F475476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 348 | 1380 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0003149|Ga0495592_0003149_4876_5655 |
| Length | 259 |
| Sequence | VLFCLPGQNSGITATAHSRDPLIRPAFEPETLPVEATGAHLPPVHAERLTPDGLRRRFKQHLCWTPEPIVETPWRNTQGDPRVASVLVPLVIRANGLTVLLTQRADHLNDHAGQVSFPGGRQEPFDADATATALREAQEEVGLAPSRVEVLGALPDYLTGTGFRVTPVIGLVHPPFALKADALEVAEVFEVPLAFLMNPAHHEERVFRYEGGERRFFAMPYPRGASLEAAERDDGTGSHYFIWGATAAMLRNFYRFLTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 112 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 113 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 222 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 223 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 224 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 262 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 263 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 264 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 269 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 270 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 271 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 272 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 273 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 274 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 275 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 276 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 277 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 278 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 279 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 280 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 281 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 282 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 283 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 284 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 285 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 286 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 287 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 288 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 289 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 290 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 291 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 292 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 293 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 294 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 295 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 296 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 297 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 298 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 299 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 300 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 301 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 302 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 303 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 304 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 305 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 306 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 307 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 308 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 309 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 310 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 311 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 312 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 313 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 314 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 315 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 316 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 317 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 318 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 319 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 320 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 321 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 322 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 323 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 324 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 325 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 326 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 327 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 328 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 329 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 330 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 331 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 332 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 333 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 334 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 335 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 336 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 337 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 338 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 339 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 340 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 341 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 342 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 343 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 344 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 345 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 346 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 347 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 348 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.26 |
| Metatranscriptomes | 0.14 |
| Isolates | 11.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.84 |
| Nodule | 2.75 |
| Rhizoplane | 5.65 |
| Rhizosphere | 70.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495592_0003149 | 3300046454 | Bacteria | 11804 |
| 2 | JGI24740J21852_10000321 | 3300001979 | Bacteria | 20355 |
| 3 | JGI24739J22299_10005570 | 3300001989 | Bacteria | 4775 |
| 4 | JGI24739J22299_10007598 | 3300001989 | Bacteria | 4061 |
| 5 | JGI24739J22299_10024097 | 3300001989 | Bacteria | 2148 |
| 6 | JGI24739J22299_10028840 | 3300001989 | Bacteria | 1933 |
| 7 | JGI24737J22298_10022298 | 3300001990 | Bacteria | 2013 |
| 8 | JGI24735J21928_10000211 | 3300002067 | Bacteria | 20387 |
| 9 | JGI24735J21928_10001050 | 3300002067 | Bacteria | 9898 |
| 10 | JGI24735J21928_10005467 | 3300002067 | Bacteria | 4213 |
| 11 | JGI24738J21930_10001905 | 3300002075 | Bacteria | 5634 |
| 12 | JGI25156J39149_1001121 | 3300002705 | Bacteria | 12125 |
| 13 | JGI25156J39149_1010495 | 3300002705 | Bacteria | 2173 |
| 14 | JGI25154J39366_1000558 | 3300002738 | Bacteria | 18325 |
| 15 | JGI25165J46597_1002871 | 3300003214 | Bacteria | 4913 |
| 16 | rootL2_10033819 | 3300003322 | Bacteria | 11237 |
| 17 | rootH1_10169913 | 3300003323 | Bacteria | 1354 |
| 18 | JGI25160J50197_1000818 | 3300003354 | Bacteria | 16694 |
| 19 | Ga0055533_1000618 | 3300003756 | Bacteria | 11994 |
| 20 | Ga0055533_1009008 | 3300003756 | Bacteria | 1216 |
| 21 | Ga0055532_1000039 | 3300003758 | Bacteria | 198049 |
| 22 | Ga0055532_1002103 | 3300003758 | Bacteria | 4520 |
| 23 | Ga0055532_1002180 | 3300003758 | Bacteria | 4339 |
| 24 | Ga0055527_1000024 | 3300003760 | Bacteria | 198049 |
| 25 | Ga0055527_1000493 | 3300003760 | Bacteria | 14159 |
| 26 | Ga0055527_1000532 | 3300003760 | Bacteria | 12837 |
| 27 | Ga0055535_1000028 | 3300003761 | Bacteria | 198049 |
| 28 | Ga0055535_1001248 | 3300003761 | Bacteria | 14159 |
| 29 | Ga0055535_1001362 | 3300003761 | Bacteria | 12837 |
| 30 | Ga0055542_1000047 | 3300003762 | Bacteria | 198049 |
| 31 | Ga0055542_1001239 | 3300003762 | Bacteria | 14176 |
| 32 | Ga0055542_1004506 | 3300003762 | Bacteria | 3363 |
| 33 | Ga0055529_1000054 | 3300003763 | Bacteria | 198049 |
| 34 | Ga0055529_1000492 | 3300003763 | Bacteria | 36023 |
| 35 | Ga0055526_1000709 | 3300003771 | Bacteria | 25255 |
| 36 | Ga0055528_1001475 | 3300003790 | Bacteria | 14296 |
| 37 | Ga0065165_1002547 | 3300005262 | Bacteria | 15111 |
| 38 | Ga0070658_10001863 | 3300005327 | Bacteria | 17769 |
| 39 | Ga0070658_10004277 | 3300005327 | Bacteria | 11668 |
| 40 | Ga0070666_10279696 | 3300005335 | Bacteria | 1186 |
| 41 | Ga0070660_100000016 | 3300005339 | Bacteria | 102648 |
| 42 | Ga0070661_100102233 | 3300005344 | Bacteria | 2133 |
| 43 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 44 | Ga0070659_100138694 | 3300005366 | Bacteria | 1979 |
| 45 | Ga0070663_100002147 | 3300005455 | Bacteria | 11030 |
| 46 | Ga0070663_100347671 | 3300005455 | Bacteria | 1200 |
| 47 | Ga0070684_100379518 | 3300005535 | Bacteria | 1302 |
| 48 | Ga0070665_100016567 | 3300005548 | Bacteria | 7389 |
| 49 | Ga0068855_100002126 | 3300005563 | Bacteria | 24515 |
| 50 | Ga0068855_100011135 | 3300005563 | Bacteria | 10858 |
| 51 | Ga0068855_100155534 | 3300005563 | Bacteria | 2598 |
| 52 | Ga0068855_100183129 | 3300005563 | Bacteria | 2367 |
| 53 | Ga0068856_101238293 | 3300005614 | Bacteria | 762 |
| 54 | Ga0068858_100043018 | 3300005842 | Bacteria | 4189 |
| 55 | Ga0075363_100083055 | 3300006048 | Bacteria | 1755 |
| 56 | Ga0075362_10005404 | 3300006177 | Bacteria | 4672 |
| 57 | Ga0079104_1025720 | 3300006946 | Bacteria | 1532 |
| 58 | Ga0105251_10001940 | 3300009011 | Bacteria | 16937 |
| 59 | Ga0105251_10098430 | 3300009011 | Bacteria | 1338 |
| 60 | Ga0105251_10117292 | 3300009011 | Bacteria | 1210 |
| 61 | Ga0105244_10001408 | 3300009036 | Bacteria | 19468 |
| 62 | Ga0105240_10005681 | 3300009093 | Bacteria | 18515 |
| 63 | Ga0105240_10024403 | 3300009093 | Bacteria | 7969 |
| 64 | Ga0105240_10031037 | 3300009093 | Bacteria | 6935 |
| 65 | Ga0105240_10036958 | 3300009093 | Bacteria | 6277 |
| 66 | Ga0105240_10038727 | 3300009093 | Bacteria | 6113 |
| 67 | Ga0105240_10091007 | 3300009093 | Bacteria | 3728 |
| 68 | Ga0105240_10103481 | 3300009093 | Bacteria | 3459 |
| 69 | Ga0105240_10487230 | 3300009093 | Bacteria | 1373 |
| 70 | Ga0105247_10050555 | 3300009101 | Bacteria | 2558 |
| 71 | Ga0105241_10091472 | 3300009174 | Bacteria | 2400 |
| 72 | Ga0105248_10451790 | 3300009177 | Bacteria | 1448 |
| 73 | Ga0105237_10064356 | 3300009545 | Bacteria | 3663 |
| 74 | Ga0105237_10867525 | 3300009545 | Bacteria | 909 |
| 75 | Ga0105238_10004083 | 3300009551 | Bacteria | 14482 |
| 76 | Ga0105238_10105936 | 3300009551 | Bacteria | 2793 |
| 77 | Ga0105238_11091045 | 3300009551 | Bacteria | 821 |
| 78 | Ga0105239_10006046 | 3300010375 | Bacteria | 14090 |
| 79 | Ga0105239_10167743 | 3300010375 | Bacteria | 2455 |
| 80 | Ga0105239_10327341 | 3300010375 | Bacteria | 1728 |
| 81 | Ga0157373_10090002 | 3300013100 | Bacteria | 2161 |
| 82 | Ga0157371_10004966 | 3300013102 | Bacteria | 11423 |
| 83 | Ga0157370_10071414 | 3300013104 | Bacteria | 3275 |
| 84 | Ga0157370_10330826 | 3300013104 | Bacteria | 1405 |
| 85 | Ga0157370_10798941 | 3300013104 | Bacteria | 859 |
| 86 | Ga0157369_10000820 | 3300013105 | Bacteria | 39707 |
| 87 | Ga0157369_10001117 | 3300013105 | Bacteria | 33543 |
| 88 | Ga0157369_10058799 | 3300013105 | Bacteria | 4146 |
| 89 | Ga0157369_10149955 | 3300013105 | Bacteria | 2464 |
| 90 | Ga0157369_10531280 | 3300013105 | Bacteria | 1216 |
| 91 | Ga0157374_10060594 | 3300013296 | Bacteria | 3542 |
| 92 | Ga0157374_10482756 | 3300013296 | Bacteria | 1242 |
| 93 | Ga0157372_10665335 | 3300013307 | Bacteria | 1212 |
| 94 | Ga0163163_10208473 | 3300014325 | Bacteria | 2003 |
| 95 | Ga0182008_10153551 | 3300014497 | Bacteria | 1156 |
| 96 | Ga0157376_10738959 | 3300014969 | Bacteria | 992 |
| 97 | Ga0182006_1000211 | 3300015261 | Bacteria | 57444 |
| 98 | Ga0182006_1005017 | 3300015261 | Bacteria | 6372 |
| 99 | Ga0182006_1012863 | 3300015261 | Bacteria | 3651 |
| 100 | Ga0182007_10002694 | 3300015262 | Bacteria | 8686 |
| 101 | Ga0182007_10049519 | 3300015262 | Bacteria | 1388 |
| 102 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 103 | Ga0182005_1007213 | 3300015265 | Bacteria | 3346 |
| 104 | Ga0224712_10000963 | 3300022467 | Bacteria | 6241 |
| 105 | Ga0209566_100680 | 3300025225 | Bacteria | 20034 |
| 106 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 107 | Ga0209674_100508 | 3300025226 | Bacteria | 16000 |
| 108 | Ga0209674_104330 | 3300025226 | Bacteria | 2333 |
| 109 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 110 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 111 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 112 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 113 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 114 | Ga0209147_100192 | 3300025229 | Bacteria | 70162 |
| 115 | Ga0209147_100308 | 3300025229 | Bacteria | 38671 |
| 116 | Ga0209563_100478 | 3300025230 | Bacteria | 13598 |
| 117 | Ga0207427_100524 | 3300025231 | Bacteria | 19948 |
| 118 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 119 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 120 | Ga0209258_100358 | 3300025242 | Bacteria | 61852 |
| 121 | Ga0207425_1000766 | 3300025245 | Bacteria | 16595 |
| 122 | Ga0209646_1000036 | 3300025246 | Bacteria | 358864 |
| 123 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 124 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 125 | Ga0209148_1000400 | 3300025254 | Bacteria | 50569 |
| 126 | Ga0209148_1001772 | 3300025254 | Bacteria | 9278 |
| 127 | Ga0209759_1000147 | 3300025256 | Bacteria | 121320 |
| 128 | Ga0209759_1000160 | 3300025256 | Bacteria | 116290 |
| 129 | Ga0209759_1000617 | 3300025256 | Bacteria | 34037 |
| 130 | Ga0209759_1000830 | 3300025256 | Bacteria | 24405 |
| 131 | Ga0209233_1000135 | 3300025261 | Bacteria | 201057 |
| 132 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 133 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 134 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 135 | Ga0209130_1006747 | 3300025284 | Bacteria | 3670 |
| 136 | Ga0209025_1007282 | 3300025294 | Bacteria | 8301 |
| 137 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 138 | Ga0209564_1000348 | 3300025295 | Bacteria | 86984 |
| 139 | Ga0209564_1002172 | 3300025295 | Bacteria | 16506 |
| 140 | Ga0209564_1005720 | 3300025295 | Bacteria | 6961 |
| 141 | Ga0209758_1000340 | 3300025297 | Bacteria | 86646 |
| 142 | Ga0207426_1000183 | 3300025302 | Bacteria | 154449 |
| 143 | Ga0207655_1010294 | 3300025728 | Bacteria | 5679 |
| 144 | Ga0207713_1001524 | 3300025735 | Bacteria | 18242 |
| 145 | Ga0207647_10001598 | 3300025904 | Bacteria | 17402 |
| 146 | Ga0207647_10018062 | 3300025904 | Bacteria | 4780 |
| 147 | Ga0207647_10021133 | 3300025904 | Bacteria | 4349 |
| 148 | Ga0207705_10000706 | 3300025909 | Bacteria | 27583 |
| 149 | Ga0207707_10078643 | 3300025912 | Bacteria | 2880 |
| 150 | Ga0207695_10002638 | 3300025913 | Bacteria | 26228 |
| 151 | Ga0207695_10003550 | 3300025913 | Bacteria | 21855 |
| 152 | Ga0207695_10004451 | 3300025913 | Bacteria | 19092 |
| 153 | Ga0207695_10058334 | 3300025913 | Bacteria | 4007 |
| 154 | Ga0207695_10119524 | 3300025913 | Bacteria | 2605 |
| 155 | Ga0207671_10008552 | 3300025914 | Bacteria | 8659 |
| 156 | Ga0207671_10132068 | 3300025914 | Bacteria | 1917 |
| 157 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 158 | Ga0207649_10328694 | 3300025920 | Bacteria | 1125 |
| 159 | Ga0207694_10080147 | 3300025924 | Bacteria | 2562 |
| 160 | Ga0207700_10106244 | 3300025928 | Bacteria | 2250 |
| 161 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 162 | Ga0207667_10001310 | 3300025949 | Bacteria | 31213 |
| 163 | Ga0207667_10059722 | 3300025949 | Bacteria | 3992 |
| 164 | Ga0207667_10613491 | 3300025949 | Bacteria | 1096 |
| 165 | Ga0207658_10052982 | 3300025986 | Bacteria | 2996 |
| 166 | Ga0207703_10029243 | 3300026035 | Bacteria | 4346 |
| 167 | Ga0207703_10516054 | 3300026035 | Bacteria | 1123 |
| 168 | Ga0207678_10000640 | 3300026067 | Bacteria | 32171 |
| 169 | Ga0207678_10109690 | 3300026067 | Bacteria | 2354 |
| 170 | Ga0207702_11138214 | 3300026078 | Bacteria | 774 |
| 171 | Ga0207674_10062444 | 3300026116 | Bacteria | 3763 |
| 172 | Ga0209281_1004199 | 3300027111 | Bacteria | 4388 |
| 173 | Ga0209371_1000202 | 3300027312 | Bacteria | 85989 |
| 174 | Ga0209371_1007990 | 3300027312 | Bacteria | 3585 |
| 175 | Ga0268266_10002606 | 3300028379 | Bacteria | 19106 |
| 176 | Ga0268266_10014962 | 3300028379 | Bacteria | 6661 |
| 177 | Ga0268256_1000189 | 3300030500 | Bacteria | 72206 |
| 178 | Ga0268256_1006535 | 3300030500 | Bacteria | 4315 |
| 179 | Ga0265331_10006217 | 3300031250 | Bacteria | 7086 |
| 180 | Ga0265327_10047534 | 3300031251 | Bacteria | 2263 |
| 181 | Ga0307408_100006987 | 3300031548 | Bacteria | 7469 |
| 182 | Ga0307405_10030128 | 3300031731 | Bacteria | 3179 |
| 183 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 184 | Ga0307416_100050490 | 3300032002 | Bacteria | 3316 |
| 185 | Ga0373939_0104433 | 3300035114 | Bacteria | 977 |
| 186 | Ga0395900_0001172 | 3300037418 | Bacteria | 32710 |
| 187 | Ga0395900_0539860 | 3300037418 | Bacteria | 1112 |
| 188 | Ga0395898_0001373 | 3300037466 | Bacteria | 34999 |
| 189 | Ga0395898_0143474 | 3300037466 | Bacteria | 2286 |
| 190 | Ga0395905_0033181 | 3300037471 | Bacteria | 4850 |
| 191 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 192 | Ga0395901_0000264 | 3300038443 | Bacteria | 65306 |
| 193 | Ga0436365_0124429 | 3300039437 | Bacteria | 2257 |
| 194 | Ga0466969_0004678 | 3300044656 | Bacteria | 7291 |
| 195 | Ga0466969_0005458 | 3300044656 | Bacteria | 6763 |
| 196 | Ga0466969_0013814 | 3300044656 | Bacteria | 4251 |
| 197 | Ga0466969_0084527 | 3300044656 | Bacteria | 1510 |
| 198 | Ga0466980_0240838 | 3300044668 | Bacteria | 1130 |
| 199 | Ga0466965_0000606 | 3300044683 | Bacteria | 13073 |
| 200 | Ga0466965_0001401 | 3300044683 | Bacteria | 9706 |
| 201 | Ga0466966_0000066 | 3300044684 | Bacteria | 69299 |
| 202 | Ga0466966_0000227 | 3300044684 | Bacteria | 37516 |
| 203 | Ga0466966_0006963 | 3300044684 | Bacteria | 7485 |
| 204 | Ga0466966_0089831 | 3300044684 | Bacteria | 1908 |
| 205 | Ga0466961_0000037 | 3300044693 | Bacteria | 80759 |
| 206 | Ga0466961_0001393 | 3300044693 | Bacteria | 14971 |
| 207 | Ga0466961_0002686 | 3300044693 | Bacteria | 11035 |
| 208 | Ga0466961_0004562 | 3300044693 | Bacteria | 8687 |
| 209 | Ga0466961_0016531 | 3300044693 | Bacteria | 4740 |
| 210 | Ga0466961_0025387 | 3300044693 | Bacteria | 3810 |
| 211 | Ga0466963_0002315 | 3300044694 | Bacteria | 10606 |
| 212 | Ga0466963_0003459 | 3300044694 | Bacteria | 9046 |
| 213 | Ga0466963_0015198 | 3300044694 | Bacteria | 4761 |
| 214 | Ga0466963_0203010 | 3300044694 | Bacteria | 1387 |
| 215 | Ga0466964_0006690 | 3300044706 | Bacteria | 4297 |
| 216 | Ga0466964_0017023 | 3300044706 | Bacteria | 2780 |
| 217 | Ga0466971_0000253 | 3300044719 | Bacteria | 20381 |
| 218 | Ga0466971_0001402 | 3300044719 | Bacteria | 10119 |
| 219 | Ga0466971_0008797 | 3300044719 | Bacteria | 4406 |
| 220 | Ga0466971_0026634 | 3300044719 | Bacteria | 2585 |
| 221 | Ga0466968_0090169 | 3300044735 | Bacteria | 1357 |
| 222 | Ga0466970_0000417 | 3300044765 | Bacteria | 20826 |
| 223 | Ga0466970_0001726 | 3300044765 | Bacteria | 10528 |
| 224 | Ga0466970_0028923 | 3300044765 | Bacteria | 2915 |
| 225 | Ga0466970_0240916 | 3300044765 | Bacteria | 1012 |
| 226 | Ga0466970_0302820 | 3300044765 | Bacteria | 902 |
| 227 | Ga0466957_0003013 | 3300044842 | Bacteria | 9146 |
| 228 | Ga0466957_0009195 | 3300044842 | Bacteria | 5638 |
| 229 | Ga0466957_0009985 | 3300044842 | Bacteria | 5432 |
| 230 | Ga0466957_0121737 | 3300044842 | Bacteria | 1664 |
| 231 | Ga0466957_0273899 | 3300044842 | Bacteria | 1128 |
| 232 | Ga0466959_0001227 | 3300045049 | Bacteria | 15480 |
| 233 | Ga0466959_0004990 | 3300045049 | Bacteria | 9003 |
| 234 | Ga0466959_0011060 | 3300045049 | Bacteria | 6476 |
| 235 | Ga0466959_0020718 | 3300045049 | Bacteria | 4845 |
| 236 | Ga0466959_0023700 | 3300045049 | Bacteria | 4542 |
| 237 | Ga0466959_0062796 | 3300045049 | Bacteria | 2699 |
| 238 | Ga0466959_0419504 | 3300045049 | Bacteria | 908 |
| 239 | Ga0451576_0265453 | 3300045051 | Bacteria | 1794 |
| 240 | Ga0466958_0000736 | 3300045836 | Bacteria | 14318 |
| 241 | Ga0466958_0006656 | 3300045836 | Bacteria | 6302 |
| 242 | Ga0466958_0007917 | 3300045836 | Bacteria | 5873 |
| 243 | Ga0466958_0369004 | 3300045836 | Bacteria | 925 |
| 244 | Ga0495617_000005 | 3300046452 | Bacteria | 404687 |
| 245 | Ga0495627_000033 | 3300046453 | Bacteria | 220621 |
| 246 | Ga0495592_0030564 | 3300046454 | Bacteria | 4074 |
| 247 | Ga0495592_0123576 | 3300046454 | Bacteria | 1818 |
| 248 | Ga0495603_0001415 | 3300046455 | Bacteria | 13954 |
| 249 | Ga0495603_0003952 | 3300046455 | Bacteria | 8830 |
| 250 | Ga0495603_0068454 | 3300046455 | Bacteria | 2089 |
| 251 | Ga0495603_0221202 | 3300046455 | Bacteria | 1092 |
| 252 | Ga0495590_0004876 | 3300046457 | Bacteria | 5364 |
| 253 | Ga0495590_0071581 | 3300046457 | Bacteria | 1217 |
| 254 | Ga0495591_001984 | 3300046458 | Bacteria | 11948 |
| 255 | Ga0495629_0000060 | 3300046459 | Bacteria | 100921 |
| 256 | Ga0495629_0002826 | 3300046459 | Bacteria | 13260 |
| 257 | Ga0495629_0005449 | 3300046459 | Bacteria | 9489 |
| 258 | Ga0495629_0069072 | 3300046459 | Bacteria | 2465 |
| 259 | Ga0495638_0017801 | 3300046460 | Bacteria | 4730 |
| 260 | Ga0495641_0011078 | 3300046461 | Bacteria | 5164 |
| 261 | Ga0495641_0080589 | 3300046461 | Bacteria | 1458 |
| 262 | Ga0495651_0001821 | 3300046462 | Bacteria | 16457 |
| 263 | Ga0495651_0050510 | 3300046462 | Bacteria | 3208 |
| 264 | Ga0495651_0121796 | 3300046462 | Bacteria | 1915 |
| 265 | Ga0495653_0000008 | 3300046463 | Bacteria | 307868 |
| 266 | Ga0495653_0001720 | 3300046463 | Bacteria | 17247 |
| 267 | Ga0495653_0011779 | 3300046463 | Bacteria | 7142 |
| 268 | Ga0495653_0037633 | 3300046463 | Bacteria | 3799 |
| 269 | Ga0495653_0043338 | 3300046463 | Bacteria | 3498 |
| 270 | Ga0495653_0252990 | 3300046463 | Bacteria | 1168 |
| 271 | Ga0495653_0277940 | 3300046463 | Bacteria | 1100 |
| 272 | Ga0495653_0297524 | 3300046463 | Bacteria | 1053 |
| 273 | Ga0495650_0000365 | 3300046471 | Bacteria | 79708 |
| 274 | Ga0495650_0018902 | 3300046471 | Bacteria | 3411 |
| 275 | Ga0495650_0045722 | 3300046471 | Bacteria | 1841 |
| 276 | Ga0495650_0107555 | 3300046471 | Bacteria | 1039 |
| 277 | Ga0495580_0000291 | 3300046472 | Bacteria | 40835 |
| 278 | Ga0495580_0000728 | 3300046472 | Bacteria | 28205 |
| 279 | Ga0495580_0001191 | 3300046472 | Bacteria | 22906 |
| 280 | Ga0495580_0002463 | 3300046472 | Bacteria | 16164 |
| 281 | Ga0495580_0009416 | 3300046472 | Bacteria | 7684 |
| 282 | Ga0495580_0031609 | 3300046472 | Bacteria | 3823 |
| 283 | Ga0495580_0049554 | 3300046472 | Bacteria | 2972 |
| 284 | Ga0495580_0535047 | 3300046472 | Bacteria | 779 |
| 285 | Ga0495580_0563473 | 3300046472 | Bacteria | 755 |
| 286 | Ga0495582_0007338 | 3300046473 | Bacteria | 6108 |
| 287 | Ga0495582_0015768 | 3300046473 | Bacteria | 4144 |
| 288 | Ga0495605_0000082 | 3300046474 | Bacteria | 125136 |
| 289 | Ga0495605_0013666 | 3300046474 | Bacteria | 4463 |
| 290 | Ga0495662_0013125 | 3300046476 | Bacteria | 4035 |
| 291 | Ga0495662_0161782 | 3300046476 | Bacteria | 1103 |
| 292 | Ga0495662_0171673 | 3300046476 | Bacteria | 1068 |
| 293 | Ga0495664_0000037 | 3300046477 | Bacteria | 70108 |
| 294 | Ga0495664_0001638 | 3300046477 | Bacteria | 11882 |
| 295 | Ga0495664_0009072 | 3300046477 | Bacteria | 5560 |
| 296 | Ga0495664_0044051 | 3300046477 | Bacteria | 2644 |
| 297 | Ga0495584_0129357 | 3300046491 | Bacteria | 1281 |
| 298 | Ga0495585_0005923 | 3300046492 | Bacteria | 7650 |
| 299 | Ga0495594_0152934 | 3300046499 | Bacteria | 1310 |
| 300 | Ga0495596_0003678 | 3300046500 | Bacteria | 7672 |
| 301 | Ga0495607_0040877 | 3300046501 | Bacteria | 2757 |
| 302 | Ga0495583_0002702 | 3300046506 | Bacteria | 14733 |
| 303 | Ga0495583_0008290 | 3300046506 | Bacteria | 6371 |
| 304 | Ga0495606_0000048 | 3300046507 | Bacteria | 207840 |
| 305 | Ga0495606_0001916 | 3300046507 | Bacteria | 25879 |
| 306 | Ga0495606_0029193 | 3300046507 | Bacteria | 3877 |
| 307 | Ga0495606_0048597 | 3300046507 | Bacteria | 2788 |
| 308 | Ga0495606_0124527 | 3300046507 | Bacteria | 1538 |
| 309 | Ga0495606_0141797 | 3300046507 | Bacteria | 1418 |
| 310 | Ga0495606_0148720 | 3300046507 | Bacteria | 1376 |
| 311 | Ga0495606_0242562 | 3300046507 | Bacteria | 1004 |
| 312 | Ga0495606_0291649 | 3300046507 | Bacteria | 887 |
| 313 | Ga0495608_0072460 | 3300046511 | Bacteria | 2247 |
| 314 | Ga0495608_0107160 | 3300046511 | Bacteria | 1798 |
| 315 | Ga0495610_0002900 | 3300046512 | Bacteria | 13881 |
| 316 | Ga0495618_0015491 | 3300046514 | Bacteria | 4653 |
| 317 | Ga0495618_0070084 | 3300046514 | Bacteria | 2229 |
| 318 | Ga0495618_0134741 | 3300046514 | Bacteria | 1580 |
| 319 | Ga0495628_0007659 | 3300046516 | Bacteria | 9336 |
| 320 | Ga0495628_0011864 | 3300046516 | Bacteria | 7353 |
| 321 | Ga0495628_0085018 | 3300046516 | Bacteria | 2454 |
| 322 | Ga0495628_0091074 | 3300046516 | Bacteria | 2360 |
| 323 | Ga0495628_0144548 | 3300046516 | Bacteria | 1813 |
| 324 | Ga0495628_0341787 | 3300046516 | Bacteria | 1101 |
| 325 | Ga0495630_0008007 | 3300046517 | Bacteria | 7591 |
| 326 | Ga0495630_0009248 | 3300046517 | Bacteria | 7084 |
| 327 | Ga0495630_0020044 | 3300046517 | Bacteria | 4924 |
| 328 | Ga0495630_0024525 | 3300046517 | Bacteria | 4459 |
| 329 | Ga0495630_0043721 | 3300046517 | Bacteria | 3347 |
| 330 | Ga0495643_0098364 | 3300046522 | Bacteria | 1502 |
| 331 | Ga0495644_0029156 | 3300046523 | Bacteria | 2086 |
| 332 | Ga0495648_0004350 | 3300046524 | Bacteria | 12127 |
| 333 | Ga0495648_0015798 | 3300046524 | Bacteria | 5459 |
| 334 | Ga0495648_0077574 | 3300046524 | Bacteria | 1903 |
| 335 | Ga0495648_0160135 | 3300046524 | Bacteria | 1164 |
| 336 | Ga0495666_0001133 | 3300046526 | Bacteria | 12770 |
| 337 | Ga0495666_0007812 | 3300046526 | Bacteria | 5356 |
| 338 | Ga0495666_0069458 | 3300046526 | Bacteria | 1676 |
| 339 | Ga0495666_0083078 | 3300046526 | Bacteria | 1514 |
| 340 | Ga0495642_0014286 | 3300046528 | Bacteria | 3076 |
| 341 | Ga0495652_0035956 | 3300046529 | Bacteria | 4308 |
| 342 | Ga0495652_0040238 | 3300046529 | Bacteria | 4039 |
| 343 | Ga0495652_0113708 | 3300046529 | Bacteria | 2173 |
| 344 | Ga0495652_0134159 | 3300046529 | Bacteria | 1955 |
| 345 | Ga0495652_0165455 | 3300046529 | Bacteria | 1712 |
| 346 | Ga0495654_0004264 | 3300046530 | Bacteria | 8544 |
| 347 | Ga0495665_0000627 | 3300046531 | Bacteria | 17967 |
| 348 | Ga0495665_0004869 | 3300046531 | Bacteria | 7241 |
| 349 | Ga0495665_0012822 | 3300046531 | Bacteria | 4535 |
| 350 | Ga0495665_0023929 | 3300046531 | Bacteria | 3281 |
| 351 | Ga0495640_0002615 | 3300046533 | Bacteria | 14472 |
| 352 | Ga0495640_0076010 | 3300046533 | Bacteria | 2241 |
| 353 | Ga0495640_0222803 | 3300046533 | Bacteria | 1189 |
| 354 | Ga0495586_0005674 | 3300046535 | Bacteria | 6675 |
| 355 | Ga0495586_0066157 | 3300046535 | Bacteria | 1970 |
| 356 | Ga0495586_0214280 | 3300046535 | Bacteria | 1093 |
| 357 | Ga0495587_0002254 | 3300046536 | Bacteria | 12891 |
| 358 | Ga0495609_0002061 | 3300046538 | Bacteria | 12653 |
| 359 | Ga0495597_0023395 | 3300046542 | Bacteria | 2857 |
| 360 | Ga0495597_0104168 | 3300046542 | Bacteria | 1194 |
| 361 | Ga0495645_0009157 | 3300046543 | Bacteria | 6917 |
| 362 | Ga0495645_0026898 | 3300046543 | Bacteria | 4178 |
| 363 | Ga0495645_0141132 | 3300046543 | Bacteria | 1680 |
| 364 | Ga0495645_0184160 | 3300046543 | Bacteria | 1428 |
| 365 | Ga0495622_0000190 | 3300046557 | Bacteria | 49410 |
| 366 | Ga0495622_0144102 | 3300046557 | Bacteria | 1080 |
| 367 | Ga0495633_0078550 | 3300046558 | Bacteria | 1536 |
| 368 | Ga0495668_0001210 | 3300046616 | Bacteria | 26115 |
| 369 | Ga0495634_0050780 | 3300046642 | Bacteria | 2783 |
| 370 | Ga0495634_0271729 | 3300046642 | Bacteria | 1031 |
| 371 | Ga0495611_0039435 | 3300046648 | Bacteria | 2102 |
| 372 | Ga0495625_0026873 | 3300046660 | Bacteria | 4341 |
| 373 | Ga0495625_0079286 | 3300046660 | Bacteria | 2290 |
| 374 | Ga0495635_0027251 | 3300046663 | Bacteria | 3975 |
| 375 | Ga0495635_0032464 | 3300046663 | Bacteria | 3622 |
| 376 | Ga0495635_0036555 | 3300046663 | Bacteria | 3403 |
| 377 | Ga0495635_0114327 | 3300046663 | Bacteria | 1842 |
| 378 | Ga0495661_0001085 | 3300046665 | Bacteria | 23930 |
| 379 | Ga0495661_0008422 | 3300046665 | Bacteria | 7131 |
| 380 | Ga0495661_0012262 | 3300046665 | Bacteria | 5790 |
| 381 | Ga0495588_0036956 | 3300046674 | Bacteria | 2480 |
| 382 | Ga0495588_0218878 | 3300046674 | Bacteria | 1005 |
| 383 | Ga0495657_0059546 | 3300046675 | Bacteria | 2533 |
| 384 | Ga0495599_0025715 | 3300046678 | Bacteria | 3686 |
| 385 | Ga0495599_0034888 | 3300046678 | Bacteria | 3158 |
| 386 | Ga0495599_0037140 | 3300046678 | Bacteria | 3060 |
| 387 | Ga0495599_0211291 | 3300046678 | Bacteria | 1189 |
| 388 | Ga0495599_0290785 | 3300046678 | Bacteria | 988 |
| 389 | Ga0495623_0008586 | 3300046679 | Bacteria | 6633 |
| 390 | Ga0495623_0012430 | 3300046679 | Bacteria | 5511 |
| 391 | Ga0495623_0073663 | 3300046679 | Bacteria | 2122 |
| 392 | Ga0495646_0000964 | 3300046680 | Bacteria | 16453 |
| 393 | Ga0495646_0004030 | 3300046680 | Bacteria | 9207 |
| 394 | Ga0495646_0032040 | 3300046680 | Bacteria | 3272 |
| 395 | Ga0495646_0088903 | 3300046680 | Bacteria | 1788 |
| 396 | Ga0495646_0204087 | 3300046680 | Bacteria | 1075 |
| 397 | Ga0495646_0356025 | 3300046680 | Bacteria | 766 |
| 398 | Ga0495669_0110993 | 3300046684 | Bacteria | 1280 |
| 399 | Ga0495613_0006326 | 3300046689 | Bacteria | 8857 |
| 400 | Ga0495613_0023271 | 3300046689 | Bacteria | 4615 |
| 401 | Ga0495624_0023620 | 3300046690 | Bacteria | 4052 |
| 402 | Ga0495624_0087956 | 3300046690 | Bacteria | 1918 |
| 403 | Ga0495624_0104436 | 3300046690 | Bacteria | 1743 |
| 404 | Ga0495624_0343081 | 3300046690 | Bacteria | 898 |
| 405 | Ga0495671_0130104 | 3300046692 | Bacteria | 1227 |
| 406 | Ga0495649_0129032 | 3300046694 | Bacteria | 1334 |
| 407 | Ga0495649_0261768 | 3300046694 | Bacteria | 886 |
| 408 | Ga0495649_0275613 | 3300046694 | Bacteria | 860 |
| 409 | Ga0495589_0001627 | 3300046794 | Bacteria | 12881 |
| 410 | Ga0495589_0054384 | 3300046794 | Bacteria | 1974 |
| 411 | Ga0495589_0125580 | 3300046794 | Bacteria | 1234 |
| 412 | Ga0495600_0018398 | 3300046809 | Bacteria | 4450 |
| 413 | Ga0495600_0026670 | 3300046809 | Bacteria | 3730 |
| 414 | Ga0495600_0370792 | 3300046809 | Bacteria | 894 |
| 415 | Ga0495660_0002949 | 3300046810 | Bacteria | 10657 |
| 416 | Ga0495660_0040832 | 3300046810 | Bacteria | 2570 |
| 417 | Ga0495660_0240522 | 3300046810 | Bacteria | 844 |
| 418 | Ga0495581_0003064 | 3300047315 | Bacteria | 9562 |
| 419 | Ga0495581_0080258 | 3300047315 | Bacteria | 1888 |
| 420 | Ga0495581_0084929 | 3300047315 | Bacteria | 1835 |
| 421 | Ga0495604_0025505 | 3300047317 | Bacteria | 4710 |
| 422 | Ga0495604_0083289 | 3300047317 | Bacteria | 2391 |
| 423 | Ga0495604_0155065 | 3300047317 | Bacteria | 1623 |
| 424 | Ga0495674_0004711 | 3300047319 | Bacteria | 13121 |
| 425 | Ga0495674_0005533 | 3300047319 | Bacteria | 12118 |
| 426 | Ga0495674_0025521 | 3300047319 | Bacteria | 5417 |
| 427 | Ga0495674_0091647 | 3300047319 | Bacteria | 2595 |
| 428 | Ga0495674_0459986 | 3300047319 | Bacteria | 1021 |
| 429 | Ga0495672_0037013 | 3300047320 | Bacteria | 2990 |
| 430 | Ga0495672_0046511 | 3300047320 | Bacteria | 2587 |
| 431 | Ga0495676_0005402 | 3300047321 | Bacteria | 11710 |
| 432 | Ga0495676_0037460 | 3300047321 | Bacteria | 4036 |
| 433 | Ga0495676_0113346 | 3300047321 | Bacteria | 1985 |
| 434 | Ga0495676_0373948 | 3300047321 | Bacteria | 949 |
| 435 | Ga0495680_0001059 | 3300047322 | Bacteria | 30455 |
| 436 | Ga0495680_0022923 | 3300047322 | Bacteria | 5198 |
| 437 | Ga0495680_0051099 | 3300047322 | Bacteria | 3229 |
| 438 | Ga0495680_0080600 | 3300047322 | Bacteria | 2459 |
| 439 | Ga0495680_0104145 | 3300047322 | Bacteria | 2111 |
| 440 | Ga0495683_0005028 | 3300047323 | Bacteria | 7408 |
| 441 | Ga0495683_0005067 | 3300047323 | Bacteria | 7374 |
| 442 | Ga0495683_0019110 | 3300047323 | Bacteria | 3537 |
| 443 | Ga0495683_0025164 | 3300047323 | Bacteria | 3052 |
| 444 | Ga0495683_0035414 | 3300047323 | Bacteria | 2537 |
| 445 | Ga0495683_0048986 | 3300047323 | Bacteria | 2117 |
| 446 | Ga0495687_033403 | 3300047443 | Bacteria | 2334 |
| 447 | Ga0495687_037834 | 3300047443 | Bacteria | 2146 |
| 448 | Ga0495675_0014442 | 3300047444 | Bacteria | 4989 |
| 449 | Ga0495675_0016656 | 3300047444 | Bacteria | 4646 |
| 450 | Ga0495675_0079572 | 3300047444 | Bacteria | 2064 |
| 451 | Ga0495679_000038 | 3300047446 | Bacteria | 157311 |
| 452 | Ga0495679_000990 | 3300047446 | Bacteria | 17515 |
| 453 | Ga0495679_001096 | 3300047446 | Bacteria | 16376 |
| 454 | Ga0495679_101651 | 3300047446 | Bacteria | 798 |
| 455 | Ga0495673_0000098 | 3300047469 | Bacteria | 182002 |
| 456 | Ga0495673_0007845 | 3300047469 | Bacteria | 6070 |
| 457 | Ga0495673_0039163 | 3300047469 | Bacteria | 2151 |
| 458 | Ga0495681_0007634 | 3300047470 | Bacteria | 6879 |
| 459 | Ga0495684_0031732 | 3300047471 | Bacteria | 4058 |
| 460 | Ga0495684_0248974 | 3300047471 | Bacteria | 1293 |
| 461 | Ga0495686_0037158 | 3300047472 | Bacteria | 3122 |
| 462 | Ga0495593_0001558 | 3300047673 | Bacteria | 13525 |
| 463 | Ga0495593_0005158 | 3300047673 | Bacteria | 7721 |
| 464 | Ga0495593_0007154 | 3300047673 | Bacteria | 6545 |
| 465 | Ga0495593_0023225 | 3300047673 | Bacteria | 3448 |
| 466 | Ga0495593_0092841 | 3300047673 | Bacteria | 1553 |
| 467 | Ga0495593_0156070 | 3300047673 | Bacteria | 1153 |
| 468 | Ga0495602_0018601 | 3300048088 | Bacteria | 6929 |
| 469 | Ga0495602_0024213 | 3300048088 | Bacteria | 5893 |
| 470 | Ga0495602_0029041 | 3300048088 | Bacteria | 5280 |
| 471 | Ga0495602_0112711 | 3300048088 | Bacteria | 2206 |
| 472 | Ga0495602_0254188 | 3300048088 | Bacteria | 1307 |
| 473 | Ga0495602_0361114 | 3300048088 | Bacteria | 1045 |
| 474 | Ga0495614_0003398 | 3300048089 | Bacteria | 7124 |
| 475 | Ga0495614_0005862 | 3300048089 | Bacteria | 5534 |
| 476 | Ga0495614_0057547 | 3300048089 | Bacteria | 1669 |
| 477 | Ga0495614_0058640 | 3300048089 | Bacteria | 1653 |
| 478 | Ga0495626_0019139 | 3300048091 | Bacteria | 3426 |
| 479 | Ga0496100_0002473 | 3300048903 | Bacteria | 9388 |
| 480 | Ga0496100_0003752 | 3300048903 | Bacteria | 7954 |
| 481 | Ga0496100_0028796 | 3300048903 | Bacteria | 3429 |
| 482 | Ga0496100_0136002 | 3300048903 | Bacteria | 1736 |
| 483 | Ga0496101_0001448 | 3300048904 | Bacteria | 14161 |
| 484 | Ga0496101_0036182 | 3300048904 | Bacteria | 3496 |
| 485 | Ga0496101_0041601 | 3300048904 | Bacteria | 3277 |
| 486 | Ga0496102_0003516 | 3300048905 | Bacteria | 13279 |
| 487 | Ga0496102_0004637 | 3300048905 | Bacteria | 11630 |
| 488 | Ga0496102_0049400 | 3300048905 | Bacteria | 3827 |
| 489 | Ga0496102_0204784 | 3300048905 | Bacteria | 1860 |
| 490 | Ga0496102_0656200 | 3300048905 | Bacteria | 972 |
| 491 | Ga0496103_0002086 | 3300048906 | Bacteria | 12767 |
| 492 | Ga0496103_0002298 | 3300048906 | Bacteria | 12076 |
| 493 | Ga0496103_0005467 | 3300048906 | Bacteria | 7596 |
| 494 | Ga0496103_0015875 | 3300048906 | Bacteria | 4490 |
| 495 | Ga0496103_0066234 | 3300048906 | Bacteria | 2254 |
| 496 | Ga0496104_0059386 | 3300048907 | Bacteria | 3620 |
| 497 | Ga0496104_0407738 | 3300048907 | Bacteria | 1271 |
| 498 | Ga0496105_0087787 | 3300048908 | Bacteria | 2569 |
| 499 | Ga0496105_0392988 | 3300048908 | Bacteria | 1102 |
| 500 | Ga0496106_0110128 | 3300048909 | Bacteria | 2143 |
| 501 | Ga0496107_0037568 | 3300048910 | Bacteria | 3475 |
| 502 | Ga0496108_0227949 | 3300048911 | Bacteria | 1619 |
| 503 | Ga0496109_0073221 | 3300048912 | Bacteria | 3148 |
| 504 | Ga0496110_0090939 | 3300048913 | Bacteria | 2729 |
| 505 | Ga0496111_0039631 | 3300048914 | Bacteria | 3379 |
| 506 | Ga0496112_0021900 | 3300048915 | Bacteria | 6082 |
| 507 | Ga0496112_0023099 | 3300048915 | Bacteria | 5936 |
| 508 | Ga0496113_0011252 | 3300048916 | Bacteria | 5959 |
| 509 | Ga0496113_0037435 | 3300048916 | Bacteria | 3560 |
| 510 | Ga0496115_0057931 | 3300048918 | Bacteria | 3117 |
| 511 | Ga0496115_0308801 | 3300048918 | Bacteria | 1295 |
| 512 | Ga0496115_0380464 | 3300048918 | Bacteria | 1148 |
| 513 | Ga0496115_0494218 | 3300048918 | Bacteria | 984 |
| 514 | Ga0496116_0012813 | 3300048919 | Bacteria | 6814 |
| 515 | Ga0496116_0022544 | 3300048919 | Bacteria | 4716 |
| 516 | Ga0496116_0032690 | 3300048919 | Bacteria | 3704 |
| 517 | Ga0496116_0068010 | 3300048919 | Bacteria | 2272 |
| 518 | Ga0496116_0161415 | 3300048919 | Bacteria | 1229 |
| 519 | Ga0496116_0197967 | 3300048919 | Bacteria | 1055 |
| 520 | Ga0496117_0003564 | 3300048920 | Bacteria | 17969 |
| 521 | Ga0496117_0005225 | 3300048920 | Bacteria | 13798 |
| 522 | Ga0496117_0010730 | 3300048920 | Bacteria | 8283 |
| 523 | Ga0496117_0049233 | 3300048920 | Bacteria | 3000 |
| 524 | Ga0496118_0001410 | 3300048921 | Bacteria | 36234 |
| 525 | Ga0496118_0004991 | 3300048921 | Bacteria | 15338 |
| 526 | Ga0496118_0005234 | 3300048921 | Bacteria | 14834 |
| 527 | Ga0496118_0026293 | 3300048921 | Bacteria | 4962 |
| 528 | Ga0496118_0028440 | 3300048921 | Bacteria | 4706 |
| 529 | Ga0496118_0060402 | 3300048921 | Bacteria | 2815 |
| 530 | Ga0496119_0199273 | 3300048922 | Bacteria | 1037 |
| 531 | Ga0496119_0252703 | 3300048922 | Bacteria | 888 |
| 532 | Ga0496121_0003570 | 3300048924 | Bacteria | 21990 |
| 533 | Ga0496121_0007511 | 3300048924 | Bacteria | 13151 |
| 534 | Ga0496121_0031530 | 3300048924 | Bacteria | 4839 |
| 535 | Ga0496121_0047707 | 3300048924 | Bacteria | 3651 |
| 536 | Ga0496121_0050756 | 3300048924 | Bacteria | 3501 |
| 537 | Ga0496121_0107949 | 3300048924 | Bacteria | 2130 |
| 538 | Ga0496121_0110782 | 3300048924 | Bacteria | 2094 |
| 539 | Ga0496122_0012927 | 3300048925 | Bacteria | 8240 |
| 540 | Ga0496122_0275011 | 3300048925 | Bacteria | 925 |
| 541 | Ga0496123_0009874 | 3300048926 | Bacteria | 8521 |
| 542 | Ga0496124_0010905 | 3300048927 | Bacteria | 9145 |
| 543 | Ga0496124_0099208 | 3300048927 | Bacteria | 2362 |
| 544 | Ga0496124_0427593 | 3300048927 | Bacteria | 910 |
| 545 | Ga0496126_0000706 | 3300048929 | Bacteria | 60980 |
| 546 | Ga0496126_0001223 | 3300048929 | Bacteria | 41744 |
| 547 | Ga0496126_0006478 | 3300048929 | Bacteria | 13039 |
| 548 | Ga0496126_0009208 | 3300048929 | Bacteria | 10531 |
| 549 | Ga0496126_0028853 | 3300048929 | Bacteria | 5280 |
| 550 | Ga0496126_0420893 | 3300048929 | Bacteria | 1080 |
| 551 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 552 | Ga0495678_008322 | 3300049459 | Bacteria | 5246 |
| 553 | Ga0495682_0022703 | 3300049460 | Bacteria | 2346 |
| 554 | Ga0501031_0181958 | 3300049568 | Bacteria | 1373 |
| 555 | Ga0501032_0191219 | 3300049569 | Bacteria | 1338 |
| 556 | Ga0501033_0018316 | 3300049570 | Bacteria | 5291 |
| 557 | Ga0501036_0005955 | 3300049572 | Bacteria | 9883 |
| 558 | Ga0501036_0280946 | 3300049572 | Bacteria | 1393 |
| 559 | Ga0501037_0048639 | 3300049573 | Bacteria | 3106 |
| 560 | Ga0501038_0012767 | 3300049574 | Bacteria | 7673 |
| 561 | Ga0501038_0013159 | 3300049574 | Bacteria | 7546 |
| 562 | Ga0501039_0003471 | 3300049575 | Bacteria | 11777 |
| 563 | Ga0501039_0044990 | 3300049575 | Bacteria | 3409 |
| 564 | Ga0501040_0005113 | 3300049576 | Bacteria | 8480 |
| 565 | Ga0501040_0005312 | 3300049576 | Bacteria | 8329 |
| 566 | Ga0501041_0005447 | 3300049577 | Bacteria | 7451 |
| 567 | Ga0501041_0005640 | 3300049577 | Bacteria | 7311 |
| 568 | Ga0501042_0014805 | 3300049578 | Bacteria | 5327 |
| 569 | Ga0501042_0028904 | 3300049578 | Bacteria | 3909 |
| 570 | Ga0501043_0018050 | 3300049579 | Bacteria | 5534 |
| 571 | Ga0501046_0027896 | 3300049580 | Bacteria | 4603 |
| 572 | Ga0501046_0118499 | 3300049580 | Bacteria | 2016 |
| 573 | Ga0501048_0021988 | 3300049582 | Bacteria | 4668 |
| 574 | Ga0501068_0021663 | 3300049584 | Bacteria | 3755 |
| 575 | Ga0501070_0606313 | 3300049586 | Bacteria | 872 |
| 576 | Ga0501071_0000534 | 3300049587 | Bacteria | 19489 |
| 577 | Ga0501072_0008540 | 3300049588 | Bacteria | 7768 |
| 578 | Ga0501072_0014970 | 3300049588 | Bacteria | 5945 |
| 579 | Ga0501072_0907148 | 3300049588 | Bacteria | 688 |
| 580 | Ga0501074_0018563 | 3300049590 | Bacteria | 5052 |
| 581 | Ga0501074_0351210 | 3300049590 | Bacteria | 1046 |
| 582 | Ga0501075_0011006 | 3300049591 | Bacteria | 6383 |
| 583 | Ga0501077_0010411 | 3300049593 | Bacteria | 5787 |
| 584 | Ga0501077_0461535 | 3300049593 | Bacteria | 813 |
| 585 | Ga0501079_0012238 | 3300049741 | Bacteria | 6551 |
| 586 | Ga0501079_0121604 | 3300049741 | Bacteria | 2030 |
| 587 | Ga0501080_0033258 | 3300049742 | Bacteria | 4812 |
| 588 | Ga0501080_0034682 | 3300049742 | Bacteria | 4712 |
| 589 | Ga0501081_0004723 | 3300049743 | Bacteria | 8760 |
| 590 | Ga0501269_000145 | 3300049766 | Bacteria | 22006 |
| 591 | Ga0501035_0035238 | 3300049822 | Bacteria | 4542 |
| 592 | Ga0501035_0102065 | 3300049822 | Bacteria | 2516 |
| 593 | Ga0501044_0307450 | 3300049823 | Bacteria | 1513 |
| 594 | Ga0501045_0015934 | 3300049824 | Bacteria | 5332 |
| 595 | Ga0501045_0067242 | 3300049824 | Bacteria | 2631 |
| 596 | nmdc:mga03683_8147_c1 | 3300050489 | Bacteria | 3671 |
| 597 | Ga0495655_0022673 | 3300053083 | Bacteria | 1438 |
| 598 | Ga0500586_002407 | 3300053145 | Bacteria | 4217 |
| 599 | Ga0500634_0016878 | 3300053161 | Bacteria | 3902 |
| 600 | Ga0500637_0041092 | 3300053178 | Bacteria | 2614 |
| 601 | Ga0500596_020735 | 3300053735 | Bacteria | 989 |
| 602 | Ga0501084_0023931 | 3300054114 | Bacteria | 5095 |
| 603 | Ga0501084_0027073 | 3300054114 | Bacteria | 4790 |
| 604 | Ga0501082_0009269 | 3300060353 | Bacteria | 8485 |
| 605 | Ga0501082_0020664 | 3300060353 | Bacteria | 5675 |
| 606 | Ga0466962_0000472 | 3300061719 | Bacteria | 17495 |
| 607 | Ga0466962_0001486 | 3300061719 | Bacteria | 10935 |
| 608 | Ga0466962_0020544 | 3300061719 | Bacteria | 3172 |
| 609 | Ga0466962_0022583 | 3300061719 | Bacteria | 3023 |
| 610 | Ga0530510_0016081 | 3300061734 | Bacteria | 5289 |
| 611 | 2509131436 | 2508501125 | Bacteria | 7208311 |
| 612 | 2510251845 | 2510065045 | Bacteria | 7761063 |
| 613 | 2512345187 | 2512047030 | Bacteria | 9031815 |
| 614 | 2513961414 | 2513237151 | Bacteria | 6309801 |
| 615 | 2514053370 | 2513237166 | Bacteria | 10373764 |
| 616 | 2515684277 | 2515154122 | Bacteria | 8609520 |
| 617 | 2515691573 | 2515154123 | Bacteria | 6387382 |
| 618 | 2519458207 | 2519103095 | Bacteria | 6629912 |
| 619 | 2527080696 | 2526164713 | Bacteria | 6780608 |
| 620 | 2563059275 | 2562617112 | Bacteria | 10918404 |
| 621 | 2585294739 | 2582581311 | Bacteria | 6763856 |
| 622 | 2599738069 | 2599185239 | Bacteria | 8686614 |
| 623 | 2599742559 | 2599185240 | Bacteria | 7968121 |
| 624 | 2600204677 | 2599185355 | Bacteria | 7968906 |
| 625 | 2600810865 | 2600255067 | Bacteria | 6795583 |
| 626 | 2676741663 | 2675903129 | Bacteria | 7964495 |
| 627 | 2713479791 | 2711768613 | Bacteria | 11048459 |
| 628 | 2719640956 | 2718217991 | Bacteria | 7829542 |
| 629 | 2738819034 | 2738541296 | Bacteria | 7285013 |
| 630 | 2738827303 | 2738541297 | Bacteria | 6549566 |
| 631 | 2738830810 | 2738541298 | Bacteria | 7286732 |
| 632 | 2738872337 | 2738541306 | Bacteria | 7284992 |
| 633 | 2739151100 | 2738541357 | Bacteria | 6549408 |
| 634 | 2739183967 | 2738543002 | Bacteria | 7284546 |
| 635 | 2739193019 | 2738543003 | Bacteria | 6549560 |
| 636 | 2739218937 | 2738543008 | Bacteria | 7282815 |
| 637 | 2739319496 | 2738543026 | Bacteria | 6549408 |
| 638 | 2739337737 | 2738543029 | Bacteria | 6549249 |
| 639 | 2746088216 | 2744054900 | Bacteria | 8399525 |
| 640 | 2746096890 | 2744054901 | Bacteria | 8397047 |
| 641 | 2753567671 | 2751185846 | Bacteria | 7242164 |
| 642 | 2792839740 | 2791355137 | Bacteria | 9654227 |
| 643 | 2808969976 | 2808606384 | Bacteria | 8474373 |
| 644 | 2809005177 | 2808606390 | Bacteria | 8476311 |
| 645 | 2809011682 | 2808606391 | Bacteria | 8308166 |
| 646 | 2817260359 | 2816332253 | Bacteria | 6764532 |
| 647 | 2817278047 | 2816332256 | Bacteria | 6891714 |
| 648 | 2817455614 | 2816332286 | Bacteria | 6853759 |
| 649 | 2819623531 | 2818991450 | Bacteria | 6962147 |
| 650 | 2819632885 | 2818991452 | Bacteria | 8442785 |
| 651 | 2842325049 | 2842324504 | Bacteria | 9364110 |
| 652 | 2842349327 | 2842348783 | Bacteria | 9002918 |
| 653 | 2842459930 | 2842454564 | Bacteria | 8730687 |
| 654 | 2857557892 | 2857553236 | Bacteria | 6166726 |
| 655 | 2863421896 | 2863421361 | Bacteria | 7300805 |
| 656 | 2870072162 | 2870068957 | Bacteria | 8925310 |
| 657 | 2885271045 | 2885270888 | Bacteria | 9831543 |
| 658 | 2900637773 | 2900634093 | Bacteria | 10263517 |
| 659 | 2902687367 | 2902682994 | Bacteria | 8951596 |
| 660 | 2904430009 | 2904424332 | Bacteria | 7633521 |
| 661 | 2904487447 | 2904483920 | Bacteria | 7545285 |
| 662 | 2904566061 | 2904564687 | Bacteria | 7609577 |
| 663 | 2904573105 | 2904571731 | Bacteria | 7608790 |
| 664 | 2904623594 | 2904615490 | Bacteria | 10047340 |
| 665 | 2919479597 | 2919476304 | Bacteria | 5888696 |
| 666 | 2919528754 | 2919527303 | Bacteria | 7718827 |
| 667 | 2921653457 | 2921643360 | Bacteria | 11448031 |
| 668 | 2928110882 | 2928108538 | Bacteria | 7360024 |
| 669 | 2928137560 | 2928135762 | Bacteria | 7259641 |
| 670 | 2928159523 | 2928157003 | Bacteria | 7522202 |
| 671 | 2928164417 | 2928163908 | Bacteria | 7561269 |
| 672 | 2928177599 | 2928170801 | Bacteria | 8785406 |
| 673 | 2928505733 | 2928503688 | Bacteria | 7268108 |
| 674 | 2928538373 | 2928536128 | Bacteria | 7657547 |
| 675 | 2945937715 | 2945934425 | Bacteria | 7444609 |
| 676 | 2981993957 | 2981990288 | Bacteria | 7590678 |
| 677 | 2990705567 | 2990703756 | Bacteria | 7715990 |
| 678 | 642417926 | 641736154 | Bacteria | 7689995 |
| 679 | 642592541 | 642555112 | Bacteria | 8676562 |
| 680 | 642622543 | 642555113 | Bacteria | 8214658 |
| 681 | 8018850330 | 8018845410 | Bacteria | 8933938 |
| 682 | 8020808888 | 8020807995 | Bacteria | 6801506 |
| 683 | 8020947266 | 8020945358 | Bacteria | 8467355 |
| 684 | 8021122792 | 8021120328 | Bacteria | 8782274 |
| 685 | 8039102728 | 8039098773 | Bacteria | 6602928 |
| 686 | 8040169339 | 8040167225 | Bacteria | 6542727 |
| 687 | 8040174958 | 8040173305 | Bacteria | 6827067 |
| 688 | 8055226985 | 8055225921 | Bacteria | 3341787 |
| 689 | 8055267000 | 8055266321 | Bacteria | 7999742 |
| 690 | 8055301685 | 8055301274 | Bacteria | 8587385 |
| 691 | Ga0495592_0003149 | |||
| 692 | JGI24740J21852_10000321 | |||
| 693 | JGI24739J22299_10005570 | |||
| 694 | JGI24739J22299_10007598 | |||
| 695 | JGI24739J22299_10024097 | |||
| 696 | JGI24739J22299_10028840 | |||
| 697 | JGI24737J22298_10022298 | |||
| 698 | JGI24735J21928_10000211 | |||
| 699 | JGI24735J21928_10001050 | |||
| 700 | JGI24735J21928_10005467 | |||
| 701 | JGI24738J21930_10001905 | |||
| 702 | JGI25156J39149_1001121 | |||
| 703 | JGI25156J39149_1010495 | |||
| 704 | JGI25154J39366_1000558 | |||
| 705 | JGI25165J46597_1002871 | |||
| 706 | rootL2_10033819 | |||
| 707 | rootH1_10169913 | |||
| 708 | JGI25160J50197_1000818 | |||
| 709 | Ga0055533_1000618 | |||
| 710 | Ga0055533_1009008 | |||
| 711 | Ga0055532_1000039 | |||
| 712 | Ga0055532_1002103 | |||
| 713 | Ga0055532_1002180 | |||
| 714 | Ga0055527_1000024 | |||
| 715 | Ga0055527_1000493 | |||
| 716 | Ga0055527_1000532 | |||
| 717 | Ga0055535_1000028 | |||
| 718 | Ga0055535_1001248 | |||
| 719 | Ga0055535_1001362 | |||
| 720 | Ga0055542_1000047 | |||
| 721 | Ga0055542_1001239 | |||
| 722 | Ga0055542_1004506 | |||
| 723 | Ga0055529_1000054 | |||
| 724 | Ga0055529_1000492 | |||
| 725 | Ga0055526_1000709 | |||
| 726 | Ga0055528_1001475 | |||
| 727 | Ga0065165_1002547 | |||
| 728 | Ga0070658_10001863 | |||
| 729 | Ga0070658_10004277 | |||
| 730 | Ga0070666_10279696 | |||
| 731 | Ga0070660_100000016 | |||
| 732 | Ga0070661_100102233 | |||
| 733 | Ga0070659_100000014 | |||
| 734 | Ga0070659_100138694 | |||
| 735 | Ga0070663_100002147 | |||
| 736 | Ga0070663_100347671 | |||
| 737 | Ga0070684_100379518 | |||
| 738 | Ga0070665_100016567 | |||
| 739 | Ga0068855_100002126 | |||
| 740 | Ga0068855_100011135 | |||
| 741 | Ga0068855_100155534 | |||
| 742 | Ga0068855_100183129 | |||
| 743 | Ga0068856_101238293 | |||
| 744 | Ga0068858_100043018 | |||
| 745 | Ga0075363_100083055 | |||
| 746 | Ga0075362_10005404 | |||
| 747 | Ga0079104_1025720 | |||
| 748 | Ga0105251_10001940 | |||
| 749 | Ga0105251_10098430 | |||
| 750 | Ga0105251_10117292 | |||
| 751 | Ga0105244_10001408 | |||
| 752 | Ga0105240_10005681 | |||
| 753 | Ga0105240_10024403 | |||
| 754 | Ga0105240_10031037 | |||
| 755 | Ga0105240_10036958 | |||
| 756 | Ga0105240_10038727 | |||
| 757 | Ga0105240_10091007 | |||
| 758 | Ga0105240_10103481 | |||
| 759 | Ga0105240_10487230 | |||
| 760 | Ga0105247_10050555 | |||
| 761 | Ga0105241_10091472 | |||
| 762 | Ga0105248_10451790 | |||
| 763 | Ga0105237_10064356 | |||
| 764 | Ga0105237_10867525 | |||
| 765 | Ga0105238_10004083 | |||
| 766 | Ga0105238_10105936 | |||
| 767 | Ga0105238_11091045 | |||
| 768 | Ga0105239_10006046 | |||
| 769 | Ga0105239_10167743 | |||
| 770 | Ga0105239_10327341 | |||
| 771 | Ga0157373_10090002 | |||
| 772 | Ga0157371_10004966 | |||
| 773 | Ga0157370_10071414 | |||
| 774 | Ga0157370_10330826 | |||
| 775 | Ga0157370_10798941 | |||
| 776 | Ga0157369_10000820 | |||
| 777 | Ga0157369_10001117 | |||
| 778 | Ga0157369_10058799 | |||
| 779 | Ga0157369_10149955 | |||
| 780 | Ga0157369_10531280 | |||
| 781 | Ga0157374_10060594 | |||
| 782 | Ga0157374_10482756 | |||
| 783 | Ga0157372_10665335 | |||
| 784 | Ga0163163_10208473 | |||
| 785 | Ga0182008_10153551 | |||
| 786 | Ga0157376_10738959 | |||
| 787 | Ga0182006_1000211 | |||
| 788 | Ga0182006_1005017 | |||
| 789 | Ga0182006_1012863 | |||
| 790 | Ga0182007_10002694 | |||
| 791 | Ga0182007_10049519 | |||
| 792 | Ga0182005_1000005 | |||
| 793 | Ga0182005_1007213 | |||
| 794 | Ga0224712_10000963 | |||
| 795 | Ga0209566_100680 | |||
| 796 | Ga0209674_100013 | |||
| 797 | Ga0209674_100508 | |||
| 798 | Ga0209674_104330 | |||
| 799 | Ga0209672_100010 | |||
| 800 | Ga0209672_100019 | |||
| 801 | Ga0209672_100051 | |||
| 802 | Ga0209147_100006 | |||
| 803 | Ga0209147_100026 | |||
| 804 | Ga0209147_100192 | |||
| 805 | Ga0209147_100308 | |||
| 806 | Ga0209563_100478 | |||
| 807 | Ga0207427_100524 | |||
| 808 | Ga0209258_100010 | |||
| 809 | Ga0209258_100031 | |||
| 810 | Ga0209258_100358 | |||
| 811 | Ga0207425_1000766 | |||
| 812 | Ga0209646_1000036 | |||
| 813 | Ga0209148_1000018 | |||
| 814 | Ga0209148_1000027 | |||
| 815 | Ga0209148_1000400 | |||
| 816 | Ga0209148_1001772 | |||
| 817 | Ga0209759_1000147 | |||
| 818 | Ga0209759_1000160 | |||
| 819 | Ga0209759_1000617 | |||
| 820 | Ga0209759_1000830 | |||
| 821 | Ga0209233_1000135 | |||
| 822 | Ga0209455_1000015 | |||
| 823 | Ga0209455_1000213 | |||
| 824 | Ga0209673_1000201 | |||
| 825 | Ga0209130_1006747 | |||
| 826 | Ga0209025_1007282 | |||
| 827 | Ga0209564_1000032 | |||
| 828 | Ga0209564_1000348 | |||
| 829 | Ga0209564_1002172 | |||
| 830 | Ga0209564_1005720 | |||
| 831 | Ga0209758_1000340 | |||
| 832 | Ga0207426_1000183 | |||
| 833 | Ga0207655_1010294 | |||
| 834 | Ga0207713_1001524 | |||
| 835 | Ga0207647_10001598 | |||
| 836 | Ga0207647_10018062 | |||
| 837 | Ga0207647_10021133 | |||
| 838 | Ga0207705_10000706 | |||
| 839 | Ga0207707_10078643 | |||
| 840 | Ga0207695_10002638 | |||
| 841 | Ga0207695_10003550 | |||
| 842 | Ga0207695_10004451 | |||
| 843 | Ga0207695_10058334 | |||
| 844 | Ga0207695_10119524 | |||
| 845 | Ga0207671_10008552 | |||
| 846 | Ga0207671_10132068 | |||
| 847 | Ga0207657_10000001 | |||
| 848 | Ga0207649_10328694 | |||
| 849 | Ga0207694_10080147 | |||
| 850 | Ga0207700_10106244 | |||
| 851 | Ga0207690_10000006 | |||
| 852 | Ga0207667_10001310 | |||
| 853 | Ga0207667_10059722 | |||
| 854 | Ga0207667_10613491 | |||
| 855 | Ga0207658_10052982 | |||
| 856 | Ga0207703_10029243 | |||
| 857 | Ga0207703_10516054 | |||
| 858 | Ga0207678_10000640 | |||
| 859 | Ga0207678_10109690 | |||
| 860 | Ga0207702_11138214 | |||
| 861 | Ga0207674_10062444 | |||
| 862 | Ga0209281_1004199 | |||
| 863 | Ga0209371_1000202 | |||
| 864 | Ga0209371_1007990 | |||
| 865 | Ga0268266_10002606 | |||
| 866 | Ga0268266_10014962 | |||
| 867 | Ga0268256_1000189 | |||
| 868 | Ga0268256_1006535 | |||
| 869 | Ga0265331_10006217 | |||
| 870 | Ga0265327_10047534 | |||
| 871 | Ga0307408_100006987 | |||
| 872 | Ga0307405_10030128 | |||
| 873 | Ga0307412_10000008 | |||
| 874 | Ga0307416_100050490 | |||
| 875 | Ga0373939_0104433 | |||
| 876 | Ga0395900_0001172 | |||
| 877 | Ga0395900_0539860 | |||
| 878 | Ga0395898_0001373 | |||
| 879 | Ga0395898_0143474 | |||
| 880 | Ga0395905_0033181 | |||
| 881 | Ga0395901_0000011 | |||
| 882 | Ga0395901_0000264 | |||
| 883 | Ga0436365_0124429 | |||
| 884 | Ga0466969_0004678 | |||
| 885 | Ga0466969_0005458 | |||
| 886 | Ga0466969_0013814 | |||
| 887 | Ga0466969_0084527 | |||
| 888 | Ga0466980_0240838 | |||
| 889 | Ga0466965_0000606 | |||
| 890 | Ga0466965_0001401 | |||
| 891 | Ga0466966_0000066 | |||
| 892 | Ga0466966_0000227 | |||
| 893 | Ga0466966_0006963 | |||
| 894 | Ga0466966_0089831 | |||
| 895 | Ga0466961_0000037 | |||
| 896 | Ga0466961_0001393 | |||
| 897 | Ga0466961_0002686 | |||
| 898 | Ga0466961_0004562 | |||
| 899 | Ga0466961_0016531 | |||
| 900 | Ga0466961_0025387 | |||
| 901 | Ga0466963_0002315 | |||
| 902 | Ga0466963_0003459 | |||
| 903 | Ga0466963_0015198 | |||
| 904 | Ga0466963_0203010 | |||
| 905 | Ga0466964_0006690 | |||
| 906 | Ga0466964_0017023 | |||
| 907 | Ga0466971_0000253 | |||
| 908 | Ga0466971_0001402 | |||
| 909 | Ga0466971_0008797 | |||
| 910 | Ga0466971_0026634 | |||
| 911 | Ga0466968_0090169 | |||
| 912 | Ga0466970_0000417 | |||
| 913 | Ga0466970_0001726 | |||
| 914 | Ga0466970_0028923 | |||
| 915 | Ga0466970_0240916 | |||
| 916 | Ga0466970_0302820 | |||
| 917 | Ga0466957_0003013 | |||
| 918 | Ga0466957_0009195 | |||
| 919 | Ga0466957_0009985 | |||
| 920 | Ga0466957_0121737 | |||
| 921 | Ga0466957_0273899 | |||
| 922 | Ga0466959_0001227 | |||
| 923 | Ga0466959_0004990 | |||
| 924 | Ga0466959_0011060 | |||
| 925 | Ga0466959_0020718 | |||
| 926 | Ga0466959_0023700 | |||
| 927 | Ga0466959_0062796 | |||
| 928 | Ga0466959_0419504 | |||
| 929 | Ga0451576_0265453 | |||
| 930 | Ga0466958_0000736 | |||
| 931 | Ga0466958_0006656 | |||
| 932 | Ga0466958_0007917 | |||
| 933 | Ga0466958_0369004 | |||
| 934 | Ga0495617_000005 | |||
| 935 | Ga0495627_000033 | |||
| 936 | Ga0495592_0030564 | |||
| 937 | Ga0495592_0123576 | |||
| 938 | Ga0495603_0001415 | |||
| 939 | Ga0495603_0003952 | |||
| 940 | Ga0495603_0068454 | |||
| 941 | Ga0495603_0221202 | |||
| 942 | Ga0495590_0004876 | |||
| 943 | Ga0495590_0071581 | |||
| 944 | Ga0495591_001984 | |||
| 945 | Ga0495629_0000060 | |||
| 946 | Ga0495629_0002826 | |||
| 947 | Ga0495629_0005449 | |||
| 948 | Ga0495629_0069072 | |||
| 949 | Ga0495638_0017801 | |||
| 950 | Ga0495641_0011078 | |||
| 951 | Ga0495641_0080589 | |||
| 952 | Ga0495651_0001821 | |||
| 953 | Ga0495651_0050510 | |||
| 954 | Ga0495651_0121796 | |||
| 955 | Ga0495653_0000008 | |||
| 956 | Ga0495653_0001720 | |||
| 957 | Ga0495653_0011779 | |||
| 958 | Ga0495653_0037633 | |||
| 959 | Ga0495653_0043338 | |||
| 960 | Ga0495653_0252990 | |||
| 961 | Ga0495653_0277940 | |||
| 962 | Ga0495653_0297524 | |||
| 963 | Ga0495650_0000365 | |||
| 964 | Ga0495650_0018902 | |||
| 965 | Ga0495650_0045722 | |||
| 966 | Ga0495650_0107555 | |||
| 967 | Ga0495580_0000291 | |||
| 968 | Ga0495580_0000728 | |||
| 969 | Ga0495580_0001191 | |||
| 970 | Ga0495580_0002463 | |||
| 971 | Ga0495580_0009416 | |||
| 972 | Ga0495580_0031609 | |||
| 973 | Ga0495580_0049554 | |||
| 974 | Ga0495580_0535047 | |||
| 975 | Ga0495580_0563473 | |||
| 976 | Ga0495582_0007338 | |||
| 977 | Ga0495582_0015768 | |||
| 978 | Ga0495605_0000082 | |||
| 979 | Ga0495605_0013666 | |||
| 980 | Ga0495662_0013125 | |||
| 981 | Ga0495662_0161782 | |||
| 982 | Ga0495662_0171673 | |||
| 983 | Ga0495664_0000037 | |||
| 984 | Ga0495664_0001638 | |||
| 985 | Ga0495664_0009072 | |||
| 986 | Ga0495664_0044051 | |||
| 987 | Ga0495584_0129357 | |||
| 988 | Ga0495585_0005923 | |||
| 989 | Ga0495594_0152934 | |||
| 990 | Ga0495596_0003678 | |||
| 991 | Ga0495607_0040877 | |||
| 992 | Ga0495583_0002702 | |||
| 993 | Ga0495583_0008290 | |||
| 994 | Ga0495606_0000048 | |||
| 995 | Ga0495606_0001916 | |||
| 996 | Ga0495606_0029193 | |||
| 997 | Ga0495606_0048597 | |||
| 998 | Ga0495606_0124527 | |||
| 999 | Ga0495606_0141797 | |||
| 1000 | Ga0495606_0148720 | |||
| 1001 | Ga0495606_0242562 | |||
| 1002 | Ga0495606_0291649 | |||
| 1003 | Ga0495608_0072460 | |||
| 1004 | Ga0495608_0107160 | |||
| 1005 | Ga0495610_0002900 | |||
| 1006 | Ga0495618_0015491 | |||
| 1007 | Ga0495618_0070084 | |||
| 1008 | Ga0495618_0134741 | |||
| 1009 | Ga0495628_0007659 | |||
| 1010 | Ga0495628_0011864 | |||
| 1011 | Ga0495628_0085018 | |||
| 1012 | Ga0495628_0091074 | |||
| 1013 | Ga0495628_0144548 | |||
| 1014 | Ga0495628_0341787 | |||
| 1015 | Ga0495630_0008007 | |||
| 1016 | Ga0495630_0009248 | |||
| 1017 | Ga0495630_0020044 | |||
| 1018 | Ga0495630_0024525 | |||
| 1019 | Ga0495630_0043721 | |||
| 1020 | Ga0495643_0098364 | |||
| 1021 | Ga0495644_0029156 | |||
| 1022 | Ga0495648_0004350 | |||
| 1023 | Ga0495648_0015798 | |||
| 1024 | Ga0495648_0077574 | |||
| 1025 | Ga0495648_0160135 | |||
| 1026 | Ga0495666_0001133 | |||
| 1027 | Ga0495666_0007812 | |||
| 1028 | Ga0495666_0069458 | |||
| 1029 | Ga0495666_0083078 | |||
| 1030 | Ga0495642_0014286 | |||
| 1031 | Ga0495652_0035956 | |||
| 1032 | Ga0495652_0040238 | |||
| 1033 | Ga0495652_0113708 | |||
| 1034 | Ga0495652_0134159 | |||
| 1035 | Ga0495652_0165455 | |||
| 1036 | Ga0495654_0004264 | |||
| 1037 | Ga0495665_0000627 | |||
| 1038 | Ga0495665_0004869 | |||
| 1039 | Ga0495665_0012822 | |||
| 1040 | Ga0495665_0023929 | |||
| 1041 | Ga0495640_0002615 | |||
| 1042 | Ga0495640_0076010 | |||
| 1043 | Ga0495640_0222803 | |||
| 1044 | Ga0495586_0005674 | |||
| 1045 | Ga0495586_0066157 | |||
| 1046 | Ga0495586_0214280 | |||
| 1047 | Ga0495587_0002254 | |||
| 1048 | Ga0495609_0002061 | |||
| 1049 | Ga0495597_0023395 | |||
| 1050 | Ga0495597_0104168 | |||
| 1051 | Ga0495645_0009157 | |||
| 1052 | Ga0495645_0026898 | |||
| 1053 | Ga0495645_0141132 | |||
| 1054 | Ga0495645_0184160 | |||
| 1055 | Ga0495622_0000190 | |||
| 1056 | Ga0495622_0144102 | |||
| 1057 | Ga0495633_0078550 | |||
| 1058 | Ga0495668_0001210 | |||
| 1059 | Ga0495634_0050780 | |||
| 1060 | Ga0495634_0271729 | |||
| 1061 | Ga0495611_0039435 | |||
| 1062 | Ga0495625_0026873 | |||
| 1063 | Ga0495625_0079286 | |||
| 1064 | Ga0495635_0027251 | |||
| 1065 | Ga0495635_0032464 | |||
| 1066 | Ga0495635_0036555 | |||
| 1067 | Ga0495635_0114327 | |||
| 1068 | Ga0495661_0001085 | |||
| 1069 | Ga0495661_0008422 | |||
| 1070 | Ga0495661_0012262 | |||
| 1071 | Ga0495588_0036956 | |||
| 1072 | Ga0495588_0218878 | |||
| 1073 | Ga0495657_0059546 | |||
| 1074 | Ga0495599_0025715 | |||
| 1075 | Ga0495599_0034888 | |||
| 1076 | Ga0495599_0037140 | |||
| 1077 | Ga0495599_0211291 | |||
| 1078 | Ga0495599_0290785 | |||
| 1079 | Ga0495623_0008586 | |||
| 1080 | Ga0495623_0012430 | |||
| 1081 | Ga0495623_0073663 | |||
| 1082 | Ga0495646_0000964 | |||
| 1083 | Ga0495646_0004030 | |||
| 1084 | Ga0495646_0032040 | |||
| 1085 | Ga0495646_0088903 | |||
| 1086 | Ga0495646_0204087 | |||
| 1087 | Ga0495646_0356025 | |||
| 1088 | Ga0495669_0110993 | |||
| 1089 | Ga0495613_0006326 | |||
| 1090 | Ga0495613_0023271 | |||
| 1091 | Ga0495624_0023620 | |||
| 1092 | Ga0495624_0087956 | |||
| 1093 | Ga0495624_0104436 | |||
| 1094 | Ga0495624_0343081 | |||
| 1095 | Ga0495671_0130104 | |||
| 1096 | Ga0495649_0129032 | |||
| 1097 | Ga0495649_0261768 | |||
| 1098 | Ga0495649_0275613 | |||
| 1099 | Ga0495589_0001627 | |||
| 1100 | Ga0495589_0054384 | |||
| 1101 | Ga0495589_0125580 | |||
| 1102 | Ga0495600_0018398 | |||
| 1103 | Ga0495600_0026670 | |||
| 1104 | Ga0495600_0370792 | |||
| 1105 | Ga0495660_0002949 | |||
| 1106 | Ga0495660_0040832 | |||
| 1107 | Ga0495660_0240522 | |||
| 1108 | Ga0495581_0003064 | |||
| 1109 | Ga0495581_0080258 | |||
| 1110 | Ga0495581_0084929 | |||
| 1111 | Ga0495604_0025505 | |||
| 1112 | Ga0495604_0083289 | |||
| 1113 | Ga0495604_0155065 | |||
| 1114 | Ga0495674_0004711 | |||
| 1115 | Ga0495674_0005533 | |||
| 1116 | Ga0495674_0025521 | |||
| 1117 | Ga0495674_0091647 | |||
| 1118 | Ga0495674_0459986 | |||
| 1119 | Ga0495672_0037013 | |||
| 1120 | Ga0495672_0046511 | |||
| 1121 | Ga0495676_0005402 | |||
| 1122 | Ga0495676_0037460 | |||
| 1123 | Ga0495676_0113346 | |||
| 1124 | Ga0495676_0373948 | |||
| 1125 | Ga0495680_0001059 | |||
| 1126 | Ga0495680_0022923 | |||
| 1127 | Ga0495680_0051099 | |||
| 1128 | Ga0495680_0080600 | |||
| 1129 | Ga0495680_0104145 | |||
| 1130 | Ga0495683_0005028 | |||
| 1131 | Ga0495683_0005067 | |||
| 1132 | Ga0495683_0019110 | |||
| 1133 | Ga0495683_0025164 | |||
| 1134 | Ga0495683_0035414 | |||
| 1135 | Ga0495683_0048986 | |||
| 1136 | Ga0495687_033403 | |||
| 1137 | Ga0495687_037834 | |||
| 1138 | Ga0495675_0014442 | |||
| 1139 | Ga0495675_0016656 | |||
| 1140 | Ga0495675_0079572 | |||
| 1141 | Ga0495679_000038 | |||
| 1142 | Ga0495679_000990 | |||
| 1143 | Ga0495679_001096 | |||
| 1144 | Ga0495679_101651 | |||
| 1145 | Ga0495673_0000098 | |||
| 1146 | Ga0495673_0007845 | |||
| 1147 | Ga0495673_0039163 | |||
| 1148 | Ga0495681_0007634 | |||
| 1149 | Ga0495684_0031732 | |||
| 1150 | Ga0495684_0248974 | |||
| 1151 | Ga0495686_0037158 | |||
| 1152 | Ga0495593_0001558 | |||
| 1153 | Ga0495593_0005158 | |||
| 1154 | Ga0495593_0007154 | |||
| 1155 | Ga0495593_0023225 | |||
| 1156 | Ga0495593_0092841 | |||
| 1157 | Ga0495593_0156070 | |||
| 1158 | Ga0495602_0018601 | |||
| 1159 | Ga0495602_0024213 | |||
| 1160 | Ga0495602_0029041 | |||
| 1161 | Ga0495602_0112711 | |||
| 1162 | Ga0495602_0254188 | |||
| 1163 | Ga0495602_0361114 | |||
| 1164 | Ga0495614_0003398 | |||
| 1165 | Ga0495614_0005862 | |||
| 1166 | Ga0495614_0057547 | |||
| 1167 | Ga0495614_0058640 | |||
| 1168 | Ga0495626_0019139 | |||
| 1169 | Ga0496100_0002473 | |||
| 1170 | Ga0496100_0003752 | |||
| 1171 | Ga0496100_0028796 | |||
| 1172 | Ga0496100_0136002 | |||
| 1173 | Ga0496101_0001448 | |||
| 1174 | Ga0496101_0036182 | |||
| 1175 | Ga0496101_0041601 | |||
| 1176 | Ga0496102_0003516 | |||
| 1177 | Ga0496102_0004637 | |||
| 1178 | Ga0496102_0049400 | |||
| 1179 | Ga0496102_0204784 | |||
| 1180 | Ga0496102_0656200 | |||
| 1181 | Ga0496103_0002086 | |||
| 1182 | Ga0496103_0002298 | |||
| 1183 | Ga0496103_0005467 | |||
| 1184 | Ga0496103_0015875 | |||
| 1185 | Ga0496103_0066234 | |||
| 1186 | Ga0496104_0059386 | |||
| 1187 | Ga0496104_0407738 | |||
| 1188 | Ga0496105_0087787 | |||
| 1189 | Ga0496105_0392988 | |||
| 1190 | Ga0496106_0110128 | |||
| 1191 | Ga0496107_0037568 | |||
| 1192 | Ga0496108_0227949 | |||
| 1193 | Ga0496109_0073221 | |||
| 1194 | Ga0496110_0090939 | |||
| 1195 | Ga0496111_0039631 | |||
| 1196 | Ga0496112_0021900 | |||
| 1197 | Ga0496112_0023099 | |||
| 1198 | Ga0496113_0011252 | |||
| 1199 | Ga0496113_0037435 | |||
| 1200 | Ga0496115_0057931 | |||
| 1201 | Ga0496115_0308801 | |||
| 1202 | Ga0496115_0380464 | |||
| 1203 | Ga0496115_0494218 | |||
| 1204 | Ga0496116_0012813 | |||
| 1205 | Ga0496116_0022544 | |||
| 1206 | Ga0496116_0032690 | |||
| 1207 | Ga0496116_0068010 | |||
| 1208 | Ga0496116_0161415 | |||
| 1209 | Ga0496116_0197967 | |||
| 1210 | Ga0496117_0003564 | |||
| 1211 | Ga0496117_0005225 | |||
| 1212 | Ga0496117_0010730 | |||
| 1213 | Ga0496117_0049233 | |||
| 1214 | Ga0496118_0001410 | |||
| 1215 | Ga0496118_0004991 | |||
| 1216 | Ga0496118_0005234 | |||
| 1217 | Ga0496118_0026293 | |||
| 1218 | Ga0496118_0028440 | |||
| 1219 | Ga0496118_0060402 | |||
| 1220 | Ga0496119_0199273 | |||
| 1221 | Ga0496119_0252703 | |||
| 1222 | Ga0496121_0003570 | |||
| 1223 | Ga0496121_0007511 | |||
| 1224 | Ga0496121_0031530 | |||
| 1225 | Ga0496121_0047707 | |||
| 1226 | Ga0496121_0050756 | |||
| 1227 | Ga0496121_0107949 | |||
| 1228 | Ga0496121_0110782 | |||
| 1229 | Ga0496122_0012927 | |||
| 1230 | Ga0496122_0275011 | |||
| 1231 | Ga0496123_0009874 | |||
| 1232 | Ga0496124_0010905 | |||
| 1233 | Ga0496124_0099208 | |||
| 1234 | Ga0496124_0427593 | |||
| 1235 | Ga0496126_0000706 | |||
| 1236 | Ga0496126_0001223 | |||
| 1237 | Ga0496126_0006478 | |||
| 1238 | Ga0496126_0009208 | |||
| 1239 | Ga0496126_0028853 | |||
| 1240 | Ga0496126_0420893 | |||
| 1241 | Ga0495678_000001 | |||
| 1242 | Ga0495678_008322 | |||
| 1243 | Ga0495682_0022703 | |||
| 1244 | Ga0501031_0181958 | |||
| 1245 | Ga0501032_0191219 | |||
| 1246 | Ga0501033_0018316 | |||
| 1247 | Ga0501036_0005955 | |||
| 1248 | Ga0501036_0280946 | |||
| 1249 | Ga0501037_0048639 | |||
| 1250 | Ga0501038_0012767 | |||
| 1251 | Ga0501038_0013159 | |||
| 1252 | Ga0501039_0003471 | |||
| 1253 | Ga0501039_0044990 | |||
| 1254 | Ga0501040_0005113 | |||
| 1255 | Ga0501040_0005312 | |||
| 1256 | Ga0501041_0005447 | |||
| 1257 | Ga0501041_0005640 | |||
| 1258 | Ga0501042_0014805 | |||
| 1259 | Ga0501042_0028904 | |||
| 1260 | Ga0501043_0018050 | |||
| 1261 | Ga0501046_0027896 | |||
| 1262 | Ga0501046_0118499 | |||
| 1263 | Ga0501048_0021988 | |||
| 1264 | Ga0501068_0021663 | |||
| 1265 | Ga0501070_0606313 | |||
| 1266 | Ga0501071_0000534 | |||
| 1267 | Ga0501072_0008540 | |||
| 1268 | Ga0501072_0014970 | |||
| 1269 | Ga0501072_0907148 | |||
| 1270 | Ga0501074_0018563 | |||
| 1271 | Ga0501074_0351210 | |||
| 1272 | Ga0501075_0011006 | |||
| 1273 | Ga0501077_0010411 | |||
| 1274 | Ga0501077_0461535 | |||
| 1275 | Ga0501079_0012238 | |||
| 1276 | Ga0501079_0121604 | |||
| 1277 | Ga0501080_0033258 | |||
| 1278 | Ga0501080_0034682 | |||
| 1279 | Ga0501081_0004723 | |||
| 1280 | Ga0501269_000145 | |||
| 1281 | Ga0501035_0035238 | |||
| 1282 | Ga0501035_0102065 | |||
| 1283 | Ga0501044_0307450 | |||
| 1284 | Ga0501045_0015934 | |||
| 1285 | Ga0501045_0067242 | |||
| 1286 | nmdc:mga03683_8147_c1 | |||
| 1287 | Ga0495655_0022673 | |||
| 1288 | Ga0500586_002407 | |||
| 1289 | Ga0500634_0016878 | |||
| 1290 | Ga0500637_0041092 | |||
| 1291 | Ga0500596_020735 | |||
| 1292 | Ga0501084_0023931 | |||
| 1293 | Ga0501084_0027073 | |||
| 1294 | Ga0501082_0009269 | |||
| 1295 | Ga0501082_0020664 | |||
| 1296 | Ga0466962_0000472 | |||
| 1297 | Ga0466962_0001486 | |||
| 1298 | Ga0466962_0020544 | |||
| 1299 | Ga0466962_0022583 | |||
| 1300 | Ga0530510_0016081 | |||
| 1301 | 2509131436 | |||
| 1302 | 2510251845 | |||
| 1303 | 2512345187 | |||
| 1304 | 2513961414 | |||
| 1305 | 2514053370 | |||
| 1306 | 2515684277 | |||
| 1307 | 2515691573 | |||
| 1308 | 2519458207 | |||
| 1309 | 2527080696 | |||
| 1310 | 2563059275 | |||
| 1311 | 2585294739 | |||
| 1312 | 2599738069 | |||
| 1313 | 2599742559 | |||
| 1314 | 2600204677 | |||
| 1315 | 2600810865 | |||
| 1316 | 2676741663 | |||
| 1317 | 2713479791 | |||
| 1318 | 2719640956 | |||
| 1319 | 2738819034 | |||
| 1320 | 2738827303 | |||
| 1321 | 2738830810 | |||
| 1322 | 2738872337 | |||
| 1323 | 2739151100 | |||
| 1324 | 2739183967 | |||
| 1325 | 2739193019 | |||
| 1326 | 2739218937 | |||
| 1327 | 2739319496 | |||
| 1328 | 2739337737 | |||
| 1329 | 2746088216 | |||
| 1330 | 2746096890 | |||
| 1331 | 2753567671 | |||
| 1332 | 2792839740 | |||
| 1333 | 2808969976 | |||
| 1334 | 2809005177 | |||
| 1335 | 2809011682 | |||
| 1336 | 2817260359 | |||
| 1337 | 2817278047 | |||
| 1338 | 2817455614 | |||
| 1339 | 2819623531 | |||
| 1340 | 2819632885 | |||
| 1341 | 2842325049 | |||
| 1342 | 2842349327 | |||
| 1343 | 2842459930 | |||
| 1344 | 2857557892 | |||
| 1345 | 2863421896 | |||
| 1346 | 2870072162 | |||
| 1347 | 2885271045 | |||
| 1348 | 2900637773 | |||
| 1349 | 2902687367 | |||
| 1350 | 2904430009 | |||
| 1351 | 2904487447 | |||
| 1352 | 2904566061 | |||
| 1353 | 2904573105 | |||
| 1354 | 2904623594 | |||
| 1355 | 2919479597 | |||
| 1356 | 2919528754 | |||
| 1357 | 2921653457 | |||
| 1358 | 2928110882 | |||
| 1359 | 2928137560 | |||
| 1360 | 2928159523 | |||
| 1361 | 2928164417 | |||
| 1362 | 2928177599 | |||
| 1363 | 2928505733 | |||
| 1364 | 2928538373 | |||
| 1365 | 2945937715 | |||
| 1366 | 2981993957 | |||
| 1367 | 2990705567 | |||
| 1368 | 642417926 | |||
| 1369 | 642592541 | |||
| 1370 | 642622543 | |||
| 1371 | 8018850330 | |||
| 1372 | 8020808888 | |||
| 1373 | 8020947266 | |||
| 1374 | 8021122792 | |||
| 1375 | 8039102728 | |||
| 1376 | 8040169339 | |||
| 1377 | 8040174958 | |||
| 1378 | 8055226985 | |||
| 1379 | 8055267000 | |||
| 1380 | 8055301685 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ktg-assembly2.cif.gz_B | crystal structure of a c. elegans ap4a hydrolase binary complex | 0.8532 | 63 | 178 |
| 5cfi-assembly4.cif.gz_D | structural and functional attributes of malaria parasite ap4a hydrolase | 0.848 | 61 | 171 |
| 5qgk-assembly1.cif.gz_A | pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt7 in complex with fmopl000679a | 0.8391 | 57 | 237 |
| 6uuf-assembly1.cif.gz_A | crystal structure of a nudix hydrolase from m. smegmatis, renu | 0.8379 | 60 | 171 |
| 3cng-assembly1.cif.gz_B | crystal structure of nudix hydrolase from nitrosomonas europaea | 0.8274 | 57 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P43337_8_187_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.917 | 31 | 233 | 3.90.79.10 |
| af_A0A1D8PU14_38_158_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8978 | 64 | 151 | 3.90.79.10 |
| af_P43337_8_187_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8977 | 31 | 233 | 3.90.79.10 |
| af_E7FAS2_11_192_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8593 | 55 | 233 | 3.90.79.10 |
| 5cfiD00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.848 | 61 | 171 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W0VA56-F1-model_v4 | NUDIX domain protein | 0.9799 | 68 | 238 |
GO:0010945
|
| AF-C4KS39-F1-model_v4 | deleted | 0.9749 | 4 | 238 |
|
| AF-Q2SXZ7-F1-model_v4 | Pyrophosphatase, MutT/nudix family | 0.9713 | 3 | 238 |
GO:0010945
|
| AF-Q3JQ11-F1-model_v4 | Pyrophosphatase, MutT/nudix family | 0.971 | 3 | 238 |
GO:0010945
|
| AF-A0A537RS48-F1-model_v4 | CoA pyrophosphatase | 0.971 | 58 | 233 |
GO:0010945
|