F475626

General Info

Members Datasets Scaffolds Average Seq Length
693 308 1386 155

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1079394|Ga0055528_10793941
Length 159
Sequence MNSTVVDVVPLILIGGLTTAGVYLLLERNLTRMLLGLLLVGNAVNLLILTVGGPAGNPPIRGRTSDGKTTTADPLAQGMVLTAIVISMGIAAFVLALTYRSYRLSREEDVANDPEDTRVSELSDMSAGAIDEDLVTHDPARDTDAPDELDALPGHEGSR

Samples

Sample ID Description Type Environment
1 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
285 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
286 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
298 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
299 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
300 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
301 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
302 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
303 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
304 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
305 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
306 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
307 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
308 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.85
Nodule 0.14
Rhizoplane 11.98
Rhizosphere 67.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055528_1079394 3300003790 Bacteria 579
2 JGI24737J22298_10021133 3300001990 Bacteria 2076
3 JGI24735J21928_10135182 3300002067 Bacteria 711
4 JGI24745J21846_1001095 3300002073 Bacteria 2562
5 JGI24744J21845_10000037 3300002077 Bacteria 15645
6 JGI24744J21845_10006862 3300002077 Bacteria 2353
7 JGI24034J26672_10001279 3300002239 Bacteria 3311
8 JGI24742J22300_10002482 3300002244 Bacteria 2949
9 Ga0055540_1001186 3300003792 Bacteria 16069
10 Ga0055540_1006526 3300003792 Bacteria 4609
11 Ga0070676_10009420 3300005328 Bacteria 5275
12 Ga0070676_10054920 3300005328 Bacteria 2349
13 Ga0070690_100005907 3300005330 Bacteria 6906
14 Ga0070690_100247005 3300005330 Bacteria 1261
15 Ga0070690_101298397 3300005330 Bacteria 583
16 Ga0070670_100107730 3300005331 Bacteria 2401
17 Ga0068869_100003467 3300005334 Bacteria 9645
18 Ga0068869_100004965 3300005334 Bacteria 8324
19 Ga0070666_10026050 3300005335 Bacteria 3817
20 Ga0070666_10083344 3300005335 Bacteria 2187
21 Ga0070680_100402913 3300005336 Bacteria 1166
22 Ga0070682_100018857 3300005337 Bacteria 4040
23 Ga0070682_100157152 3300005337 Bacteria 1566
24 Ga0068868_100000860 3300005338 Bacteria 20605
25 Ga0068868_101046977 3300005338 Bacteria 748
26 Ga0070660_100116544 3300005339 Bacteria 2130
27 Ga0070660_100427745 3300005339 Bacteria 1097
28 Ga0070689_100018489 3300005340 Bacteria 5135
29 Ga0070691_10008023 3300005341 Bacteria 4829
30 Ga0070691_10080652 3300005341 Bacteria 1593
31 Ga0070692_10247947 3300005345 Bacteria 1065
32 Ga0070668_100004256 3300005347 Bacteria 10621
33 Ga0070668_100182372 3300005347 Bacteria 1715
34 Ga0070668_100288836 3300005347 Bacteria 1372
35 Ga0070668_100752972 3300005347 Bacteria 862
36 Ga0070668_101253486 3300005347 Bacteria 673
37 Ga0070669_100007192 3300005353 Bacteria 7993
38 Ga0070669_100057885 3300005353 Bacteria 2845
39 Ga0070669_100101750 3300005353 Bacteria 2169
40 Ga0070671_100003316 3300005355 Bacteria 12559
41 Ga0070671_100034474 3300005355 Bacteria 4190
42 Ga0070674_100000505 3300005356 Bacteria 19608
43 Ga0070674_100369516 3300005356 Bacteria 1164
44 Ga0070688_100045466 3300005365 Bacteria 2713
45 Ga0070659_100019578 3300005366 Bacteria 5131
46 Ga0070659_100834858 3300005366 Bacteria 803
47 Ga0070667_100000029 3300005367 Bacteria 178990
48 Ga0070667_100002270 3300005367 Bacteria 16919
49 Ga0070667_100009046 3300005367 Bacteria 8244
50 Ga0070667_100057127 3300005367 Bacteria 3297
51 Ga0070667_100348799 3300005367 Bacteria 1340
52 Ga0070667_100466021 3300005367 Bacteria 1155
53 Ga0070667_100991740 3300005367 Bacteria 784
54 Ga0070703_10078028 3300005406 Bacteria 1121
55 Ga0070709_10048834 3300005434 Bacteria 2642
56 Ga0070709_10841066 3300005434 Bacteria 722
57 Ga0070714_100920711 3300005435 Bacteria 849
58 Ga0070710_10009509 3300005437 Bacteria 4757
59 Ga0070710_10035471 3300005437 Bacteria 2719
60 Ga0070701_10001625 3300005438 Bacteria 8391
61 Ga0070711_100001681 3300005439 Bacteria 12253
62 Ga0070711_100107291 3300005439 Bacteria 2043
63 Ga0070705_100050941 3300005440 Bacteria 2411
64 Ga0070705_100083363 3300005440 Bacteria 1970
65 Ga0070700_100001238 3300005441 Bacteria 12656
66 Ga0070700_100132558 3300005441 Bacteria 1683
67 Ga0070694_100026304 3300005444 Bacteria 3770
68 Ga0070694_100543114 3300005444 Bacteria 930
69 Ga0070663_100064435 3300005455 Bacteria 2649
70 Ga0070663_100093517 3300005455 Bacteria 2231
71 Ga0070663_100157399 3300005455 Bacteria 1746
72 Ga0070678_100002692 3300005456 Bacteria 9797
73 Ga0070678_100146213 3300005456 Bacteria 1898
74 Ga0070662_100002292 3300005457 Bacteria 11751
75 Ga0070662_100164319 3300005457 Bacteria 1738
76 Ga0068867_100004656 3300005459 Bacteria 9651
77 Ga0068867_100045222 3300005459 Bacteria 3228
78 Ga0070685_10090408 3300005466 Bacteria 1852
79 Ga0070685_10675758 3300005466 Bacteria 751
80 Ga0070679_100754248 3300005530 Bacteria 916
81 Ga0068853_100015503 3300005539 Bacteria 6260
82 Ga0068853_100020712 3300005539 Bacteria 5470
83 Ga0070672_100211299 3300005543 Bacteria 1625
84 Ga0070686_100094354 3300005544 Bacteria 2008
85 Ga0070686_100171404 3300005544 Bacteria 1535
86 Ga0070695_100013059 3300005545 Bacteria 4989
87 Ga0070696_100013764 3300005546 Bacteria 5432
88 Ga0070696_100029192 3300005546 Bacteria 3767
89 Ga0070693_100008073 3300005547 Bacteria 5168
90 Ga0070665_100005028 3300005548 Bacteria 13715
91 Ga0070665_100007037 3300005548 Bacteria 11431
92 Ga0070665_100018659 3300005548 Bacteria 6953
93 Ga0070665_100100360 3300005548 Bacteria 2898
94 Ga0070665_100566856 3300005548 Bacteria 1148
95 Ga0070704_100001365 3300005549 Bacteria 12949
96 Ga0070704_100372235 3300005549 Bacteria 1211
97 Ga0068854_100002626 3300005578 Bacteria 11140
98 Ga0068854_100040105 3300005578 Bacteria 3302
99 Ga0070702_100001171 3300005615 Bacteria 10559
100 Ga0070702_100005931 3300005615 Bacteria 5740
101 Ga0070702_100398628 3300005615 Bacteria 984
102 Ga0068852_100044942 3300005616 Bacteria 3754
103 Ga0068852_100097350 3300005616 Bacteria 2647
104 Ga0068852_100726719 3300005616 Bacteria 1004
105 Ga0068859_100001467 3300005617 Bacteria 24018
106 Ga0068859_100012822 3300005617 Bacteria 8417
107 Ga0068859_100034892 3300005617 Bacteria 5047
108 Ga0068864_100689814 3300005618 Bacteria 997
109 Ga0068864_100872756 3300005618 Bacteria 887
110 Ga0068866_10000577 3300005718 Bacteria 16668
111 Ga0068861_100005512 3300005719 Bacteria 8571
112 Ga0068861_100015271 3300005719 Bacteria 5407
113 Ga0068861_100092358 3300005719 Bacteria 2391
114 Ga0068851_10200159 3300005834 Bacteria 1114
115 Ga0068870_10027221 3300005840 Bacteria 2858
116 Ga0068870_10141529 3300005840 Bacteria 1408
117 Ga0068863_100000465 3300005841 Bacteria 41376
118 Ga0068863_100005922 3300005841 Bacteria 11992
119 Ga0068863_100070873 3300005841 Bacteria 3297
120 Ga0068863_100305723 3300005841 Bacteria 1543
121 Ga0068858_100002228 3300005842 Bacteria 19593
122 Ga0068858_100010235 3300005842 Bacteria 8898
123 Ga0068858_100121606 3300005842 Bacteria 2441
124 Ga0068860_100000088 3300005843 Bacteria 154416
125 Ga0068860_100007392 3300005843 Bacteria 10988
126 Ga0068860_100098828 3300005843 Bacteria 2783
127 Ga0068860_100175223 3300005843 Bacteria 2073
128 Ga0068862_100000056 3300005844 Bacteria 142257
129 Ga0068862_100189112 3300005844 Bacteria 1851
130 Ga0068862_101201620 3300005844 Bacteria 757
131 Ga0081455_10032467 3300005937 Bacteria 4703
132 Ga0075365_10016337 3300006038 Bacteria 4513
133 Ga0075365_10039711 3300006038 Bacteria 3066
134 Ga0075365_10088273 3300006038 Bacteria 2109
135 Ga0075365_10316941 3300006038 Bacteria 1098
136 Ga0075365_11042783 3300006038 Bacteria 576
137 Ga0075363_100000041 3300006048 Bacteria 24416
138 Ga0075363_100001192 3300006048 Bacteria 9588
139 Ga0075363_100028834 3300006048 Bacteria 2860
140 Ga0075363_100179787 3300006048 Bacteria 1203
141 Ga0075363_100183235 3300006048 Bacteria 1192
142 Ga0075363_100448394 3300006048 Bacteria 762
143 Ga0075363_100620471 3300006048 Bacteria 649
144 Ga0075364_10006335 3300006051 Bacteria 6953
145 Ga0075364_10006684 3300006051 Bacteria 6799
146 Ga0075364_10202686 3300006051 Bacteria 1345
147 Ga0075364_10324806 3300006051 Bacteria 1048
148 Ga0075364_10328366 3300006051 Bacteria 1042
149 Ga0070715_10019647 3300006163 Bacteria 2595
150 Ga0070716_100021232 3300006173 Bacteria 3419
151 Ga0070716_100098519 3300006173 Bacteria 1787
152 Ga0070712_100003928 3300006175 Bacteria 9153
153 Ga0070712_100066855 3300006175 Bacteria 2556
154 Ga0075362_10032915 3300006177 Bacteria 2253
155 Ga0075367_10003749 3300006178 Bacteria 7316
156 Ga0075367_10060164 3300006178 Bacteria 2264
157 Ga0075367_10341499 3300006178 Bacteria 944
158 Ga0075369_10000691 3300006186 Bacteria 10806
159 Ga0075369_10005328 3300006186 Bacteria 4797
160 Ga0075369_10009962 3300006186 Bacteria 3709
161 Ga0075369_10018504 3300006186 Bacteria 2837
162 Ga0075369_10019888 3300006186 Bacteria 2745
163 Ga0075369_10039950 3300006186 Bacteria 2004
164 Ga0075369_10054044 3300006186 Bacteria 1743
165 Ga0075369_10115689 3300006186 Bacteria 1211
166 Ga0075369_10142616 3300006186 Bacteria 1093
167 Ga0075369_10280616 3300006186 Bacteria 776
168 Ga0075369_10336988 3300006186 Bacteria 707
169 Ga0097621_100267017 3300006237 Bacteria 1503
170 Ga0075370_10000413 3300006353 Bacteria 15789
171 Ga0075370_10013246 3300006353 Bacteria 4378
172 Ga0075370_10030284 3300006353 Bacteria 3018
173 Ga0075370_10088049 3300006353 Bacteria 1790
174 Ga0068871_100079847 3300006358 Bacteria 2707
175 Ga0068871_100307379 3300006358 Bacteria 1393
176 Ga0068871_100805279 3300006358 Bacteria 866
177 Ga0075428_100004705 3300006844 Bacteria 15104
178 Ga0075430_100025015 3300006846 Bacteria 5080
179 Ga0075430_100204488 3300006846 Bacteria 1639
180 Ga0075434_101243498 3300006871 Bacteria 756
181 Ga0068865_100000595 3300006881 Bacteria 20259
182 Ga0068865_100197344 3300006881 Bacteria 1560
183 Ga0097620_100001467 3300006931 Bacteria 24018
184 Ga0097620_100012822 3300006931 Bacteria 8417
185 Ga0097620_100034891 3300006931 Bacteria 5047
186 Ga0105250_10026527 3300009092 Bacteria 2334
187 Ga0105250_10252954 3300009092 Bacteria 753
188 Ga0111539_10654480 3300009094 Bacteria 1223
189 Ga0105245_10000753 3300009098 Bacteria 29286
190 Ga0105245_10039100 3300009098 Bacteria 4222
191 Ga0105247_10000008 3300009101 Bacteria 391450
192 Ga0105247_10001050 3300009101 Bacteria 20695
193 Ga0105247_10031446 3300009101 Bacteria 3221
194 Ga0105247_10499535 3300009101 Bacteria 886
195 Ga0114129_10022080 3300009147 Bacteria 9031
196 Ga0114129_11279014 3300009147 Bacteria 910
197 Ga0105243_10002393 3300009148 Bacteria 15721
198 Ga0105243_10040206 3300009148 Bacteria 3650
199 Ga0105241_10028611 3300009174 Bacteria 4154
200 Ga0105241_10101922 3300009174 Bacteria 2283
201 Ga0105241_10651572 3300009174 Bacteria 956
202 Ga0105242_10000885 3300009176 Bacteria 23245
203 Ga0105242_10034076 3300009176 Bacteria 4081
204 Ga0105248_10000051 3300009177 Bacteria 150288
205 Ga0105248_10019104 3300009177 Bacteria 7579
206 Ga0105248_10126836 3300009177 Bacteria 2879
207 Ga0105248_10691466 3300009177 Bacteria 1151
208 Ga0105237_10028180 3300009545 Bacteria 5724
209 Ga0105237_10076311 3300009545 Bacteria 3342
210 Ga0105237_10078540 3300009545 Bacteria 3290
211 Ga0105237_10217087 3300009545 Bacteria 1912
212 Ga0105249_10000040 3300009553 Bacteria 196153
213 Ga0105249_10001945 3300009553 Bacteria 17928
214 Ga0105249_10005906 3300009553 Bacteria 10600
215 Ga0105249_10114591 3300009553 Bacteria 2552
216 Ga0105249_10595193 3300009553 Bacteria 1160
217 Ga0105249_10669519 3300009553 Bacteria 1096
218 Ga0099796_10020708 3300010159 Bacteria 2014
219 Ga0105239_10003126 3300010375 Bacteria 20550
220 Ga0105239_10082418 3300010375 Bacteria 3542
221 Ga0105239_10276826 3300010375 Bacteria 1888
222 Ga0105239_10463870 3300010375 Bacteria 1438
223 Ga0105239_11097808 3300010375 Bacteria 916
224 Ga0105246_10073046 3300011119 Bacteria 2420
225 Ga0105246_10634154 3300011119 Bacteria 928
226 Ga0157373_10352748 3300013100 Bacteria 1050
227 Ga0157369_10330599 3300013105 Bacteria 1584
228 Ga0157374_10019678 3300013296 Bacteria 5978
229 Ga0157378_10001354 3300013297 Bacteria 22032
230 Ga0163162_10003848 3300013306 Bacteria 14398
231 Ga0163162_10088345 3300013306 Bacteria 3179
232 Ga0163162_11075547 3300013306 Bacteria 911
233 Ga0163162_11606457 3300013306 Bacteria 742
234 Ga0157372_10295551 3300013307 Bacteria 1884
235 Ga0157372_11052208 3300013307 Bacteria 942
236 Ga0157372_11052497 3300013307 Bacteria 942
237 Ga0157375_10000340 3300013308 Bacteria 42196
238 Ga0157375_10601951 3300013308 Bacteria 1258
239 Ga0157375_11291822 3300013308 Bacteria 858
240 Ga0157375_11725963 3300013308 Bacteria 742
241 Ga0157375_12772425 3300013308 Bacteria 586
242 Ga0163163_10028880 3300014325 Bacteria 5331
243 Ga0163163_10112211 3300014325 Bacteria 2755
244 Ga0157380_10000251 3300014326 Bacteria 32377
245 Ga0157377_10197058 3300014745 Bacteria 1276
246 Ga0157379_10032909 3300014968 Bacteria 4623
247 Ga0157376_10010466 3300014969 Bacteria 6785
248 Ga0157376_10067190 3300014969 Bacteria 3032
249 Ga0163161_10000280 3300017792 Bacteria 44602
250 Ga0163161_10209733 3300017792 Bacteria 1505
251 Ga0163161_10299604 3300017792 Bacteria 1266
252 Ga0163161_10684609 3300017792 Bacteria 852
253 Ga0209673_1005991 3300025273 Bacteria 5980
254 Ga0209051_1000034 3300025303 Bacteria 371498
255 Ga0209051_1001623 3300025303 Bacteria 18335
256 Ga0209051_1002089 3300025303 Bacteria 15055
257 Ga0209051_1045990 3300025303 Bacteria 1505
258 Ga0207656_10059873 3300025321 Bacteria 1668
259 Ga0207653_10190573 3300025885 Bacteria 770
260 Ga0207692_10014904 3300025898 Bacteria 3408
261 Ga0207692_10121802 3300025898 Bacteria 1462
262 Ga0207642_10000287 3300025899 Bacteria 15092
263 Ga0207642_10034771 3300025899 Bacteria 2146
264 Ga0207710_10000006 3300025900 Bacteria 538831
265 Ga0207710_10036531 3300025900 Bacteria 2166
266 Ga0207688_10000674 3300025901 Bacteria 16862
267 Ga0207688_10005931 3300025901 Bacteria 6648
268 Ga0207680_10129545 3300025903 Bacteria 1661
269 Ga0207647_10020151 3300025904 Bacteria 4476
270 Ga0207685_10006324 3300025905 Bacteria 3215
271 Ga0207685_10084438 3300025905 Bacteria 1322
272 Ga0207699_10037161 3300025906 Bacteria 2782
273 Ga0207699_10388163 3300025906 Bacteria 992
274 Ga0207645_10012924 3300025907 Bacteria 5649
275 Ga0207645_10114261 3300025907 Bacteria 1749
276 Ga0207643_10068078 3300025908 Bacteria 2045
277 Ga0207654_10192327 3300025911 Bacteria 1338
278 Ga0207654_10346551 3300025911 Bacteria 1022
279 Ga0207671_10016880 3300025914 Bacteria 5652
280 Ga0207671_10024451 3300025914 Bacteria 4542
281 Ga0207671_10253826 3300025914 Bacteria 1383
282 Ga0207693_10000806 3300025915 Bacteria 28060
283 Ga0207693_10002376 3300025915 Bacteria 16344
284 Ga0207663_10008324 3300025916 Bacteria 5415
285 Ga0207663_10016603 3300025916 Bacteria 4087
286 Ga0207663_10477346 3300025916 Bacteria 965
287 Ga0207662_10021547 3300025918 Bacteria 3686
288 Ga0207662_10502715 3300025918 Bacteria 835
289 Ga0207657_10170089 3300025919 Bacteria 1766
290 Ga0207649_10309332 3300025920 Bacteria 1158
291 Ga0207681_10076401 3300025923 Bacteria 2352
292 Ga0207681_10543378 3300025923 Bacteria 955
293 Ga0207694_10198020 3300025924 Bacteria 1633
294 Ga0207659_10095672 3300025926 Bacteria 2228
295 Ga0207659_10390081 3300025926 Bacteria 1163
296 Ga0207687_10001886 3300025927 Bacteria 14442
297 Ga0207687_10297641 3300025927 Bacteria 1299
298 Ga0207687_10326064 3300025927 Bacteria 1244
299 Ga0207664_10092068 3300025929 Bacteria 2488
300 Ga0207664_10655506 3300025929 Bacteria 944
301 Ga0207644_10041545 3300025931 Bacteria 3253
302 Ga0207690_10215229 3300025932 Bacteria 1467
303 Ga0207690_10224861 3300025932 Bacteria 1438
304 Ga0207706_10004709 3300025933 Bacteria 12778
305 Ga0207706_10010411 3300025933 Bacteria 8495
306 Ga0207686_10028610 3300025934 Bacteria 3278
307 Ga0207686_10386795 3300025934 Bacteria 1062
308 Ga0207709_10018749 3300025935 Bacteria 3880
309 Ga0207709_10591354 3300025935 Bacteria 878
310 Ga0207669_10000861 3300025937 Bacteria 12919
311 Ga0207704_10000826 3300025938 Bacteria 13703
312 Ga0207665_10001991 3300025939 Bacteria 13780
313 Ga0207665_10032109 3300025939 Bacteria 3476
314 Ga0207691_10015404 3300025940 Bacteria 7275
315 Ga0207691_10283938 3300025940 Bacteria 1424
316 Ga0207711_10000811 3300025941 Bacteria 30675
317 Ga0207711_10065442 3300025941 Bacteria 3142
318 Ga0207711_10275276 3300025941 Bacteria 1549
319 Ga0207711_10480329 3300025941 Bacteria 1158
320 Ga0207689_10004263 3300025942 Bacteria 13006
321 Ga0207689_10016761 3300025942 Bacteria 6201
322 Ga0207689_10195055 3300025942 Bacteria 1671
323 Ga0207661_10768099 3300025944 Bacteria 887
324 Ga0207667_10148236 3300025949 Bacteria 2415
325 Ga0207651_11340425 3300025960 Bacteria 644
326 Ga0207712_10000017 3300025961 Bacteria 337943
327 Ga0207712_10007739 3300025961 Bacteria 6794
328 Ga0207712_10011917 3300025961 Bacteria 5544
329 Ga0207712_10373341 3300025961 Bacteria 1192
330 Ga0207712_10567905 3300025961 Bacteria 977
331 Ga0207668_10014128 3300025972 Bacteria 4938
332 Ga0207668_10526891 3300025972 Bacteria 1020
333 Ga0207668_10544127 3300025972 Bacteria 1005
334 Ga0207640_10018712 3300025981 Bacteria 4076
335 Ga0207640_10098495 3300025981 Bacteria 2044
336 Ga0207658_10000016 3300025986 Bacteria 215618
337 Ga0207658_10006921 3300025986 Bacteria 7721
338 Ga0207658_10007439 3300025986 Bacteria 7467
339 Ga0207658_10008417 3300025986 Bacteria 7023
340 Ga0207658_10043323 3300025986 Bacteria 3271
341 Ga0207658_10195358 3300025986 Bacteria 1685
342 Ga0207658_10224257 3300025986 Bacteria 1583
343 Ga0207658_11484570 3300025986 Bacteria 620
344 Ga0207677_10007056 3300026023 Bacteria 6180
345 Ga0207677_10353078 3300026023 Bacteria 1233
346 Ga0207703_10024246 3300026035 Bacteria 4773
347 Ga0207703_10621666 3300026035 Bacteria 1023
348 Ga0207703_10647217 3300026035 Bacteria 1002
349 Ga0207703_10930508 3300026035 Bacteria 833
350 Ga0207639_10001887 3300026041 Bacteria 14079
351 Ga0207639_10055494 3300026041 Bacteria 3033
352 Ga0207678_10009319 3300026067 Bacteria 8642
353 Ga0207678_10020820 3300026067 Bacteria 5748
354 Ga0207678_10215278 3300026067 Bacteria 1644
355 Ga0207678_11166162 3300026067 Bacteria 682
356 Ga0207708_10007162 3300026075 Bacteria 8241
357 Ga0207708_10048523 3300026075 Bacteria 3232
358 Ga0207702_10157439 3300026078 Bacteria 2072
359 Ga0207702_11465406 3300026078 Bacteria 676
360 Ga0207641_10000564 3300026088 Bacteria 41406
361 Ga0207641_10025813 3300026088 Bacteria 4845
362 Ga0207641_10119952 3300026088 Bacteria 2345
363 Ga0207648_10001139 3300026089 Bacteria 29879
364 Ga0207648_10073726 3300026089 Bacteria 2975
365 Ga0207676_10251392 3300026095 Bacteria 1591
366 Ga0207676_10735451 3300026095 Bacteria 958
367 Ga0207675_100002167 3300026118 Bacteria 19505
368 Ga0207675_100055143 3300026118 Bacteria 3708
369 Ga0207675_100150702 3300026118 Bacteria 2213
370 Ga0207675_100611845 3300026118 Bacteria 1093
371 Ga0207683_10000390 3300026121 Bacteria 40388
372 Ga0207683_10013704 3300026121 Bacteria 6912
373 Ga0207683_10178802 3300026121 Bacteria 1923
374 Ga0207698_10200485 3300026142 Bacteria 1786
375 Ga0207698_10203897 3300026142 Bacteria 1773
376 Ga0268266_10002615 3300028379 Bacteria 19070
377 Ga0268266_10024447 3300028379 Bacteria 5138
378 Ga0268266_10034149 3300028379 Bacteria 4325
379 Ga0268266_10079438 3300028379 Bacteria 2856
380 Ga0268265_10000068 3300028380 Bacteria 142272
381 Ga0268265_10013845 3300028380 Bacteria 5490
382 Ga0268265_10193723 3300028380 Bacteria 1757
383 Ga0268265_11264862 3300028380 Bacteria 737
384 Ga0268264_10000056 3300028381 Bacteria 310339
385 Ga0268264_10005091 3300028381 Bacteria 11138
386 Ga0268264_10130762 3300028381 Bacteria 2225
387 Ga0265327_10000274 3300031251 Bacteria 101723
388 Ga0265327_10001202 3300031251 Bacteria 34967
389 Ga0265327_10005467 3300031251 Bacteria 10599
390 Ga0265327_10035412 3300031251 Bacteria 2760
391 Ga0316578_10519878 3300031728 Bacteria 700
392 Ga0307405_10449747 3300031731 Bacteria 1021
393 Ga0307413_10356692 3300031824 Bacteria 1130
394 Ga0307406_10007648 3300031901 Bacteria 6001
395 Ga0307406_10181520 3300031901 Bacteria 1532
396 Ga0307412_10483108 3300031911 Bacteria 1028
397 Ga0307409_100216487 3300031995 Bacteria 1726
398 Ga0307409_100231121 3300031995 Bacteria 1677
399 Ga0307409_100614641 3300031995 Bacteria 1076
400 Ga0307416_100224109 3300032002 Bacteria 1806
401 Ga0307414_10427531 3300032004 Bacteria 1156
402 Ga0307415_100365608 3300032126 Bacteria 1220
403 Ga0307415_100397151 3300032126 Bacteria 1176
404 Ga0307415_101690182 3300032126 Bacteria 610
405 Ga0373959_0030807 3300034820 Bacteria 1082
406 Ga0373928_0049697 3300035084 Bacteria 987
407 Ga0373952_0052871 3300035092 Bacteria 973
408 Ga0373932_0253605 3300035112 Bacteria 643
409 Ga0373960_0047701 3300035121 Bacteria 1261
410 Ga0373961_0428037 3300035241 Bacteria 512
411 Ga0373962_0031923 3300035242 Bacteria 1447
412 Ga0373931_0018859 3300035691 Bacteria 3435
413 Ga0373931_0041709 3300035691 Bacteria 2411
414 Ga0373925_0797248 3300037068 Bacteria 779
415 Ga0436365_0491092 3300039437 Bacteria 3714
416 Ga0436360_0807705 3300039438 Bacteria 609
417 Ga0436363_0344372 3300039450 Bacteria 941
418 Ga0436363_1118321 3300039450 Bacteria 1605
419 Ga0439461_0004858 3300041410 Bacteria 2264
420 Ga0439466_0008518 3300041411 Bacteria 3865
421 Ga0439466_0013193 3300041411 Bacteria 3027
422 Ga0439465_0008129 3300041413 Bacteria 3312
423 Ga0439465_0021141 3300041413 Bacteria 2040
424 Ga0439465_0036640 3300041413 Bacteria 1575
425 Ga0451791_0322933 3300041451 Bacteria 737
426 Ga0451845_0373021 3300041501 Bacteria 750
427 Ga0451853_1606720 3300041512 Bacteria 918
428 Ga0439431_0009010 3300041997 Bacteria 2249
429 Ga0439431_0145944 3300041997 Bacteria 670
430 Ga0439442_012361 3300042002 Bacteria 1745
431 Ga0439445_0004470 3300042004 Bacteria 3168
432 Ga0439445_0007743 3300042004 Bacteria 2500
433 Ga0439445_0071677 3300042004 Bacteria 959
434 Ga0439448_0061283 3300042005 Bacteria 1244
435 Ga0439448_0259290 3300042005 Bacteria 614
436 Ga0439434_0003751 3300042435 Bacteria 4437
437 Ga0439434_0004692 3300042435 Bacteria 4006
438 Ga0439435_0055520 3300042436 Bacteria 1143
439 Ga0466972_0003221 3300044658 Bacteria 8102
440 Ga0466972_0005653 3300044658 Bacteria 6273
441 Ga0466972_0018335 3300044658 Bacteria 3498
442 Ga0466972_0338168 3300044658 Bacteria 704
443 Ga0466972_0412227 3300044658 Bacteria 633
444 Ga0466965_0003599 3300044683 Bacteria 6821
445 Ga0466965_0005671 3300044683 Bacteria 5633
446 Ga0466965_0015226 3300044683 Bacteria 3653
447 Ga0466965_0186494 3300044683 Bacteria 1096
448 Ga0466966_0037836 3300044684 Bacteria 3109
449 Ga0466964_0159161 3300044706 Bacteria 1054
450 Ga0466968_0014242 3300044735 Bacteria 3141
451 Ga0466968_0057704 3300044735 Bacteria 1669
452 Ga0466968_0334092 3300044735 Bacteria 734
453 Ga0466968_0426183 3300044735 Bacteria 653
454 Ga0466970_0049274 3300044765 Bacteria 2246
455 Ga0466957_0023015 3300044842 Bacteria 3678
456 Ga0466957_0032970 3300044842 Bacteria 3104
457 Ga0466960_0000267 3300044901 Bacteria 17993
458 Ga0466960_0275016 3300044901 Bacteria 942
459 Ga0466959_0055553 3300045049 Bacteria 2890
460 Ga0466959_0147855 3300045049 Bacteria 1657
461 Ga0466959_0298806 3300045049 Bacteria 1103
462 Ga0466959_0552406 3300045049 Bacteria 776
463 Ga0466958_0003593 3300045836 Bacteria 8077
464 Ga0466958_0395654 3300045836 Bacteria 892
465 Ga0466967_0010373 3300045976 Bacteria 6985
466 Ga0466967_0215833 3300045976 Bacteria 1821
467 Ga0466967_0253824 3300045976 Bacteria 1681
468 Ga0466967_0322821 3300045976 Bacteria 1489
469 Ga0466967_1403779 3300045976 Bacteria 695
470 Ga0495629_0150852 3300046459 Bacteria 1615
471 Ga0495638_0013559 3300046460 Bacteria 5541
472 Ga0495582_0065342 3300046473 Bacteria 2010
473 Ga0495662_0024687 3300046476 Bacteria 2901
474 Ga0495594_0258528 3300046499 Bacteria 992
475 Ga0495606_0127701 3300046507 Bacteria 1515
476 Ga0495620_0165773 3300046515 Bacteria 858
477 Ga0495666_0307105 3300046526 Bacteria 717
478 Ga0495635_0108297 3300046663 Bacteria 1898
479 Ga0495588_0203576 3300046674 Bacteria 1046
480 Ga0495658_0044208 3300046683 Bacteria 2495
481 Ga0495624_0194557 3300046690 Bacteria 1233
482 Ga0495674_0033541 3300047319 Bacteria 4649
483 Ga0495672_0091578 3300047320 Bacteria 1669
484 Ga0495680_0474445 3300047322 Bacteria 853
485 Ga0495686_0004017 3300047472 Bacteria 12306
486 Ga0495686_0063134 3300047472 Bacteria 2296
487 Ga0495686_0552023 3300047472 Bacteria 601
488 Ga0495593_0006639 3300047673 Bacteria 6772
489 Ga0495602_0993084 3300048088 Bacteria 554
490 Ga0496100_0000215 3300048903 Bacteria 31914
491 Ga0496100_0000996 3300048903 Bacteria 13644
492 Ga0496100_0003907 3300048903 Bacteria 7827
493 Ga0496100_0135156 3300048903 Bacteria 1741
494 Ga0496100_0243044 3300048903 Bacteria 1329
495 Ga0496100_0289120 3300048903 Bacteria 1224
496 Ga0496101_0000014 3300048904 Bacteria 253487
497 Ga0496101_0000241 3300048904 Bacteria 40574
498 Ga0496101_0000301 3300048904 Bacteria 34516
499 Ga0496101_0083197 3300048904 Bacteria 2369
500 Ga0496101_0119935 3300048904 Bacteria 1987
501 Ga0496101_0153311 3300048904 Bacteria 1764
502 Ga0496101_0174470 3300048904 Bacteria 1653
503 Ga0496101_0472609 3300048904 Bacteria 990
504 Ga0496102_0000041 3300048905 Bacteria 196634
505 Ga0496102_0001025 3300048905 Bacteria 26029
506 Ga0496102_0001869 3300048905 Bacteria 18138
507 Ga0496102_0005306 3300048905 Bacteria 10941
508 Ga0496102_0116225 3300048905 Bacteria 2496
509 Ga0496102_0148384 3300048905 Bacteria 2202
510 Ga0496102_0985411 3300048905 Bacteria 763
511 Ga0496103_0000058 3300048906 Bacteria 141099
512 Ga0496103_0000353 3300048906 Bacteria 41823
513 Ga0496103_0000899 3300048906 Bacteria 21429
514 Ga0496103_0096884 3300048906 Bacteria 1864
515 Ga0496103_0150052 3300048906 Bacteria 1493
516 Ga0496104_0002069 3300048907 Bacteria 17422
517 Ga0496104_0062002 3300048907 Bacteria 3545
518 Ga0496104_0119436 3300048907 Bacteria 2531
519 Ga0496104_0670149 3300048907 Bacteria 946
520 Ga0496105_0015747 3300048908 Bacteria 6034
521 Ga0496105_0343949 3300048908 Bacteria 1192
522 Ga0496105_0550617 3300048908 Bacteria 900
523 Ga0496105_0551249 3300048908 Bacteria 900
524 Ga0496106_0000410 3300048909 Bacteria 30399
525 Ga0496106_0000638 3300048909 Bacteria 25113
526 Ga0496106_0002922 3300048909 Bacteria 12714
527 Ga0496106_0049351 3300048909 Bacteria 3170
528 Ga0496106_0262949 3300048909 Bacteria 1381
529 Ga0496107_0002690 3300048910 Bacteria 11653
530 Ga0496107_0003452 3300048910 Bacteria 10561
531 Ga0496107_0044323 3300048910 Bacteria 3197
532 Ga0496107_0093378 3300048910 Bacteria 2200
533 Ga0496107_0368414 3300048910 Bacteria 1069
534 Ga0496108_0003498 3300048911 Bacteria 12593
535 Ga0496108_0011902 3300048911 Bacteria 7077
536 Ga0496108_0046145 3300048911 Bacteria 3640
537 Ga0496108_0046465 3300048911 Bacteria 3627
538 Ga0496108_0086797 3300048911 Bacteria 2657
539 Ga0496108_0553365 3300048911 Bacteria 1004
540 Ga0496109_0001155 3300048912 Bacteria 21963
541 Ga0496109_0006803 3300048912 Bacteria 9635
542 Ga0496109_0012267 3300048912 Bacteria 7397
543 Ga0496109_0077386 3300048912 Bacteria 3061
544 Ga0496109_0344927 3300048912 Bacteria 1406
545 Ga0496110_0037366 3300048913 Bacteria 4220
546 Ga0496110_0040244 3300048913 Bacteria 4074
547 Ga0496110_0049588 3300048913 Bacteria 3684
548 Ga0496110_0064258 3300048913 Bacteria 3243
549 Ga0496110_0219436 3300048913 Bacteria 1729
550 Ga0496110_0260541 3300048913 Bacteria 1578
551 Ga0496111_0017661 3300048914 Bacteria 4933
552 Ga0496111_0167198 3300048914 Bacteria 1633
553 Ga0496111_0293190 3300048914 Bacteria 1206
554 Ga0496111_1304764 3300048914 Bacteria 511
555 Ga0496112_0012108 3300048915 Bacteria 7914
556 Ga0496112_0015576 3300048915 Bacteria 7102
557 Ga0496112_0031047 3300048915 Bacteria 5178
558 Ga0496112_0101968 3300048915 Bacteria 2840
559 Ga0496112_0122099 3300048915 Bacteria 2575
560 Ga0496112_0211460 3300048915 Bacteria 1897
561 Ga0496113_0003444 3300048916 Bacteria 9470
562 Ga0496113_0116204 3300048916 Bacteria 2087
563 Ga0496113_0385392 3300048916 Bacteria 1125
564 Ga0496113_0719481 3300048916 Bacteria 796
565 Ga0496114_0000872 3300048917 Bacteria 22557
566 Ga0496114_0011153 3300048917 Bacteria 7174
567 Ga0496114_0206533 3300048917 Bacteria 1722
568 Ga0496114_0379202 3300048917 Bacteria 1252
569 Ga0496115_0013861 3300048918 Bacteria 6105
570 Ga0496115_0028411 3300048918 Bacteria 4383
571 Ga0496115_0601702 3300048918 Bacteria 874
572 Ga0496116_0000098 3300048919 Bacteria 196497
573 Ga0496116_0028095 3300048919 Bacteria 4081
574 Ga0496116_0177601 3300048919 Bacteria 1144
575 Ga0496117_0000096 3300048920 Bacteria 196788
576 Ga0496117_0001778 3300048920 Bacteria 29523
577 Ga0496118_0000073 3300048921 Bacteria 196712
578 Ga0496118_0000461 3300048921 Bacteria 67437
579 Ga0496118_0109156 3300048921 Bacteria 1842
580 Ga0496119_0006522 3300048922 Bacteria 10769
581 Ga0496119_0016940 3300048922 Bacteria 5512
582 Ga0496119_0029200 3300048922 Bacteria 3745
583 Ga0496119_0087595 3300048922 Bacteria 1777
584 Ga0496119_0251052 3300048922 Bacteria 892
585 Ga0496120_0008519 3300048923 Bacteria 7432
586 Ga0496120_0024103 3300048923 Bacteria 3799
587 Ga0496121_0000002 3300048924 Bacteria 1494588
588 Ga0496121_0001389 3300048924 Bacteria 40961
589 Ga0496121_0044241 3300048924 Bacteria 3844
590 Ga0496122_0000396 3300048925 Bacteria 92624
591 Ga0496122_0075033 3300048925 Bacteria 2388
592 Ga0496123_0009119 3300048926 Bacteria 8980
593 Ga0496123_0014212 3300048926 Bacteria 6616
594 Ga0496124_0000002 3300048927 Bacteria 1494588
595 Ga0496124_0398237 3300048927 Bacteria 956
596 Ga0496125_0000002 3300048928 Bacteria 1480920
597 Ga0496125_0114826 3300048928 Bacteria 1938
598 Ga0496125_0186478 3300048928 Bacteria 1375
599 Ga0496125_0233870 3300048928 Bacteria 1173
600 Ga0496126_0000009 3300048929 Bacteria 750350
601 Ga0496126_0000762 3300048929 Bacteria 58311
602 Ga0496126_0003121 3300048929 Bacteria 21370
603 Ga0496126_0020187 3300048929 Bacteria 6539
604 Ga0496126_0068194 3300048929 Bacteria 3176
605 Ga0501032_0004238 3300049569 Bacteria 10843
606 Ga0501034_0002167 3300049571 Bacteria 24348
607 Ga0501034_0387843 3300049571 Bacteria 1321
608 Ga0501034_0680992 3300049571 Bacteria 928
609 Ga0501036_0022237 3300049572 Bacteria 5334
610 Ga0501036_1222246 3300049572 Bacteria 612
611 Ga0501037_0001096 3300049573 Bacteria 20062
612 Ga0501038_0005406 3300049574 Bacteria 11872
613 Ga0501039_0000601 3300049575 Bacteria 26065
614 Ga0501043_0000253 3300049579 Bacteria 48525
615 Ga0501047_0295247 3300049581 Bacteria 1464
616 Ga0501070_0000501 3300049586 Bacteria 35639
617 Ga0501070_0043348 3300049586 Bacteria 3745
618 Ga0501074_0168721 3300049590 Bacteria 1563
619 Ga0501080_0049788 3300049742 Bacteria 3900
620 Ga0501044_0006785 3300049823 Bacteria 12621
621 Ga0501044_0042590 3300049823 Bacteria 4721
622 nmdc:mga03683_126497_c1 3300050489 Bacteria 1140
623 nmdc:mga03683_265771_c1 3300050489 Bacteria 799
624 nmdc:mga03683_55809_c1 3300050489 Bacteria 1659
625 nmdc:mga03n38_142524_c1 3300050490 Bacteria 1198
626 nmdc:mga03n38_196_c1 3300050490 Bacteria 13813
627 nmdc:mga03n38_22359_c1 3300050490 Bacteria 2558
628 nmdc:mga03n38_296639_c1 3300050490 Bacteria 867
629 nmdc:mga03n38_519745_c1 3300050490 Bacteria 670
630 nmdc:mga03n38_558678_c1 3300050490 Bacteria 648
631 nmdc:mga03n38_737192_c1 3300050490 Bacteria 570
632 nmdc:mga00v17_271739_c1 3300050491 Bacteria 1100
633 nmdc:mga00v17_288930_c1 3300050491 Bacteria 1065
634 nmdc:mga00v17_289201_c1 3300050491 Bacteria 1064
635 nmdc:mga00v17_316103_c1 3300050491 Bacteria 1015
636 nmdc:mga00v17_544839_c1 3300050491 Bacteria 750
637 nmdc:mga00v17_6474_c1 3300050491 Bacteria 6215
638 nmdc:mga00v17_884113_c1 3300050491 Bacteria 566
639 nmdc:mga0yw44_116465_c1 3300050492 Bacteria 1717
640 nmdc:mga0yw44_1592_c1 3300050492 Bacteria 9115
641 nmdc:mga0yw44_271837_c1 3300050492 Bacteria 1131
642 nmdc:mga0yw44_301130_c1 3300050492 Bacteria 1074
643 nmdc:mga0yw44_62397_c1 3300050492 Bacteria 2289
644 nmdc:mga06z11_123270_c1 3300050494 Bacteria 1448
645 nmdc:mga06z11_192728_c1 3300050494 Bacteria 1180
646 nmdc:mga06z11_507_c1 3300050494 Bacteria 14374
647 nmdc:mga07m45_199_c1 3300050496 Bacteria 23682
648 nmdc:mga07m45_250700_c1 3300050496 Bacteria 1030
649 nmdc:mga07m45_284752_c1 3300050496 Bacteria 961
650 nmdc:mga07m45_66891_c1 3300050496 Bacteria 2042
651 nmdc:mga07m45_82951_c1 3300050496 Bacteria 1831
652 nmdc:mga0qj67_20191_c1 3300050509 Bacteria 5099
653 nmdc:mga0qj67_455924_c1 3300050509 Bacteria 1030
654 nmdc:mga06r32_310256_c1 3300050510 Bacteria 1563
655 nmdc:mga08y16_1216116_c1 3300050511 Bacteria 723
656 nmdc:mga08y16_645569_c1 3300050511 Bacteria 1063
657 nmdc:mga0sz30_10455_c1 3300050516 Bacteria 3559
658 nmdc:mga0sz30_12569_c1 3300050516 Bacteria 3297
659 nmdc:mga0sz30_13074_c1 3300050516 Bacteria 3243
660 nmdc:mga0sz30_132635_c1 3300050516 Bacteria 1098
661 nmdc:mga0sz30_49609_c1 3300050516 Bacteria 1779
662 nmdc:mga0sz30_85655_c1 3300050516 Bacteria 1367
663 Ga0500635_0243073 3300053080 Bacteria 705
664 Ga0495655_0014928 3300053083 Bacteria 1640
665 Ga0495619_0110171 3300053085 Bacteria 1881
666 Ga0500643_004996 3300053087 Bacteria 5823
667 Ga0500643_011898 3300053087 Bacteria 3144
668 Ga0500581_139023 3300053089 Bacteria 1153
669 Ga0500646_0082324 3300053090 Bacteria 984
670 Ga0500583_0197005 3300053092 Bacteria 1002
671 Ga0500641_0316271 3300053096 Bacteria 636
672 Ga0500569_053637 3300053109 Bacteria 1224
673 Ga0500652_001898 3300053131 Bacteria 6293
674 Ga0500559_0068994 3300053136 Bacteria 1589
675 Ga0500588_0142463 3300053146 Bacteria 862
676 Ga0500616_0033947 3300053153 Bacteria 2782
677 Ga0500620_094062 3300053155 Bacteria 1046
678 Ga0500627_0024084 3300053158 Bacteria 2487
679 Ga0500645_000031 3300053730 Bacteria 119643
680 Ga0500645_020670 3300053730 Bacteria 2038
681 Ga0466962_0032818 3300061719 Bacteria 2484
682 2644487350 2643221687 Bacteria 6500351
683 2644638972 2643221715 Bacteria 6671032
684 2738665779 2738541264 Bacteria 5935393
685 2738702619 2738541274 Bacteria 6909446
686 2739144913 2738541356 Bacteria 5935017
687 2739329529 2738543028 Bacteria 6917070
688 2842135168 2842134933 Bacteria 5847019
689 2902794421 2902792274 Bacteria 7270173
690 2902803234 2902799365 Bacteria 5419524
691 2902839453 2902837492 Bacteria 6697721
692 2929213163 2929212328 Bacteria 7708288
693 2939587114 2939582691 Bacteria 7088898
694 Ga0055528_1079394
695 JGI24737J22298_10021133
696 JGI24735J21928_10135182
697 JGI24745J21846_1001095
698 JGI24744J21845_10000037
699 JGI24744J21845_10006862
700 JGI24034J26672_10001279
701 JGI24742J22300_10002482
702 Ga0055540_1001186
703 Ga0055540_1006526
704 Ga0070676_10009420
705 Ga0070676_10054920
706 Ga0070690_100005907
707 Ga0070690_100247005
708 Ga0070690_101298397
709 Ga0070670_100107730
710 Ga0068869_100003467
711 Ga0068869_100004965
712 Ga0070666_10026050
713 Ga0070666_10083344
714 Ga0070680_100402913
715 Ga0070682_100018857
716 Ga0070682_100157152
717 Ga0068868_100000860
718 Ga0068868_101046977
719 Ga0070660_100116544
720 Ga0070660_100427745
721 Ga0070689_100018489
722 Ga0070691_10008023
723 Ga0070691_10080652
724 Ga0070692_10247947
725 Ga0070668_100004256
726 Ga0070668_100182372
727 Ga0070668_100288836
728 Ga0070668_100752972
729 Ga0070668_101253486
730 Ga0070669_100007192
731 Ga0070669_100057885
732 Ga0070669_100101750
733 Ga0070671_100003316
734 Ga0070671_100034474
735 Ga0070674_100000505
736 Ga0070674_100369516
737 Ga0070688_100045466
738 Ga0070659_100019578
739 Ga0070659_100834858
740 Ga0070667_100000029
741 Ga0070667_100002270
742 Ga0070667_100009046
743 Ga0070667_100057127
744 Ga0070667_100348799
745 Ga0070667_100466021
746 Ga0070667_100991740
747 Ga0070703_10078028
748 Ga0070709_10048834
749 Ga0070709_10841066
750 Ga0070714_100920711
751 Ga0070710_10009509
752 Ga0070710_10035471
753 Ga0070701_10001625
754 Ga0070711_100001681
755 Ga0070711_100107291
756 Ga0070705_100050941
757 Ga0070705_100083363
758 Ga0070700_100001238
759 Ga0070700_100132558
760 Ga0070694_100026304
761 Ga0070694_100543114
762 Ga0070663_100064435
763 Ga0070663_100093517
764 Ga0070663_100157399
765 Ga0070678_100002692
766 Ga0070678_100146213
767 Ga0070662_100002292
768 Ga0070662_100164319
769 Ga0068867_100004656
770 Ga0068867_100045222
771 Ga0070685_10090408
772 Ga0070685_10675758
773 Ga0070679_100754248
774 Ga0068853_100015503
775 Ga0068853_100020712
776 Ga0070672_100211299
777 Ga0070686_100094354
778 Ga0070686_100171404
779 Ga0070695_100013059
780 Ga0070696_100013764
781 Ga0070696_100029192
782 Ga0070693_100008073
783 Ga0070665_100005028
784 Ga0070665_100007037
785 Ga0070665_100018659
786 Ga0070665_100100360
787 Ga0070665_100566856
788 Ga0070704_100001365
789 Ga0070704_100372235
790 Ga0068854_100002626
791 Ga0068854_100040105
792 Ga0070702_100001171
793 Ga0070702_100005931
794 Ga0070702_100398628
795 Ga0068852_100044942
796 Ga0068852_100097350
797 Ga0068852_100726719
798 Ga0068859_100001467
799 Ga0068859_100012822
800 Ga0068859_100034892
801 Ga0068864_100689814
802 Ga0068864_100872756
803 Ga0068866_10000577
804 Ga0068861_100005512
805 Ga0068861_100015271
806 Ga0068861_100092358
807 Ga0068851_10200159
808 Ga0068870_10027221
809 Ga0068870_10141529
810 Ga0068863_100000465
811 Ga0068863_100005922
812 Ga0068863_100070873
813 Ga0068863_100305723
814 Ga0068858_100002228
815 Ga0068858_100010235
816 Ga0068858_100121606
817 Ga0068860_100000088
818 Ga0068860_100007392
819 Ga0068860_100098828
820 Ga0068860_100175223
821 Ga0068862_100000056
822 Ga0068862_100189112
823 Ga0068862_101201620
824 Ga0081455_10032467
825 Ga0075365_10016337
826 Ga0075365_10039711
827 Ga0075365_10088273
828 Ga0075365_10316941
829 Ga0075365_11042783
830 Ga0075363_100000041
831 Ga0075363_100001192
832 Ga0075363_100028834
833 Ga0075363_100179787
834 Ga0075363_100183235
835 Ga0075363_100448394
836 Ga0075363_100620471
837 Ga0075364_10006335
838 Ga0075364_10006684
839 Ga0075364_10202686
840 Ga0075364_10324806
841 Ga0075364_10328366
842 Ga0070715_10019647
843 Ga0070716_100021232
844 Ga0070716_100098519
845 Ga0070712_100003928
846 Ga0070712_100066855
847 Ga0075362_10032915
848 Ga0075367_10003749
849 Ga0075367_10060164
850 Ga0075367_10341499
851 Ga0075369_10000691
852 Ga0075369_10005328
853 Ga0075369_10009962
854 Ga0075369_10018504
855 Ga0075369_10019888
856 Ga0075369_10039950
857 Ga0075369_10054044
858 Ga0075369_10115689
859 Ga0075369_10142616
860 Ga0075369_10280616
861 Ga0075369_10336988
862 Ga0097621_100267017
863 Ga0075370_10000413
864 Ga0075370_10013246
865 Ga0075370_10030284
866 Ga0075370_10088049
867 Ga0068871_100079847
868 Ga0068871_100307379
869 Ga0068871_100805279
870 Ga0075428_100004705
871 Ga0075430_100025015
872 Ga0075430_100204488
873 Ga0075434_101243498
874 Ga0068865_100000595
875 Ga0068865_100197344
876 Ga0097620_100001467
877 Ga0097620_100012822
878 Ga0097620_100034891
879 Ga0105250_10026527
880 Ga0105250_10252954
881 Ga0111539_10654480
882 Ga0105245_10000753
883 Ga0105245_10039100
884 Ga0105247_10000008
885 Ga0105247_10001050
886 Ga0105247_10031446
887 Ga0105247_10499535
888 Ga0114129_10022080
889 Ga0114129_11279014
890 Ga0105243_10002393
891 Ga0105243_10040206
892 Ga0105241_10028611
893 Ga0105241_10101922
894 Ga0105241_10651572
895 Ga0105242_10000885
896 Ga0105242_10034076
897 Ga0105248_10000051
898 Ga0105248_10019104
899 Ga0105248_10126836
900 Ga0105248_10691466
901 Ga0105237_10028180
902 Ga0105237_10076311
903 Ga0105237_10078540
904 Ga0105237_10217087
905 Ga0105249_10000040
906 Ga0105249_10001945
907 Ga0105249_10005906
908 Ga0105249_10114591
909 Ga0105249_10595193
910 Ga0105249_10669519
911 Ga0099796_10020708
912 Ga0105239_10003126
913 Ga0105239_10082418
914 Ga0105239_10276826
915 Ga0105239_10463870
916 Ga0105239_11097808
917 Ga0105246_10073046
918 Ga0105246_10634154
919 Ga0157373_10352748
920 Ga0157369_10330599
921 Ga0157374_10019678
922 Ga0157378_10001354
923 Ga0163162_10003848
924 Ga0163162_10088345
925 Ga0163162_11075547
926 Ga0163162_11606457
927 Ga0157372_10295551
928 Ga0157372_11052208
929 Ga0157372_11052497
930 Ga0157375_10000340
931 Ga0157375_10601951
932 Ga0157375_11291822
933 Ga0157375_11725963
934 Ga0157375_12772425
935 Ga0163163_10028880
936 Ga0163163_10112211
937 Ga0157380_10000251
938 Ga0157377_10197058
939 Ga0157379_10032909
940 Ga0157376_10010466
941 Ga0157376_10067190
942 Ga0163161_10000280
943 Ga0163161_10209733
944 Ga0163161_10299604
945 Ga0163161_10684609
946 Ga0209673_1005991
947 Ga0209051_1000034
948 Ga0209051_1001623
949 Ga0209051_1002089
950 Ga0209051_1045990
951 Ga0207656_10059873
952 Ga0207653_10190573
953 Ga0207692_10014904
954 Ga0207692_10121802
955 Ga0207642_10000287
956 Ga0207642_10034771
957 Ga0207710_10000006
958 Ga0207710_10036531
959 Ga0207688_10000674
960 Ga0207688_10005931
961 Ga0207680_10129545
962 Ga0207647_10020151
963 Ga0207685_10006324
964 Ga0207685_10084438
965 Ga0207699_10037161
966 Ga0207699_10388163
967 Ga0207645_10012924
968 Ga0207645_10114261
969 Ga0207643_10068078
970 Ga0207654_10192327
971 Ga0207654_10346551
972 Ga0207671_10016880
973 Ga0207671_10024451
974 Ga0207671_10253826
975 Ga0207693_10000806
976 Ga0207693_10002376
977 Ga0207663_10008324
978 Ga0207663_10016603
979 Ga0207663_10477346
980 Ga0207662_10021547
981 Ga0207662_10502715
982 Ga0207657_10170089
983 Ga0207649_10309332
984 Ga0207681_10076401
985 Ga0207681_10543378
986 Ga0207694_10198020
987 Ga0207659_10095672
988 Ga0207659_10390081
989 Ga0207687_10001886
990 Ga0207687_10297641
991 Ga0207687_10326064
992 Ga0207664_10092068
993 Ga0207664_10655506
994 Ga0207644_10041545
995 Ga0207690_10215229
996 Ga0207690_10224861
997 Ga0207706_10004709
998 Ga0207706_10010411
999 Ga0207686_10028610
1000 Ga0207686_10386795
1001 Ga0207709_10018749
1002 Ga0207709_10591354
1003 Ga0207669_10000861
1004 Ga0207704_10000826
1005 Ga0207665_10001991
1006 Ga0207665_10032109
1007 Ga0207691_10015404
1008 Ga0207691_10283938
1009 Ga0207711_10000811
1010 Ga0207711_10065442
1011 Ga0207711_10275276
1012 Ga0207711_10480329
1013 Ga0207689_10004263
1014 Ga0207689_10016761
1015 Ga0207689_10195055
1016 Ga0207661_10768099
1017 Ga0207667_10148236
1018 Ga0207651_11340425
1019 Ga0207712_10000017
1020 Ga0207712_10007739
1021 Ga0207712_10011917
1022 Ga0207712_10373341
1023 Ga0207712_10567905
1024 Ga0207668_10014128
1025 Ga0207668_10526891
1026 Ga0207668_10544127
1027 Ga0207640_10018712
1028 Ga0207640_10098495
1029 Ga0207658_10000016
1030 Ga0207658_10006921
1031 Ga0207658_10007439
1032 Ga0207658_10008417
1033 Ga0207658_10043323
1034 Ga0207658_10195358
1035 Ga0207658_10224257
1036 Ga0207658_11484570
1037 Ga0207677_10007056
1038 Ga0207677_10353078
1039 Ga0207703_10024246
1040 Ga0207703_10621666
1041 Ga0207703_10647217
1042 Ga0207703_10930508
1043 Ga0207639_10001887
1044 Ga0207639_10055494
1045 Ga0207678_10009319
1046 Ga0207678_10020820
1047 Ga0207678_10215278
1048 Ga0207678_11166162
1049 Ga0207708_10007162
1050 Ga0207708_10048523
1051 Ga0207702_10157439
1052 Ga0207702_11465406
1053 Ga0207641_10000564
1054 Ga0207641_10025813
1055 Ga0207641_10119952
1056 Ga0207648_10001139
1057 Ga0207648_10073726
1058 Ga0207676_10251392
1059 Ga0207676_10735451
1060 Ga0207675_100002167
1061 Ga0207675_100055143
1062 Ga0207675_100150702
1063 Ga0207675_100611845
1064 Ga0207683_10000390
1065 Ga0207683_10013704
1066 Ga0207683_10178802
1067 Ga0207698_10200485
1068 Ga0207698_10203897
1069 Ga0268266_10002615
1070 Ga0268266_10024447
1071 Ga0268266_10034149
1072 Ga0268266_10079438
1073 Ga0268265_10000068
1074 Ga0268265_10013845
1075 Ga0268265_10193723
1076 Ga0268265_11264862
1077 Ga0268264_10000056
1078 Ga0268264_10005091
1079 Ga0268264_10130762
1080 Ga0265327_10000274
1081 Ga0265327_10001202
1082 Ga0265327_10005467
1083 Ga0265327_10035412
1084 Ga0316578_10519878
1085 Ga0307405_10449747
1086 Ga0307413_10356692
1087 Ga0307406_10007648
1088 Ga0307406_10181520
1089 Ga0307412_10483108
1090 Ga0307409_100216487
1091 Ga0307409_100231121
1092 Ga0307409_100614641
1093 Ga0307416_100224109
1094 Ga0307414_10427531
1095 Ga0307415_100365608
1096 Ga0307415_100397151
1097 Ga0307415_101690182
1098 Ga0373959_0030807
1099 Ga0373928_0049697
1100 Ga0373952_0052871
1101 Ga0373932_0253605
1102 Ga0373960_0047701
1103 Ga0373961_0428037
1104 Ga0373962_0031923
1105 Ga0373931_0018859
1106 Ga0373931_0041709
1107 Ga0373925_0797248
1108 Ga0436365_0491092
1109 Ga0436360_0807705
1110 Ga0436363_0344372
1111 Ga0436363_1118321
1112 Ga0439461_0004858
1113 Ga0439466_0008518
1114 Ga0439466_0013193
1115 Ga0439465_0008129
1116 Ga0439465_0021141
1117 Ga0439465_0036640
1118 Ga0451791_0322933
1119 Ga0451845_0373021
1120 Ga0451853_1606720
1121 Ga0439431_0009010
1122 Ga0439431_0145944
1123 Ga0439442_012361
1124 Ga0439445_0004470
1125 Ga0439445_0007743
1126 Ga0439445_0071677
1127 Ga0439448_0061283
1128 Ga0439448_0259290
1129 Ga0439434_0003751
1130 Ga0439434_0004692
1131 Ga0439435_0055520
1132 Ga0466972_0003221
1133 Ga0466972_0005653
1134 Ga0466972_0018335
1135 Ga0466972_0338168
1136 Ga0466972_0412227
1137 Ga0466965_0003599
1138 Ga0466965_0005671
1139 Ga0466965_0015226
1140 Ga0466965_0186494
1141 Ga0466966_0037836
1142 Ga0466964_0159161
1143 Ga0466968_0014242
1144 Ga0466968_0057704
1145 Ga0466968_0334092
1146 Ga0466968_0426183
1147 Ga0466970_0049274
1148 Ga0466957_0023015
1149 Ga0466957_0032970
1150 Ga0466960_0000267
1151 Ga0466960_0275016
1152 Ga0466959_0055553
1153 Ga0466959_0147855
1154 Ga0466959_0298806
1155 Ga0466959_0552406
1156 Ga0466958_0003593
1157 Ga0466958_0395654
1158 Ga0466967_0010373
1159 Ga0466967_0215833
1160 Ga0466967_0253824
1161 Ga0466967_0322821
1162 Ga0466967_1403779
1163 Ga0495629_0150852
1164 Ga0495638_0013559
1165 Ga0495582_0065342
1166 Ga0495662_0024687
1167 Ga0495594_0258528
1168 Ga0495606_0127701
1169 Ga0495620_0165773
1170 Ga0495666_0307105
1171 Ga0495635_0108297
1172 Ga0495588_0203576
1173 Ga0495658_0044208
1174 Ga0495624_0194557
1175 Ga0495674_0033541
1176 Ga0495672_0091578
1177 Ga0495680_0474445
1178 Ga0495686_0004017
1179 Ga0495686_0063134
1180 Ga0495686_0552023
1181 Ga0495593_0006639
1182 Ga0495602_0993084
1183 Ga0496100_0000215
1184 Ga0496100_0000996
1185 Ga0496100_0003907
1186 Ga0496100_0135156
1187 Ga0496100_0243044
1188 Ga0496100_0289120
1189 Ga0496101_0000014
1190 Ga0496101_0000241
1191 Ga0496101_0000301
1192 Ga0496101_0083197
1193 Ga0496101_0119935
1194 Ga0496101_0153311
1195 Ga0496101_0174470
1196 Ga0496101_0472609
1197 Ga0496102_0000041
1198 Ga0496102_0001025
1199 Ga0496102_0001869
1200 Ga0496102_0005306
1201 Ga0496102_0116225
1202 Ga0496102_0148384
1203 Ga0496102_0985411
1204 Ga0496103_0000058
1205 Ga0496103_0000353
1206 Ga0496103_0000899
1207 Ga0496103_0096884
1208 Ga0496103_0150052
1209 Ga0496104_0002069
1210 Ga0496104_0062002
1211 Ga0496104_0119436
1212 Ga0496104_0670149
1213 Ga0496105_0015747
1214 Ga0496105_0343949
1215 Ga0496105_0550617
1216 Ga0496105_0551249
1217 Ga0496106_0000410
1218 Ga0496106_0000638
1219 Ga0496106_0002922
1220 Ga0496106_0049351
1221 Ga0496106_0262949
1222 Ga0496107_0002690
1223 Ga0496107_0003452
1224 Ga0496107_0044323
1225 Ga0496107_0093378
1226 Ga0496107_0368414
1227 Ga0496108_0003498
1228 Ga0496108_0011902
1229 Ga0496108_0046145
1230 Ga0496108_0046465
1231 Ga0496108_0086797
1232 Ga0496108_0553365
1233 Ga0496109_0001155
1234 Ga0496109_0006803
1235 Ga0496109_0012267
1236 Ga0496109_0077386
1237 Ga0496109_0344927
1238 Ga0496110_0037366
1239 Ga0496110_0040244
1240 Ga0496110_0049588
1241 Ga0496110_0064258
1242 Ga0496110_0219436
1243 Ga0496110_0260541
1244 Ga0496111_0017661
1245 Ga0496111_0167198
1246 Ga0496111_0293190
1247 Ga0496111_1304764
1248 Ga0496112_0012108
1249 Ga0496112_0015576
1250 Ga0496112_0031047
1251 Ga0496112_0101968
1252 Ga0496112_0122099
1253 Ga0496112_0211460
1254 Ga0496113_0003444
1255 Ga0496113_0116204
1256 Ga0496113_0385392
1257 Ga0496113_0719481
1258 Ga0496114_0000872
1259 Ga0496114_0011153
1260 Ga0496114_0206533
1261 Ga0496114_0379202
1262 Ga0496115_0013861
1263 Ga0496115_0028411
1264 Ga0496115_0601702
1265 Ga0496116_0000098
1266 Ga0496116_0028095
1267 Ga0496116_0177601
1268 Ga0496117_0000096
1269 Ga0496117_0001778
1270 Ga0496118_0000073
1271 Ga0496118_0000461
1272 Ga0496118_0109156
1273 Ga0496119_0006522
1274 Ga0496119_0016940
1275 Ga0496119_0029200
1276 Ga0496119_0087595
1277 Ga0496119_0251052
1278 Ga0496120_0008519
1279 Ga0496120_0024103
1280 Ga0496121_0000002
1281 Ga0496121_0001389
1282 Ga0496121_0044241
1283 Ga0496122_0000396
1284 Ga0496122_0075033
1285 Ga0496123_0009119
1286 Ga0496123_0014212
1287 Ga0496124_0000002
1288 Ga0496124_0398237
1289 Ga0496125_0000002
1290 Ga0496125_0114826
1291 Ga0496125_0186478
1292 Ga0496125_0233870
1293 Ga0496126_0000009
1294 Ga0496126_0000762
1295 Ga0496126_0003121
1296 Ga0496126_0020187
1297 Ga0496126_0068194
1298 Ga0501032_0004238
1299 Ga0501034_0002167
1300 Ga0501034_0387843
1301 Ga0501034_0680992
1302 Ga0501036_0022237
1303 Ga0501036_1222246
1304 Ga0501037_0001096
1305 Ga0501038_0005406
1306 Ga0501039_0000601
1307 Ga0501043_0000253
1308 Ga0501047_0295247
1309 Ga0501070_0000501
1310 Ga0501070_0043348
1311 Ga0501074_0168721
1312 Ga0501080_0049788
1313 Ga0501044_0006785
1314 Ga0501044_0042590
1315 nmdc:mga03683_126497_c1
1316 nmdc:mga03683_265771_c1
1317 nmdc:mga03683_55809_c1
1318 nmdc:mga03n38_142524_c1
1319 nmdc:mga03n38_196_c1
1320 nmdc:mga03n38_22359_c1
1321 nmdc:mga03n38_296639_c1
1322 nmdc:mga03n38_519745_c1
1323 nmdc:mga03n38_558678_c1
1324 nmdc:mga03n38_737192_c1
1325 nmdc:mga00v17_271739_c1
1326 nmdc:mga00v17_288930_c1
1327 nmdc:mga00v17_289201_c1
1328 nmdc:mga00v17_316103_c1
1329 nmdc:mga00v17_544839_c1
1330 nmdc:mga00v17_6474_c1
1331 nmdc:mga00v17_884113_c1
1332 nmdc:mga0yw44_116465_c1
1333 nmdc:mga0yw44_1592_c1
1334 nmdc:mga0yw44_271837_c1
1335 nmdc:mga0yw44_301130_c1
1336 nmdc:mga0yw44_62397_c1
1337 nmdc:mga06z11_123270_c1
1338 nmdc:mga06z11_192728_c1
1339 nmdc:mga06z11_507_c1
1340 nmdc:mga07m45_199_c1
1341 nmdc:mga07m45_250700_c1
1342 nmdc:mga07m45_284752_c1
1343 nmdc:mga07m45_66891_c1
1344 nmdc:mga07m45_82951_c1
1345 nmdc:mga0qj67_20191_c1
1346 nmdc:mga0qj67_455924_c1
1347 nmdc:mga06r32_310256_c1
1348 nmdc:mga08y16_1216116_c1
1349 nmdc:mga08y16_645569_c1
1350 nmdc:mga0sz30_10455_c1
1351 nmdc:mga0sz30_12569_c1
1352 nmdc:mga0sz30_13074_c1
1353 nmdc:mga0sz30_132635_c1
1354 nmdc:mga0sz30_49609_c1
1355 nmdc:mga0sz30_85655_c1
1356 Ga0500635_0243073
1357 Ga0495655_0014928
1358 Ga0495619_0110171
1359 Ga0500643_004996
1360 Ga0500643_011898
1361 Ga0500581_139023
1362 Ga0500646_0082324
1363 Ga0500583_0197005
1364 Ga0500641_0316271
1365 Ga0500569_053637
1366 Ga0500652_001898
1367 Ga0500559_0068994
1368 Ga0500588_0142463
1369 Ga0500616_0033947
1370 Ga0500620_094062
1371 Ga0500627_0024084
1372 Ga0500645_000031
1373 Ga0500645_020670
1374 Ga0466962_0032818
1375 2644487350
1376 2644638972
1377 2738665779
1378 2738702619
1379 2739144913
1380 2739329529
1381 2842135168
1382 2902794421
1383 2902803234
1384 2902839453
1385 2929213163
1386 2939587114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

9

113

0.97

Map