria 2115
574 Ga0395899_0373106 3300037312 Bacteria 950
575 Ga0395900_0014124 3300037418 Bacteria 8155
576 Ga0395900_0015350 3300037418 Bacteria 7808
577 Ga0395900_0016744 3300037418 Bacteria 7479
578 Ga0395900_0031945 3300037418 Bacteria 5411
579 Ga0395900_0132063 3300037418 Bacteria 2558
580 Ga0395900_0240308 3300037418 Bacteria 1817
581 Ga0395900_0628422 3300037418 Bacteria 1012
582 Ga0395898_0002701 3300037466 Bacteria 20519
583 Ga0395898_0098661 3300037466 Bacteria 2805
584 Ga0395898_0184991 3300037466 Bacteria 1990
585 Ga0395898_0259829 3300037466 Bacteria 1656
586 Ga0395898_0526763 3300037466 Bacteria 1123
587 Ga0395898_0676200 3300037466 Bacteria 974
588 Ga0395905_0003223 3300037471 Bacteria 17551
589 Ga0395905_0008041 3300037471 Bacteria 10420
590 Ga0395905_0010915 3300037471 Bacteria 8793
591 Ga0395905_0011911 3300037471 Bacteria 8387
592 Ga0395905_0014089 3300037471 Bacteria 7644
593 Ga0395905_0027561 3300037471 Bacteria 5357
594 Ga0395905_0030456 3300037471 Bacteria 5085
595 Ga0395905_0037798 3300037471 Bacteria 4531
596 Ga0395905_0039129 3300037471 Bacteria 4449
597 Ga0395905_0056905 3300037471 Bacteria 3657
598 Ga0395905_0066738 3300037471 Bacteria 3370
599 Ga0395905_0072172 3300037471 Bacteria 3236
600 Ga0395905_0093632 3300037471 Bacteria 2818
601 Ga0395905_0217798 3300037471 Bacteria 1787
602 Ga0395905_0231037 3300037471 Bacteria 1729
603 Ga0395905_0301022 3300037471 Bacteria 1491
604 Ga0395905_0595573 3300037471 Bacteria 1007
605 Ga0395901_0002307 3300038443 Bacteria 19441
606 Ga0395901_0006240 3300038443 Bacteria 12082
607 Ga0395901_0017583 3300038443 Bacteria 7299
608 Ga0395901_0029510 3300038443 Bacteria 5648
609 Ga0395901_0049375 3300038443 Bacteria 4371
610 Ga0395901_0069941 3300038443 Bacteria 3656
611 Ga0395901_0070253 3300038443 Bacteria 3648
612 Ga0395901_0110468 3300038443 Bacteria 2886
613 Ga0395901_0128414 3300038443 Bacteria 2664
614 Ga0395901_0162507 3300038443 Bacteria 2345
615 Ga0395901_0190719 3300038443 Bacteria 2149
616 Ga0395901_0465348 3300038443 Bacteria 1291
617 Ga0436365_1025078 3300039437 Bacteria 33251
618 Ga0436362_0376260 3300039453 Bacteria 74620
619 Ga0439445_0001282 3300042004 Bacteria 5440
620 Ga0450892_005517 3300042130 Bacteria 1041
621 Ga0450905_007099 3300042142 Bacteria 1522
622 Ga0450889_000164 3300042144 Bacteria 6977
623 Ga0439458_0000109 3300042157 Bacteria 16485
624 Ga0439458_0000434 3300042157 Bacteria 10555
625 Ga0466965_0183342 3300044683 Bacteria 1105
626 Ga0466961_0051697 3300044693 Bacteria 2624
627 Ga0466963_0006830 3300044694 Bacteria 6791
628 Ga0466963_0016446 3300044694 Bacteria 4600
629 Ga0466963_0209321 3300044694 Bacteria 1364
630 Ga0466971_0045859 3300044719 Bacteria 1964
631 Ga0466971_0090815 3300044719 Bacteria 1398
632 Ga0466957_0015521 3300044842 Bacteria 4448
633 Ga0466957_0015544 3300044842 Bacteria 4445
634 Ga0466957_0309128 3300044842 Bacteria 1064
635 Ga0466957_0378222 3300044842 Bacteria 965
636 Ga0466960_0032729 3300044901 Bacteria 2410
637 Ga0466959_0244682 3300045049 Bacteria 1238
638 Ga0466958_0016344 3300045836 Bacteria 4272
639 Ga0466958_0179789 3300045836 Bacteria 1342
640 Ga0466967_0008915 3300045976 Bacteria 7403
641 Ga0466967_0019275 3300045976 Bacteria 5482
642 Ga0466967_0148126 3300045976 Bacteria 2191
643 Ga0466967_0152179 3300045976 Bacteria 2163
644 Ga0466967_0881734 3300045976 Bacteria 889
645 Ga0466967_1012951 3300045976 Bacteria 827
646 Ga0495668_0021740 3300046616 Bacteria 3673
647 Ga0495602_0109187 3300048088 Bacteria 2251
648 Ga0496100_0096199 3300048903 Bacteria 2031
649 Ga0496101_0002532 3300048904 Bacteria 11226
650 Ga0496102_0022374 3300048905 Bacteria 5601
651 Ga0496103_0031204 3300048906 Bacteria 3246
652 Ga0496103_0086960 3300048906 Bacteria 1970
653 Ga0496104_0256167 3300048907 Bacteria 1663
654 Ga0496105_0026043 3300048908 Bacteria 4767
655 Ga0496105_0237985 3300048908 Bacteria 1478
656 Ga0496105_0302986 3300048908 Bacteria 1284
657 Ga0496107_0037609 3300048910 Bacteria 3473
658 Ga0496107_0042345 3300048910 Bacteria 3270
659 Ga0496107_0086374 3300048910 Bacteria 2290
660 Ga0496108_0239397 3300048911 Bacteria 1578
661 Ga0496108_0250582 3300048911 Bacteria 1540
662 Ga0496109_0023599 3300048912 Bacteria 5460
663 Ga0496109_0252855 3300048912 Bacteria 1659
664 Ga0496110_0031758 3300048913 Bacteria 4558
665 Ga0496110_0095264 3300048913 Bacteria 2666
666 Ga0496110_0102982 3300048913 Bacteria 2560
667 Ga0496110_0145914 3300048913 Bacteria 2140
668 Ga0496110_0254485 3300048913 Bacteria 1598
669 Ga0496110_0505732 3300048913 Bacteria 1100
670 Ga0496111_0020675 3300048914 Bacteria 4586
671 Ga0496111_0039667 3300048914 Bacteria 3377
672 Ga0496111_0093525 3300048914 Bacteria 2204
673 Ga0496111_0099358 3300048914 Bacteria 2137
674 Ga0496112_0006417 3300048915 Bacteria 10321
675 Ga0496112_0055464 3300048915 Bacteria 3896
676 Ga0496112_0056604 3300048915 Bacteria 3859
677 Ga0496113_0011674 3300048916 Bacteria 5875
678 Ga0496113_0042430 3300048916 Bacteria 3361
679 Ga0496113_0438517 3300048916 Bacteria 1049
680 Ga0496114_0504219 3300048917 Bacteria 1070
681 Ga0501067_0031476 3300049583 Bacteria 2944
682 Ga0501068_0099051 3300049584 Bacteria 1806
683 Ga0501074_0059470 3300049590 Bacteria 2753
684 Ga0501080_0011952 3300049742 Bacteria 7953
685 nmdc:mga00v17_129740_c1 3300050491 Bacteria 1610
686 nmdc:mga07m45_166949_c1 3300050496 Bacteria 1278
687 nmdc:mga0qj67_215851_c1 3300050509 Bacteria 1557
688 nmdc:mga08y16_132594_c1 3300050511 Bacteria 2590
689 nmdc:mga0n895_476320_c1 3300050512 Bacteria 1259
690 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
691 Ga0495612_0058747 3300053078 Bacteria 1590
692 Ga0495655_0001821 3300053083 Bacteria 3322
693 Ga0500658_0000105 3300053134 Bacteria 38951
694 Ga0466962_0068623 3300061719 Bacteria 1693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021358 Ga0213873_10000026 Ga0213873_1000002658 231
2 3300021384 Ga0213876_10000149 Ga0213876_1000014918 231
3 3300031852 Ga0307410_10112127 Ga0307410_101121272 231
4 3300039437 Ga0436365_1025078 Ga0436365_1025078_16403_17134 231
5 3300039453 Ga0436362_0376260 Ga0436362_0376260_57772_58503 231
6 3300005327 Ga0070658_10078686 Ga0070658_100786863 235
7 3300005353 Ga0070669_100412754 Ga0070669_1004127542 235
8 3300005616 Ga0068852_100033583 Ga0068852_1000335834 235
9 3300009177 Ga0105248_10285227 Ga0105248_102852273 235
10 3300013102 Ga0157371_10031719 Ga0157371_100317193 235
11 3300025909 Ga0207705_10211186 Ga0207705_102111862 235
12 3300025919 Ga0207657_10148386 Ga0207657_101483863 235
13 3300026142 Ga0207698_10074066 Ga0207698_100740663 235
14 3300005329 Ga0070683_100004192 Ga0070683_10000419212 236
15 3300005329 Ga0070683_100268231 Ga0070683_1002682312 236
16 3300005331 Ga0070670_100035076 Ga0070670_1000350764 236
17 3300005339 Ga0070660_100068086 Ga0070660_1000680864 236
18 3300005344 Ga0070661_100020645 Ga0070661_1000206456 236
19 3300005344 Ga0070661_100289088 Ga0070661_1002890882 236
20 3300005347 Ga0070668_100290580 Ga0070668_1002905801 236
21 3300005347 Ga0070668_100301499 Ga0070668_1003014992 236
22 3300005353 Ga0070669_100242683 Ga0070669_1002426832 236
23 3300005354 Ga0070675_100092185 Ga0070675_1000921854 236
24 3300005355 Ga0070671_100000051 Ga0070671_1000000516 236
25 3300005364 Ga0070673_100223968 Ga0070673_1002239681 236
26 3300005366 Ga0070659_100121139 Ga0070659_1001211393 236
27 3300005455 Ga0070663_100039702 Ga0070663_1000397023 236
28 3300005455 Ga0070663_100164834 Ga0070663_1001648342 236
29 3300005456 Ga0070678_100001634 Ga0070678_10000163410 236
30 3300005456 Ga0070678_100217152 Ga0070678_1002171522 236
31 3300005457 Ga0070662_100001989 Ga0070662_1000019895 236
32 3300005457 Ga0070662_100007131 Ga0070662_1000071318 236
33 3300005457 Ga0070662_100017289 Ga0070662_1000172893 236
34 3300005457 Ga0070662_100030255 Ga0070662_1000302555 236
35 3300005535 Ga0070684_100026091 Ga0070684_1000260913 236
36 3300005543 Ga0070672_100068098 Ga0070672_1000680982 236
37 3300005548 Ga0070665_100080183 Ga0070665_1000801832 236
38 3300005564 Ga0070664_100003755 Ga0070664_10000375512 236
39 3300005564 Ga0070664_100059468 Ga0070664_1000594682 236
40 3300005564 Ga0070664_100205037 Ga0070664_1002050372 236
41 3300005577 Ga0068857_100030612 Ga0068857_1000306124 236
42 3300005578 Ga0068854_100003822 Ga0068854_1000038222 236
43 3300005614 Ga0068856_100008997 Ga0068856_1000089977 236
44 3300005614 Ga0068856_100472056 Ga0068856_1004720562 236
45 3300005616 Ga0068852_100011614 Ga0068852_1000116145 236
46 3300005616 Ga0068852_100038929 Ga0068852_1000389293 236
47 3300005616 Ga0068852_100688457 Ga0068852_1006884571 236
48 3300005618 Ga0068864_100028530 Ga0068864_1000285306 236
49 3300005618 Ga0068864_100035162 Ga0068864_1000351623 236
50 3300005834 Ga0068851_10156790 Ga0068851_101567901 236
51 3300005841 Ga0068863_100095885 Ga0068863_1000958854 236
52 3300005844 Ga0068862_100218759 Ga0068862_1002187593 236
53 3300006871 Ga0075434_100514904 Ga0075434_1005149042 236
54 3300009093 Ga0105240_10623354 Ga0105240_106233542 236
55 3300009174 Ga0105241_10191322 Ga0105241_101913223 236
56 3300009177 Ga0105248_10049177 Ga0105248_100491777 236
57 3300009177 Ga0105248_10161135 Ga0105248_101611352 236
58 3300009177 Ga0105248_10207723 Ga0105248_102077232 236
59 3300009177 Ga0105248_10309349 Ga0105248_103093492 236
60 3300009551 Ga0105238_10546767 Ga0105238_105467671 236
61 3300011119 Ga0105246_10001236 Ga0105246_1000123612 236
62 3300013102 Ga0157371_10051752 Ga0157371_100517523 236
63 3300013104 Ga0157370_10072675 Ga0157370_100726752 236
64 3300013105 Ga0157369_10514565 Ga0157369_105145652 236
65 3300013306 Ga0163162_10055061 Ga0163162_100550615 236
66 3300013307 Ga0157372_10113320 Ga0157372_101133203 236
67 3300013308 Ga0157375_10011059 Ga0157375_100110597 236
68 3300017792 Ga0163161_10070128 Ga0163161_100701284 236
69 3300025901 Ga0207688_10017938 Ga0207688_100179382 236
70 3300025908 Ga0207643_10279038 Ga0207643_102790382 236
71 3300025919 Ga0207657_10016875 Ga0207657_100168752 236
72 3300025920 Ga0207649_10018836 Ga0207649_100188366 236
73 3300025920 Ga0207649_10069176 Ga0207649_100691763 236
74 3300025920 Ga0207649_10074251 Ga0207649_100742512 236
75 3300025923 Ga0207681_10487160 Ga0207681_104871601 236
76 3300025925 Ga0207650_10048060 Ga0207650_100480603 236
77 3300025926 Ga0207659_10085399 Ga0207659_100853991 236
78 3300025931 Ga0207644_10004758 Ga0207644_100047582 236
79 3300025931 Ga0207644_10017452 Ga0207644_100174528 236
80 3300025932 Ga0207690_10061001 Ga0207690_100610012 236
81 3300025932 Ga0207690_10109229 Ga0207690_101092293 236
82 3300025933 Ga0207706_10003120 Ga0207706_100031205 236
83 3300025933 Ga0207706_10006675 Ga0207706_100066757 236
84 3300025933 Ga0207706_10120168 Ga0207706_101201683 236
85 3300025937 Ga0207669_10365623 Ga0207669_103656232 236
86 3300025937 Ga0207669_10387807 Ga0207669_103878072 236
87 3300025940 Ga0207691_10036319 Ga0207691_100363195 236
88 3300025940 Ga0207691_10214401 Ga0207691_102144012 236
89 3300025944 Ga0207661_10062691 Ga0207661_100626913 236
90 3300025944 Ga0207661_10327354 Ga0207661_103273542 236
91 3300025944 Ga0207661_10411280 Ga0207661_104112802 236
92 3300025945 Ga0207679_10032405 Ga0207679_100324055 236
93 3300025945 Ga0207679_10083585 Ga0207679_100835853 236
94 3300025960 Ga0207651_10013225 Ga0207651_100132252 236
95 3300025960 Ga0207651_10160391 Ga0207651_101603912 236
96 3300025961 Ga0207712_10132626 Ga0207712_101326263 236
97 3300025972 Ga0207668_10058871 Ga0207668_100588713 236
98 3300025972 Ga0207668_10336102 Ga0207668_103361021 236
99 3300025981 Ga0207640_10249382 Ga0207640_102493822 236
100 3300025986 Ga0207658_10128706 Ga0207658_101287062 236
101 3300025986 Ga0207658_10194400 Ga0207658_101944003 236
102 3300026041 Ga0207639_10332602 Ga0207639_103326022 236
103 3300026041 Ga0207639_10625304 Ga0207639_106253042 236
104 3300026041 Ga0207639_10655951 Ga0207639_106559511 236
105 3300026067 Ga0207678_10015630 Ga0207678_100156306 236
106 3300026067 Ga0207678_10029713 Ga0207678_100297133 236
107 3300026078 Ga0207702_10008508 Ga0207702_100085084 236
108 3300026078 Ga0207702_10033340 Ga0207702_100333403 236
109 3300026088 Ga0207641_10036006 Ga0207641_100360066 236
110 3300026089 Ga0207648_10489826 Ga0207648_104898261 236
111 3300026095 Ga0207676_10006711 Ga0207676_100067116 236
112 3300026095 Ga0207676_10021484 Ga0207676_100214846 236
113 3300026095 Ga0207676_10114033 Ga0207676_101140333 236
114 3300026116 Ga0207674_10004612 Ga0207674_1000461210 236
115 3300026116 Ga0207674_10005367 Ga0207674_1000536712 236
116 3300026116 Ga0207674_10145971 Ga0207674_101459712 236
117 3300026118 Ga0207675_100527904 Ga0207675_1005279042 236
118 3300026121 Ga0207683_10180294 Ga0207683_101802942 236
119 3300026121 Ga0207683_10249516 Ga0207683_102495162 236
120 3300026142 Ga0207698_10007457 Ga0207698_100074577 236
121 3300026142 Ga0207698_10056284 Ga0207698_100562844 236
122 3300026142 Ga0207698_10369135 Ga0207698_103691351 236
123 3300028380 Ga0268265_10149298 Ga0268265_101492983 236
124 3300031456 Ga0307513_10123908 Ga0307513_101239083 236
125 3300031548 Ga0307408_100232462 Ga0307408_1002324621 236
126 3300031548 Ga0307408_100250383 Ga0307408_1002503832 236
127 3300031824 Ga0307413_10264948 Ga0307413_102649482 236
128 3300031852 Ga0307410_10035163 Ga0307410_100351633 236
129 3300031852 Ga0307410_10042014 Ga0307410_100420145 236
130 3300031901 Ga0307406_10102189 Ga0307406_101021893 236
131 3300031995 Ga0307409_100346347 Ga0307409_1003463472 236
132 3300032002 Ga0307416_100241703 Ga0307416_1002417031 236
133 3300032002 Ga0307416_100933041 Ga0307416_1009330412 236
134 3300032005 Ga0307411_10106225 Ga0307411_101062253 236
135 3300032005 Ga0307411_10229684 Ga0307411_102296842 236
136 3300037312 Ga0395899_0045863 Ga0395899_0045863_981_1727 236
137 3300037312 Ga0395899_0052855 Ga0395899_0052855_564_1310 236
138 3300037418 Ga0395900_0015350 Ga0395900_0015350_5474_6220 236
139 3300037418 Ga0395900_0132063 Ga0395900_0132063_1068_1814 236
140 3300037466 Ga0395898_0098661 Ga0395898_0098661_498_1244 236
141 3300037466 Ga0395898_0184991 Ga0395898_0184991_623_1429 236
142 3300037466 Ga0395898_0526763 Ga0395898_0526763_131_877 236
143 3300037471 Ga0395905_0010915 Ga0395905_0010915_1478_2224 236
144 3300037471 Ga0395905_0014089 Ga0395905_0014089_6277_7083 236
145 3300037471 Ga0395905_0066738 Ga0395905_0066738_70_822 236
146 3300037471 Ga0395905_0217798 Ga0395905_0217798_753_1499 236
147 3300038443 Ga0395901_0029510 Ga0395901_0029510_1496_2242 236
148 3300038443 Ga0395901_0069941 Ga0395901_0069941_1679_2425 236
149 3300038443 Ga0395901_0128414 Ga0395901_0128414_976_1782 236
150 3300042157 Ga0439458_0000109 Ga0439458_0000109_2810_3607 236
151 3300044693 Ga0466961_0051697 Ga0466961_0051697_209_955 236
152 3300044719 Ga0466971_0045859 Ga0466971_0045859_1019_1765 236
153 3300044719 Ga0466971_0090815 Ga0466971_0090815_24_770 236
154 3300044842 Ga0466957_0015544 Ga0466957_0015544_348_1223 236
155 3300044842 Ga0466957_0378222 Ga0466957_0378222_200_946 236
156 3300045049 Ga0466959_0244682 Ga0466959_0244682_436_1182 236
157 3300045836 Ga0466958_0179789 Ga0466958_0179789_97_843 236
158 3300045976 Ga0466967_0019275 Ga0466967_0019275_94_840 236
159 3300046616 Ga0495668_0021740 Ga0495668_0021740_881_1672 236
160 3300048910 Ga0496107_0037609 Ga0496107_0037609_1118_1864 236
161 3300048912 Ga0496109_0252855 Ga0496109_0252855_854_1600 236
162 3300048913 Ga0496110_0095264 Ga0496110_0095264_1153_1899 236
163 3300048913 Ga0496110_0145914 Ga0496110_0145914_853_1599 236
164 3300048914 Ga0496111_0093525 Ga0496111_0093525_942_1688 236
165 3300050512 nmdc:mga0n895_476320_c1 nmdc:mga0n895_476320_c1_341_1093 236
166 3300053083 Ga0495655_0001821 Ga0495655_0001821_1105_1887 236
167 3300053134 Ga0500658_0000105 Ga0500658_0000105_37372_38163 236
168 3300061719 Ga0466962_0068623 Ga0466962_0068623_536_1282 236
169 3300001904 JGI24736J21556_1000860 JGI24736J21556_10008606 237
170 3300001904 JGI24736J21556_1011492 JGI24736J21556_10114922 237
171 3300001979 JGI24740J21852_10003212 JGI24740J21852_100032127 237
172 3300001979 JGI24740J21852_10009227 JGI24740J21852_100092274 237
173 3300001989 JGI24739J22299_10002407 JGI24739J22299_100024076 237
174 3300001990 JGI24737J22298_10000206 JGI24737J22298_100002063 237
175 3300001990 JGI24737J22298_10002181 JGI24737J22298_100021819 237
176 3300001990 JGI24737J22298_10005581 JGI24737J22298_100055815 237
177 3300001990 JGI24737J22298_10035006 JGI24737J22298_100350061 237
178 3300002067 JGI24735J21928_10065870 JGI24735J21928_100658701 237
179 3300002075 JGI24738J21930_10003464 JGI24738J21930_100034642 237
180 3300002459 JGI24751J29686_10022676 JGI24751J29686_100226762 237
181 3300005327 Ga0070658_10000374 Ga0070658_1000037410 237
182 3300005327 Ga0070658_10227861 Ga0070658_102278612 237
183 3300005327 Ga0070658_10389950 Ga0070658_103899501 237
184 3300005328 Ga0070676_10071131 Ga0070676_100711313 237
185 3300005328 Ga0070676_10109020 Ga0070676_101090202 237
186 3300005329 Ga0070683_100004286 Ga0070683_1000042864 237
187 3300005329 Ga0070683_100091962 Ga0070683_1000919623 237
188 3300005330 Ga0070690_100011455 Ga0070690_1000114553 237
189 3300005330 Ga0070690_100043855 Ga0070690_1000438553 237
190 3300005331 Ga0070670_100020797 Ga0070670_1000207976 237
191 3300005331 Ga0070670_100096550 Ga0070670_1000965502 237
192 3300005334 Ga0068869_100026860 Ga0068869_1000268606 237
193 3300005334 Ga0068869_100382019 Ga0068869_1003820191 237
194 3300005335 Ga0070666_10002899 Ga0070666_1000289912 237
195 3300005335 Ga0070666_10003596 Ga0070666_100035965 237
196 3300005335 Ga0070666_10046219 Ga0070666_100462193 237
197 3300005335 Ga0070666_10160634 Ga0070666_101606342 237
198 3300005336 Ga0070680_100002487 Ga0070680_1000024879 237
199 3300005338 Ga0068868_100011585 Ga0068868_1000115856 237
200 3300005338 Ga0068868_100058677 Ga0068868_1000586773 237
201 3300005339 Ga0070660_100000209 Ga0070660_10000020910 237
202 3300005339 Ga0070660_100008889 Ga0070660_1000088898 237
203 3300005339 Ga0070660_100010377 Ga0070660_1000103776 237
204 3300005339 Ga0070660_100038948 Ga0070660_1000389485 237
205 3300005339 Ga0070660_100048047 Ga0070660_1000480474 237
206 3300005339 Ga0070660_100229713 Ga0070660_1002297133 237
207 3300005340 Ga0070689_100096995 Ga0070689_1000969952 237
208 3300005341 Ga0070691_10017346 Ga0070691_100173463 237
209 3300005344 Ga0070661_100000674 Ga0070661_1000006748 237
210 3300005344 Ga0070661_100023394 Ga0070661_1000233942 237
211 3300005344 Ga0070661_100117586 Ga0070661_1001175863 237
212 3300005344 Ga0070661_100348981 Ga0070661_1003489812 237
213 3300005344 Ga0070661_100364924 Ga0070661_1003649242 237
214 3300005345 Ga0070692_10165400 Ga0070692_101654002 237
215 3300005353 Ga0070669_100073080 Ga0070669_1000730803 237
216 3300005353 Ga0070669_100149851 Ga0070669_1001498513 237
217 3300005354 Ga0070675_100167195 Ga0070675_1001671952 237
218 3300005355 Ga0070671_100015829 Ga0070671_1000158296 237
219 3300005355 Ga0070671_100019572 Ga0070671_1000195722 237
220 3300005355 Ga0070671_100024555 Ga0070671_1000245556 237
221 3300005355 Ga0070671_100086223 Ga0070671_1000862233 237
222 3300005355 Ga0070671_100386390 Ga0070671_1003863901 237
223 3300005356 Ga0070674_100041864 Ga0070674_1000418643 237
224 3300005364 Ga0070673_100020869 Ga0070673_1000208696 237
225 3300005364 Ga0070673_100084178 Ga0070673_1000841783 237
226 3300005364 Ga0070673_100338461 Ga0070673_1003384612 237
227 3300005364 Ga0070673_100436242 Ga0070673_1004362421 237
228 3300005366 Ga0070659_100002073 Ga0070659_10000207310 237
229 3300005366 Ga0070659_100006211 Ga0070659_1000062118 237
230 3300005366 Ga0070659_100010232 Ga0070659_1000102324 237
231 3300005366 Ga0070659_100027912 Ga0070659_1000279122 237
232 3300005366 Ga0070659_100054020 Ga0070659_1000540204 237
233 3300005366 Ga0070659_100075531 Ga0070659_1000755313 237
234 3300005366 Ga0070659_100090021 Ga0070659_1000900212 237
235 3300005366 Ga0070659_100152593 Ga0070659_1001525932 237
236 3300005367 Ga0070667_100003327 Ga0070667_1000033277 237
237 3300005367 Ga0070667_100005560 Ga0070667_10000556010 237
238 3300005367 Ga0070667_100016148 Ga0070667_1000161481 237
239 3300005367 Ga0070667_100017654 Ga0070667_1000176544 237
240 3300005367 Ga0070667_100033003 Ga0070667_1000330033 237
241 3300005367 Ga0070667_100151191 Ga0070667_1001511912 237
242 3300005367 Ga0070667_100283007 Ga0070667_1002830071 237
243 3300005435 Ga0070714_100072199 Ga0070714_1000721993 237
244 3300005435 Ga0070714_100433266 Ga0070714_1004332662 237
245 3300005444 Ga0070694_100097451 Ga0070694_1000974512 237
246 3300005455 Ga0070663_100002265 Ga0070663_1000022653 237
247 3300005455 Ga0070663_100005111 Ga0070663_1000051115 237
248 3300005455 Ga0070663_100035009 Ga0070663_1000350094 237
249 3300005455 Ga0070663_100037461 Ga0070663_1000374614 237
250 3300005456 Ga0070678_100065757 Ga0070678_1000657573 237
251 3300005457 Ga0070662_100000012 Ga0070662_10000001270 237
252 3300005457 Ga0070662_100058990 Ga0070662_1000589902 237
253 3300005457 Ga0070662_100328148 Ga0070662_1003281482 237
254 3300005458 Ga0070681_10075543 Ga0070681_100755433 237
255 3300005458 Ga0070681_10100600 Ga0070681_101006003 237
256 3300005459 Ga0068867_100090339 Ga0068867_1000903392 237
257 3300005530 Ga0070679_100012507 Ga0070679_1000125074 237
258 3300005535 Ga0070684_100050441 Ga0070684_1000504411 237
259 3300005539 Ga0068853_100000032 Ga0068853_10000003255 237
260 3300005539 Ga0068853_100032630 Ga0068853_1000326305 237
261 3300005539 Ga0068853_100034987 Ga0068853_1000349876 237
262 3300005539 Ga0068853_100063845 Ga0068853_1000638453 237
263 3300005539 Ga0068853_100470551 Ga0068853_1004705511 237
264 3300005543 Ga0070672_100065703 Ga0070672_1000657033 237
265 3300005543 Ga0070672_100093410 Ga0070672_1000934102 237
266 3300005544 Ga0070686_100033806 Ga0070686_1000338062 237
267 3300005545 Ga0070695_100087712 Ga0070695_1000877122 237
268 3300005546 Ga0070696_100041707 Ga0070696_1000417072 237
269 3300005547 Ga0070693_100000342 Ga0070693_10000034215 237
270 3300005548 Ga0070665_100004860 Ga0070665_10000486014 237
271 3300005548 Ga0070665_100250497 Ga0070665_1002504973 237
272 3300005563 Ga0068855_100000591 Ga0068855_10000059143 237
273 3300005563 Ga0068855_100363437 Ga0068855_1003634372 237
274 3300005564 Ga0070664_100002849 Ga0070664_10000284910 237
275 3300005564 Ga0070664_100033073 Ga0070664_1000330732 237
276 3300005564 Ga0070664_100038934 Ga0070664_1000389344 237
277 3300005577 Ga0068857_100098701 Ga0068857_1000987013 237
278 3300005577 Ga0068857_100098770 Ga0068857_1000987703 237
279 3300005577 Ga0068857_100203186 Ga0068857_1002031862 237
280 3300005578 Ga0068854_100006478 Ga0068854_1000064787 237
281 3300005578 Ga0068854_100030779 Ga0068854_1000307794 237
282 3300005578 Ga0068854_100041663 Ga0068854_1000416634 237
283 3300005578 Ga0068854_100111318 Ga0068854_1001113182 237
284 3300005578 Ga0068854_100329468 Ga0068854_1003294682 237
285 3300005578 Ga0068854_100362387 Ga0068854_1003623872 237
286 3300005578 Ga0068854_100435437 Ga0068854_1004354371 237
287 3300005614 Ga0068856_100000190 Ga0068856_10000019010 237
288 3300005614 Ga0068856_100020187 Ga0068856_1000201877 237
289 3300005614 Ga0068856_100168386 Ga0068856_1001683863 237
290 3300005614 Ga0068856_100288991 Ga0068856_1002889913 237
291 3300005614 Ga0068856_100362644 Ga0068856_1003626442 237
292 3300005614 Ga0068856_100503116 Ga0068856_1005031161 237
293 3300005616 Ga0068852_100000395 Ga0068852_10000039514 237
294 3300005616 Ga0068852_100002073 Ga0068852_10000207310 237
295 3300005616 Ga0068852_100021744 Ga0068852_1000217445 237
296 3300005616 Ga0068852_100051506 Ga0068852_1000515063 237
297 3300005616 Ga0068852_100111621 Ga0068852_1001116212 237
298 3300005616 Ga0068852_100144821 Ga0068852_1001448213 237
299 3300005616 Ga0068852_100367013 Ga0068852_1003670132 237
300 3300005616 Ga0068852_100987114 Ga0068852_1009871141 237
301 3300005617 Ga0068859_100000685 Ga0068859_10000068519 237
302 3300005617 Ga0068859_100040131 Ga0068859_1000401314 237
303 3300005617 Ga0068859_100094812 Ga0068859_1000948124 237
304 3300005617 Ga0068859_100134690 Ga0068859_1001346902 237
305 3300005618 Ga0068864_100000847 Ga0068864_10000084722 237
306 3300005618 Ga0068864_100014893 Ga0068864_1000148934 237
307 3300005618 Ga0068864_100025847 Ga0068864_1000258476 237
308 3300005618 Ga0068864_100027356 Ga0068864_1000273565 237
309 3300005618 Ga0068864_100200485 Ga0068864_1002004853 237
310 3300005834 Ga0068851_10213467 Ga0068851_102134671 237
311 3300005841 Ga0068863_100005917 Ga0068863_10000591710 237
312 3300005841 Ga0068863_100026328 Ga0068863_1000263282 237
313 3300005841 Ga0068863_100341354 Ga0068863_1003413542 237
314 3300005841 Ga0068863_100345183 Ga0068863_1003451832 237
315 3300005841 Ga0068863_100562437 Ga0068863_1005624372 237
316 3300005842 Ga0068858_100002934 Ga0068858_1000029345 237
317 3300005842 Ga0068858_100006170 Ga0068858_1000061702 237
318 3300005842 Ga0068858_100030883 Ga0068858_1000308834 237
319 3300005843 Ga0068860_100001106 Ga0068860_10000110610 237
320 3300005843 Ga0068860_100006941 Ga0068860_1000069412 237
321 3300005843 Ga0068860_100048248 Ga0068860_1000482485 237
322 3300005843 Ga0068860_100080459 Ga0068860_1000804594 237
323 3300005843 Ga0068860_100102330 Ga0068860_1001023304 237
324 3300005844 Ga0068862_100007304 Ga0068862_1000073048 237
325 3300005844 Ga0068862_100288246 Ga0068862_1002882462 237
326 3300005844 Ga0068862_100295291 Ga0068862_1002952911 237
327 3300005985 Ga0081539_10013686 Ga0081539_100136863 237
328 3300006051 Ga0075364_10133843 Ga0075364_101338433 237
329 3300006195 Ga0075366_10058074 Ga0075366_100580743 237
330 3300006237 Ga0097621_100007674 Ga0097621_1000076747 237
331 3300006237 Ga0097621_100010890 Ga0097621_1000108908 237
332 3300006237 Ga0097621_100024788 Ga0097621_1000247885 237
333 3300006358 Ga0068871_100040659 Ga0068871_1000406592 237
334 3300006358 Ga0068871_100081349 Ga0068871_1000813493 237
335 3300006844 Ga0075428_100052052 Ga0075428_1000520522 237
336 3300006852 Ga0075433_10022199 Ga0075433_100221995 237
337 3300006881 Ga0068865_100013945 Ga0068865_1000139456 237
338 3300006881 Ga0068865_100122730 Ga0068865_1001227303 237
339 3300006931 Ga0097620_100000685 Ga0097620_10000068514 237
340 3300006931 Ga0097620_100040129 Ga0097620_1000401294 237
341 3300006931 Ga0097620_100094807 Ga0097620_1000948073 237
342 3300006931 Ga0097620_100134695 Ga0097620_1001346952 237
343 3300009092 Ga0105250_10011311 Ga0105250_100113114 237
344 3300009093 Ga0105240_10131645 Ga0105240_101316451 237
345 3300009093 Ga0105240_10195563 Ga0105240_101955632 237
346 3300009093 Ga0105240_10199702 Ga0105240_101997022 237
347 3300009093 Ga0105240_10850364 Ga0105240_108503641 237
348 3300009094 Ga0111539_10010849 Ga0111539_100108495 237
349 3300009094 Ga0111539_10189288 Ga0111539_101892882 237
350 3300009098 Ga0105245_10025012 Ga0105245_100250125 237
351 3300009101 Ga0105247_10111114 Ga0105247_101111143 237
352 3300009101 Ga0105247_10250903 Ga0105247_102509032 237
353 3300009174 Ga0105241_10181613 Ga0105241_101816132 237
354 3300009177 Ga0105248_10000083 Ga0105248_1000008350 237
355 3300009177 Ga0105248_10001290 Ga0105248_1000129015 237
356 3300009177 Ga0105248_10010504 Ga0105248_100105048 237
357 3300009177 Ga0105248_10011986 Ga0105248_100119863 237
358 3300009177 Ga0105248_10242124 Ga0105248_102421243 237
359 3300009545 Ga0105237_10027386 Ga0105237_100273866 237
360 3300009551 Ga0105238_10005371 Ga0105238_100053718 237
361 3300009551 Ga0105238_10060953 Ga0105238_100609534 237
362 3300009551 Ga0105238_10243798 Ga0105238_102437982 237
363 3300009551 Ga0105238_10249062 Ga0105238_102490622 237
364 3300009553 Ga0105249_10004218 Ga0105249_1000421810 237
365 3300009553 Ga0105249_10037568 Ga0105249_100375685 237
366 3300009553 Ga0105249_10166104 Ga0105249_101661042 237
367 3300011119 Ga0105246_10036939 Ga0105246_100369394 237
368 3300011119 Ga0105246_10076875 Ga0105246_100768753 237
369 3300013100 Ga0157373_10024739 Ga0157373_100247395 237
370 3300013100 Ga0157373_10027921 Ga0157373_100279215 237
371 3300013100 Ga0157373_10051701 Ga0157373_100517014 237
372 3300013100 Ga0157373_10092002 Ga0157373_100920022 237
373 3300013100 Ga0157373_10249882 Ga0157373_102498821 237
374 3300013100 Ga0157373_10250776 Ga0157373_102507763 237
375 3300013102 Ga0157371_10013378 Ga0157371_100133786 237
376 3300013102 Ga0157371_10065439 Ga0157371_100654392 237
377 3300013102 Ga0157371_10071293 Ga0157371_100712933 237
378 3300013102 Ga0157371_10114036 Ga0157371_101140363 237
379 3300013102 Ga0157371_10157227 Ga0157371_101572271 237
380 3300013104 Ga0157370_10011909 Ga0157370_100119096 237
381 3300013104 Ga0157370_10215047 Ga0157370_102150472 237
382 3300013104 Ga0157370_10229904 Ga0157370_102299042 237
383 3300013104 Ga0157370_10427516 Ga0157370_104275162 237
384 3300013105 Ga0157369_10010429 Ga0157369_1001042910 237
385 3300013105 Ga0157369_10273282 Ga0157369_102732822 237
386 3300013105 Ga0157369_10340916 Ga0157369_103409162 237
387 3300013105 Ga0157369_10948914 Ga0157369_109489141 237
388 3300013296 Ga0157374_10282994 Ga0157374_102829942 237
389 3300013306 Ga0163162_10037700 Ga0163162_100377006 237
390 3300013306 Ga0163162_10076703 Ga0163162_100767033 237
391 3300013306 Ga0163162_10258811 Ga0163162_102588113 237
392 3300013306 Ga0163162_10966056 Ga0163162_109660561 237
393 3300013307 Ga0157372_10006659 Ga0157372_1000665911 237
394 3300013307 Ga0157372_10112642 Ga0157372_101126424 237
395 3300013307 Ga0157372_10224796 Ga0157372_102247963 237
396 3300013307 Ga0157372_10425486 Ga0157372_104254862 237
397 3300013308 Ga0157375_10572402 Ga0157375_105724022 237
398 3300013308 Ga0157375_10675911 Ga0157375_106759112 237
399 3300013308 Ga0157375_10779563 Ga0157375_107795632 237
400 3300014325 Ga0163163_10000307 Ga0163163_1000030711 237
401 3300014325 Ga0163163_10000364 Ga0163163_1000036443 237
402 3300014325 Ga0163163_10048670 Ga0163163_100486705 237
403 3300014497 Ga0182008_10040504 Ga0182008_100405043 237
404 3300014745 Ga0157377_10010129 Ga0157377_100101295 237
405 3300014745 Ga0157377_10025871 Ga0157377_100258712 237
406 3300014968 Ga0157379_10005320 Ga0157379_100053203 237
407 3300014968 Ga0157379_10029113 Ga0157379_100291134 237
408 3300014969 Ga0157376_10050828 Ga0157376_100508283 237
409 3300017792 Ga0163161_10091575 Ga0163161_100915753 237
410 3300025321 Ga0207656_10014925 Ga0207656_100149252 237
411 3300025321 Ga0207656_10068538 Ga0207656_100685384 237
412 3300025711 Ga0207696_1009256 Ga0207696_10092566 237
413 3300025893 Ga0207682_10052406 Ga0207682_100524062 237
414 3300025899 Ga0207642_10189578 Ga0207642_101895782 237
415 3300025901 Ga0207688_10051977 Ga0207688_100519773 237
416 3300025901 Ga0207688_10234151 Ga0207688_102341512 237
417 3300025903 Ga0207680_10001044 Ga0207680_1000104412 237
418 3300025903 Ga0207680_10022148 Ga0207680_100221484 237
419 3300025903 Ga0207680_10049246 Ga0207680_100492463 237
420 3300025904 Ga0207647_10003750 Ga0207647_1000375011 237
421 3300025904 Ga0207647_10005204 Ga0207647_100052045 237
422 3300025904 Ga0207647_10005744 Ga0207647_100057445 237
423 3300025904 Ga0207647_10008197 Ga0207647_100081974 237
424 3300025904 Ga0207647_10009701 Ga0207647_100097015 237
425 3300025904 Ga0207647_10011192 Ga0207647_100111922 237
426 3300025907 Ga0207645_10087331 Ga0207645_100873313 237
427 3300025909 Ga0207705_10000072 Ga0207705_1000007255 237
428 3300025909 Ga0207705_10028274 Ga0207705_100282746 237
429 3300025909 Ga0207705_10086331 Ga0207705_100863312 237
430 3300025909 Ga0207705_10150560 Ga0207705_101505603 237
431 3300025909 Ga0207705_10194114 Ga0207705_101941142 237
432 3300025909 Ga0207705_10213417 Ga0207705_102134171 237
433 3300025909 Ga0207705_10466551 Ga0207705_104665511 237
434 3300025911 Ga0207654_10126056 Ga0207654_101260562 237
435 3300025912 Ga0207707_10053862 Ga0207707_100538623 237
436 3300025912 Ga0207707_10256549 Ga0207707_102565492 237
437 3300025913 Ga0207695_10005583 Ga0207695_1000558315 237
438 3300025913 Ga0207695_10057521 Ga0207695_100575214 237
439 3300025913 Ga0207695_10159247 Ga0207695_101592473 237
440 3300025914 Ga0207671_10062809 Ga0207671_100628091 237
441 3300025914 Ga0207671_10476750 Ga0207671_104767502 237
442 3300025917 Ga0207660_10005019 Ga0207660_100050195 237
443 3300025919 Ga0207657_10000496 Ga0207657_1000049610 237
444 3300025919 Ga0207657_10004492 Ga0207657_1000449210 237
445 3300025919 Ga0207657_10007401 Ga0207657_1000740110 237
446 3300025919 Ga0207657_10010662 Ga0207657_100106628 237
447 3300025919 Ga0207657_10023986 Ga0207657_100239865 237
448 3300025919 Ga0207657_10104098 Ga0207657_101040983 237
449 3300025919 Ga0207657_10206631 Ga0207657_102066312 237
450 3300025919 Ga0207657_10292917 Ga0207657_102929172 237
451 3300025919 Ga0207657_10362631 Ga0207657_103626311 237
452 3300025920 Ga0207649_10000158 Ga0207649_1000015838 237
453 3300025920 Ga0207649_10015462 Ga0207649_100154622 237
454 3300025920 Ga0207649_10022700 Ga0207649_100227003 237
455 3300025920 Ga0207649_10038266 Ga0207649_100382663 237
456 3300025920 Ga0207649_10070606 Ga0207649_100706062 237
457 3300025921 Ga0207652_10001167 Ga0207652_1000116715 237
458 3300025921 Ga0207652_10392457 Ga0207652_103924572 237
459 3300025923 Ga0207681_10060659 Ga0207681_100606592 237
460 3300025923 Ga0207681_10094042 Ga0207681_100940422 237
461 3300025923 Ga0207681_10153041 Ga0207681_101530412 237
462 3300025924 Ga0207694_10014607 Ga0207694_100146074 237
463 3300025924 Ga0207694_10033272 Ga0207694_100332721 237
464 3300025924 Ga0207694_10056766 Ga0207694_100567663 237
465 3300025925 Ga0207650_10035924 Ga0207650_100359244 237
466 3300025925 Ga0207650_10055340 Ga0207650_100553402 237
467 3300025926 Ga0207659_10462465 Ga0207659_104624652 237
468 3300025927 Ga0207687_10036409 Ga0207687_100364093 237
469 3300025929 Ga0207664_10066793 Ga0207664_100667933 237
470 3300025929 Ga0207664_10298966 Ga0207664_102989662 237
471 3300025931 Ga0207644_10000358 Ga0207644_1000035819 237
472 3300025931 Ga0207644_10012673 Ga0207644_100126736 237
473 3300025931 Ga0207644_10014155 Ga0207644_100141552 237
474 3300025931 Ga0207644_10200857 Ga0207644_102008572 237
475 3300025931 Ga0207644_10239710 Ga0207644_102397102 237
476 3300025932 Ga0207690_10001410 Ga0207690_1000141017 237
477 3300025932 Ga0207690_10005347 Ga0207690_100053477 237
478 3300025932 Ga0207690_10009277 Ga0207690_100092778 237
479 3300025932 Ga0207690_10012196 Ga0207690_100121963 237
480 3300025932 Ga0207690_10012238 Ga0207690_100122383 237
481 3300025932 Ga0207690_10182730 Ga0207690_101827302 237
482 3300025933 Ga0207706_10000041 Ga0207706_1000004156 237
483 3300025933 Ga0207706_10003298 Ga0207706_1000329810 237
484 3300025933 Ga0207706_10009215 Ga0207706_100092156 237
485 3300025933 Ga0207706_10140011 Ga0207706_101400112 237
486 3300025933 Ga0207706_10330774 Ga0207706_103307742 237
487 3300025933 Ga0207706_10514097 Ga0207706_105140971 237
488 3300025934 Ga0207686_10118151 Ga0207686_101181513 237
489 3300025936 Ga0207670_10152691 Ga0207670_101526913 237
490 3300025938 Ga0207704_10025449 Ga0207704_100254494 237
491 3300025938 Ga0207704_10075647 Ga0207704_100756473 237
492 3300025938 Ga0207704_10077073 Ga0207704_100770733 237
493 3300025940 Ga0207691_10008814 Ga0207691_1000881412 237
494 3300025940 Ga0207691_10392387 Ga0207691_103923871 237
495 3300025941 Ga0207711_10000831 Ga0207711_1000083113 237
496 3300025941 Ga0207711_10001208 Ga0207711_1000120824 237
497 3300025941 Ga0207711_10231617 Ga0207711_102316173 237
498 3300025941 Ga0207711_10391174 Ga0207711_103911742 237
499 3300025942 Ga0207689_10006035 Ga0207689_1000603510 237
500 3300025942 Ga0207689_10273219 Ga0207689_102732192 237
501 3300025944 Ga0207661_10002967 Ga0207661_1000296710 237
502 3300025944 Ga0207661_10108965 Ga0207661_101089652 237
503 3300025945 Ga0207679_10003505 Ga0207679_100035053 237
504 3300025945 Ga0207679_10009869 Ga0207679_100098696 237
505 3300025945 Ga0207679_10093476 Ga0207679_100934763 237
506 3300025945 Ga0207679_10388146 Ga0207679_103881462 237
507 3300025949 Ga0207667_10002008 Ga0207667_1000200824 237
508 3300025949 Ga0207667_10005995 Ga0207667_100059956 237
509 3300025949 Ga0207667_10012442 Ga0207667_100124424 237
510 3300025949 Ga0207667_10032089 Ga0207667_100320893 237
511 3300025949 Ga0207667_10176662 Ga0207667_101766622 237
512 3300025960 Ga0207651_10012725 Ga0207651_100127256 237
513 3300025960 Ga0207651_10026456 Ga0207651_100264562 237
514 3300025960 Ga0207651_10099280 Ga0207651_100992802 237
515 3300025961 Ga0207712_10000819 Ga0207712_100008192 237
516 3300025961 Ga0207712_10036062 Ga0207712_100360624 237
517 3300025972 Ga0207668_10123654 Ga0207668_101236543 237
518 3300025972 Ga0207668_10259742 Ga0207668_102597421 237
519 3300025981 Ga0207640_10008226 Ga0207640_100082262 237
520 3300025981 Ga0207640_10033277 Ga0207640_100332774 237
521 3300025981 Ga0207640_10051605 Ga0207640_100516052 237
522 3300025981 Ga0207640_10055178 Ga0207640_100551783 237
523 3300025986 Ga0207658_10002673 Ga0207658_100026734 237
524 3300025986 Ga0207658_10003158 Ga0207658_100031588 237
525 3300025986 Ga0207658_10006868 Ga0207658_100068683 237
526 3300025986 Ga0207658_10067674 Ga0207658_100676742 237
527 3300025986 Ga0207658_10162842 Ga0207658_101628422 237
528 3300025986 Ga0207658_10403866 Ga0207658_104038662 237
529 3300026023 Ga0207677_10013551 Ga0207677_100135514 237
530 3300026023 Ga0207677_10072400 Ga0207677_100724003 237
531 3300026023 Ga0207677_10082245 Ga0207677_100822453 237
532 3300026023 Ga0207677_10254093 Ga0207677_102540932 237
533 3300026023 Ga0207677_10612451 Ga0207677_106124512 237
534 3300026035 Ga0207703_10001930 Ga0207703_100019306 237
535 3300026035 Ga0207703_10023804 Ga0207703_100238042 237
536 3300026035 Ga0207703_10026334 Ga0207703_100263344 237
537 3300026035 Ga0207703_10096134 Ga0207703_100961343 237
538 3300026041 Ga0207639_10000074 Ga0207639_1000007447 237
539 3300026041 Ga0207639_10009793 Ga0207639_100097933 237
540 3300026041 Ga0207639_10079762 Ga0207639_100797623 237
541 3300026041 Ga0207639_10381282 Ga0207639_103812822 237
542 3300026041 Ga0207639_10477176 Ga0207639_104771761 237
543 3300026067 Ga0207678_10005554 Ga0207678_1000555413 237
544 3300026067 Ga0207678_10009642 Ga0207678_100096425 237
545 3300026067 Ga0207678_10053563 Ga0207678_100535634 237
546 3300026067 Ga0207678_10349832 Ga0207678_103498322 237
547 3300026078 Ga0207702_10003674 Ga0207702_1000367410 237
548 3300026078 Ga0207702_10004666 Ga0207702_1000466612 237
549 3300026078 Ga0207702_10027944 Ga0207702_100279446 237
550 3300026078 Ga0207702_10052679 Ga0207702_100526791 237
551 3300026078 Ga0207702_10060585 Ga0207702_100605853 237
552 3300026078 Ga0207702_10386382 Ga0207702_103863822 237
553 3300026088 Ga0207641_10000502 Ga0207641_100005028 237
554 3300026088 Ga0207641_10036013 Ga0207641_100360136 237
555 3300026088 Ga0207641_10269953 Ga0207641_102699532 237
556 3300026088 Ga0207641_10801892 Ga0207641_108018921 237
557 3300026089 Ga0207648_10018551 Ga0207648_100185517 237
558 3300026089 Ga0207648_10713128 Ga0207648_107131281 237
559 3300026095 Ga0207676_10008921 Ga0207676_100089214 237
560 3300026095 Ga0207676_10015461 Ga0207676_100154616 237
561 3300026095 Ga0207676_10032734 Ga0207676_100327343 237
562 3300026095 Ga0207676_10051296 Ga0207676_100512962 237
563 3300026095 Ga0207676_10069199 Ga0207676_100691994 237
564 3300026095 Ga0207676_10336525 Ga0207676_103365251 237
565 3300026116 Ga0207674_10000086 Ga0207674_1000008678 237
566 3300026116 Ga0207674_10001687 Ga0207674_1000168734 237
567 3300026116 Ga0207674_10001715 Ga0207674_1000171513 237
568 3300026116 Ga0207674_10011675 Ga0207674_100116756 237
569 3300026116 Ga0207674_10140847 Ga0207674_101408472 237
570 3300026118 Ga0207675_100480570 Ga0207675_1004805702 237
571 3300026121 Ga0207683_10023087 Ga0207683_100230878 237
572 3300026142 Ga0207698_10001441 Ga0207698_100014418 237
573 3300026142 Ga0207698_10001717 Ga0207698_100017178 237
574 3300026142 Ga0207698_10005004 Ga0207698_100050048 237
575 3300026142 Ga0207698_10040073 Ga0207698_100400733 237
576 3300026142 Ga0207698_10097061 Ga0207698_100970612 237
577 3300026142 Ga0207698_10144724 Ga0207698_101447243 237
578 3300026142 Ga0207698_10176080 Ga0207698_101760801 237
579 3300027907 Ga0207428_10102317 Ga0207428_101023173 237
580 3300028379 Ga0268266_10002799 Ga0268266_1000279915 237
581 3300028379 Ga0268266_10152684 Ga0268266_101526843 237
582 3300028380 Ga0268265_10002045 Ga0268265_1000204510 237
583 3300028380 Ga0268265_10005838 Ga0268265_100058384 237
584 3300028380 Ga0268265_10063086 Ga0268265_100630863 237
585 3300028380 Ga0268265_10085025 Ga0268265_100850253 237
586 3300028380 Ga0268265_10136209 Ga0268265_101362093 237
587 3300028381 Ga0268264_10000410 Ga0268264_1000041050 237
588 3300028381 Ga0268264_10000418 Ga0268264_1000041844 237
589 3300028381 Ga0268264_10003670 Ga0268264_1000367011 237
590 3300028381 Ga0268264_10004427 Ga0268264_100044278 237
591 3300028381 Ga0268264_10049649 Ga0268264_100496495 237
592 3300028381 Ga0268264_10511985 Ga0268264_105119852 237
593 3300028381 Ga0268264_10621349 Ga0268264_106213492 237
594 3300031731 Ga0307405_10021649 Ga0307405_100216493 237
595 3300031731 Ga0307405_10219804 Ga0307405_102198041 237
596 3300031911 Ga0307412_10236533 Ga0307412_102365332 237
597 3300032002 Ga0307416_100001278 Ga0307416_10000127810 237
598 3300032002 Ga0307416_100177520 Ga0307416_1001775203 237
599 3300032002 Ga0307416_100701371 Ga0307416_1007013711 237
600 3300032126 Ga0307415_100001974 Ga0307415_10000197411 237
601 3300032126 Ga0307415_100056765 Ga0307415_1000567654 237
602 3300035691 Ga0373931_0038155 Ga0373931_0038155_506_1252 237
603 3300035724 Ga0373933_0090176 Ga0373933_0090176_139_1011 237
604 3300037068 Ga0373925_0658624 Ga0373925_0658624_77_829 237
605 3300037312 Ga0395899_0004923 Ga0395899_0004923_4728_5474 237
606 3300037312 Ga0395899_0098289 Ga0395899_0098289_1324_2070 237
607 3300037312 Ga0395899_0373106 Ga0395899_0373106_106_858 237
608 3300037418 Ga0395900_0014124 Ga0395900_0014124_4465_5280 237
609 3300037418 Ga0395900_0016744 Ga0395900_0016744_1535_2281 237
610 3300037418 Ga0395900_0031945 Ga0395900_0031945_1063_1809 237
611 3300037418 Ga0395900_0240308 Ga0395900_0240308_117_863 237
612 3300037418 Ga0395900_0628422 Ga0395900_0628422_210_956 237
613 3300037466 Ga0395898_0002701 Ga0395898_0002701_11226_11972 237
614 3300037466 Ga0395898_0259829 Ga0395898_0259829_685_1431 237
615 3300037466 Ga0395898_0676200 Ga0395898_0676200_150_896 237
616 3300037471 Ga0395905_0003223 Ga0395905_0003223_5697_6443 237
617 3300037471 Ga0395905_0008041 Ga0395905_0008041_9584_10330 237
618 3300037471 Ga0395905_0011911 Ga0395905_0011911_4159_4905 237
619 3300037471 Ga0395905_0027561 Ga0395905_0027561_960_1706 237
620 3300037471 Ga0395905_0030456 Ga0395905_0030456_1197_1949 237
621 3300037471 Ga0395905_0037798 Ga0395905_0037798_2504_3250 237
622 3300037471 Ga0395905_0039129 Ga0395905_0039129_3688_4434 237
623 3300037471 Ga0395905_0056905 Ga0395905_0056905_74_820 237
624 3300037471 Ga0395905_0072172 Ga0395905_0072172_102_848 237
625 3300037471 Ga0395905_0093632 Ga0395905_0093632_165_911 237
626 3300037471 Ga0395905_0231037 Ga0395905_0231037_849_1595 237
627 3300037471 Ga0395905_0301022 Ga0395905_0301022_582_1328 237
628 3300037471 Ga0395905_0595573 Ga0395905_0595573_52_798 237
629 3300038443 Ga0395901_0002307 Ga0395901_0002307_628_1374 237
630 3300038443 Ga0395901_0006240 Ga0395901_0006240_3391_4137 237
631 3300038443 Ga0395901_0017583 Ga0395901_0017583_5915_6661 237
632 3300038443 Ga0395901_0049375 Ga0395901_0049375_2870_3616 237
633 3300038443 Ga0395901_0070253 Ga0395901_0070253_2301_3047 237
634 3300038443 Ga0395901_0110468 Ga0395901_0110468_529_1275 237
635 3300038443 Ga0395901_0162507 Ga0395901_0162507_1019_1765 237
636 3300038443 Ga0395901_0190719 Ga0395901_0190719_531_1277 237
637 3300038443 Ga0395901_0465348 Ga0395901_0465348_364_1110 237
638 3300042004 Ga0439445_0001282 Ga0439445_0001282_3559_4311 237
639 3300042130 Ga0450892_005517 Ga0450892_005517_260_1012 237
640 3300042142 Ga0450905_007099 Ga0450905_007099_387_1133 237
641 3300042144 Ga0450889_000164 Ga0450889_000164_4939_5748 237
642 3300042157 Ga0439458_0000434 Ga0439458_0000434_3000_3746 237
643 3300044683 Ga0466965_0183342 Ga0466965_0183342_83_835 237
644 3300044694 Ga0466963_0006830 Ga0466963_0006830_2177_2953 237
645 3300044694 Ga0466963_0016446 Ga0466963_0016446_1376_2122 237
646 3300044694 Ga0466963_0209321 Ga0466963_0209321_148_894 237
647 3300044842 Ga0466957_0015521 Ga0466957_0015521_2781_3557 237
648 3300044842 Ga0466957_0309128 Ga0466957_0309128_230_976 237
649 3300044901 Ga0466960_0032729 Ga0466960_0032729_732_1484 237
650 3300045836 Ga0466958_0016344 Ga0466958_0016344_1627_2373 237
651 3300045976 Ga0466967_0008915 Ga0466967_0008915_320_1096 237
652 3300045976 Ga0466967_0148126 Ga0466967_0148126_847_1656 237
653 3300045976 Ga0466967_0152179 Ga0466967_0152179_779_1525 237
654 3300045976 Ga0466967_0881734 Ga0466967_0881734_127_873 237
655 3300045976 Ga0466967_1012951 Ga0466967_1012951_52_798 237
656 3300048088 Ga0495602_0109187 Ga0495602_0109187_885_1757 237
657 3300048903 Ga0496100_0096199 Ga0496100_0096199_579_1325 237
658 3300048904 Ga0496101_0002532 Ga0496101_0002532_1555_2301 237
659 3300048905 Ga0496102_0022374 Ga0496102_0022374_3043_3789 237
660 3300048906 Ga0496103_0031204 Ga0496103_0031204_2046_2792 237
661 3300048906 Ga0496103_0086960 Ga0496103_0086960_674_1420 237
662 3300048907 Ga0496104_0256167 Ga0496104_0256167_650_1396 237
663 3300048908 Ga0496105_0026043 Ga0496105_0026043_1964_2710 237
664 3300048908 Ga0496105_0237985 Ga0496105_0237985_412_1158 237
665 3300048908 Ga0496105_0302986 Ga0496105_0302986_93_839 237
666 3300048910 Ga0496107_0042345 Ga0496107_0042345_533_1279 237
667 3300048910 Ga0496107_0086374 Ga0496107_0086374_1398_2150 237
668 3300048911 Ga0496108_0239397 Ga0496108_0239397_307_1053 237
669 3300048911 Ga0496108_0250582 Ga0496108_0250582_526_1272 237
670 3300048912 Ga0496109_0023599 Ga0496109_0023599_4194_4940 237
671 3300048913 Ga0496110_0031758 Ga0496110_0031758_37_783 237
672 3300048913 Ga0496110_0102982 Ga0496110_0102982_76_822 237
673 3300048913 Ga0496110_0254485 Ga0496110_0254485_361_1107 237
674 3300048913 Ga0496110_0505732 Ga0496110_0505732_80_826 237
675 3300048914 Ga0496111_0020675 Ga0496111_0020675_1125_1871 237
676 3300048914 Ga0496111_0039667 Ga0496111_0039667_1658_2404 237
677 3300048914 Ga0496111_0099358 Ga0496111_0099358_136_882 237
678 3300048915 Ga0496112_0006417 Ga0496112_0006417_476_1222 237
679 3300048915 Ga0496112_0055464 Ga0496112_0055464_1395_2141 237
680 3300048915 Ga0496112_0056604 Ga0496112_0056604_2186_2932 237
681 3300048916 Ga0496113_0011674 Ga0496113_0011674_1496_2242 237
682 3300048916 Ga0496113_0042430 Ga0496113_0042430_93_839 237
683 3300048916 Ga0496113_0438517 Ga0496113_0438517_220_966 237
684 3300048917 Ga0496114_0504219 Ga0496114_0504219_241_987 237
685 3300049583 Ga0501067_0031476 Ga0501067_0031476_130_921 237
686 3300049584 Ga0501068_0099051 Ga0501068_0099051_326_1072 237
687 3300049590 Ga0501074_0059470 Ga0501074_0059470_274_1020 237
688 3300049742 Ga0501080_0011952 Ga0501080_0011952_805_1551 237
689 3300050491 nmdc:mga00v17_129740_c1 nmdc:mga00v17_129740_c1_820_1566 237
690 3300050496 nmdc:mga07m45_166949_c1 nmdc:mga07m45_166949_c1_249_995 237
691 3300050509 nmdc:mga0qj67_215851_c1 nmdc:mga0qj67_215851_c1_761_1507 237
692 3300050511 nmdc:mga08y16_132594_c1 nmdc:mga08y16_132594_c1_1296_2042 237
693 3300050515 nmdc:mga0a205_7550_c1 nmdc:mga0a205_7550_c1_6845_7591 237
694 3300053078 Ga0495612_0058747 Ga0495612_0058747_112_858 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

100

289

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c51-assembly1.cif.gz_A crystal structure of a simpl-like protein from campylobacter jejuni (native protein) 0.8486 42 234
7c51-assembly1.cif.gz_A crystal structure of a simpl-like protein from campylobacter jejuni (native protein) 0.8278 42 234
1nfh-assembly1.cif.gz_B-2 structure of a sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of dna-binding 0.62 63 132
6usf-assembly1.cif.gz_D cryoem structure of human alpha4beta2 nicotinic acetylcholine receptor with varenicline in complex with anti-bril synthetic antibody bak5 0.6131 96 134
2z7c-assembly1.cif.gz_A crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii 0.6064 63 136
ID Description Score Start End Superfamily
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.8144 61 163 3.30.70.2970
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7932 61 163 3.30.70.2970
af_P0ADS6_28_138_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7665 53 152 3.30.70.2970
4hvzA01 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Protein of unknown function (DUF541), domain 1 0.7235 172 237 3.30.110.170
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7158 58 163 3.30.70.2970
ID Description Score Start End GO Terms
AF-A0A825DZM8-F1-model_v4 deleted 0.8799 43 236
AF-A0A2V9KZB7-F1-model_v4 SIMPL domain-containing protein 0.8768 43 149 GO:0006974
AF-A0A512TKN6-F1-model_v4 Uncharacterized protein 0.8595 55 152 GO:0006974
AF-A0A825DZM8-F1-model_v4 deleted 0.8467 43 236
AF-A0A7X6Y2C3-F1-model_v4 SIMPL domain-containing protein 0.8324 55 165 GO:0006974

Feature Viewer

pLDDT pTM Quality
86.16 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map