F475476

General Info

Members Datasets Scaffolds Average Seq Length
690 348 1380 228

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0003149|Ga0495592_0003149_4876_5655
Length 259
Sequence VLFCLPGQNSGITATAHSRDPLIRPAFEPETLPVEATGAHLPPVHAERLTPDGLRRRFKQHLCWTPEPIVETPWRNTQGDPRVASVLVPLVIRANGLTVLLTQRADHLNDHAGQVSFPGGRQEPFDADATATALREAQEEVGLAPSRVEVLGALPDYLTGTGFRVTPVIGLVHPPFALKADALEVAEVFEVPLAFLMNPAHHEERVFRYEGGERRFFAMPYPRGASLEAAERDDGTGSHYFIWGATAAMLRNFYRFLTA

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
263 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
264 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
270 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
271 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
272 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
273 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
274 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
275 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
276 2519103095 Burkholderia sp. KJ006 Isolate Nodule
277 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
278 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
279 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
280 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
281 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
282 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
283 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
284 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
285 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
286 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
287 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
288 2738541297 Duganella sp. GV083 Isolate Unclassified
289 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
290 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
291 2738541357 Duganella sp. GV053 Isolate Unclassified
292 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
293 2738543003 Duganella sp. GV066 Isolate Unclassified
294 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
295 2738543026 Duganella sp. GV089 Isolate Unclassified
296 2738543029 Duganella sp. GV039 Isolate Unclassified
297 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
298 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
299 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
300 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
301 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
302 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
303 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
304 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
305 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
306 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
307 2818991450 Burkholderia sp. 604 Isolate Unclassified
308 2818991452 Burkholderia cepacia 561 Isolate Unclassified
309 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
310 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
311 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
312 2857553236 Duganella sp. R-74557 Isolate Unclassified
313 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
314 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
315 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
316 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
317 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
318 2904424332 Duganella sp. 1411 Isolate Rhizosphere
319 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
320 2904564687 Burkholderia sp. 571 Isolate Unclassified
321 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
322 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
323 2919476304 Duganella sp. 3397 Isolate Unclassified
324 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
325 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
326 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
327 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
328 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
329 2928163908 Burkholderia sp. 567 Isolate Unclassified
330 2928170801 Burkholderia sp. 572 Isolate Unclassified
331 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
332 2928536128 Burkholderia sola 565 Isolate Unclassified
333 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
334 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
335 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
336 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
337 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
338 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
339 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
340 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
341 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
342 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
343 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
344 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
345 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
346 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
347 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
348 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 0.14
Isolates 11.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 2.75
Rhizoplane 5.65
Rhizosphere 70.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0003149 3300046454 Bacteria 11804
2 JGI24740J21852_10000321 3300001979 Bacteria 20355
3 JGI24739J22299_10005570 3300001989 Bacteria 4775
4 JGI24739J22299_10007598 3300001989 Bacteria 4061
5 JGI24739J22299_10024097 3300001989 Bacteria 2148
6 JGI24739J22299_10028840 3300001989 Bacteria 1933
7 JGI24737J22298_10022298 3300001990 Bacteria 2013
8 JGI24735J21928_10000211 3300002067 Bacteria 20387
9 JGI24735J21928_10001050 3300002067 Bacteria 9898
10 JGI24735J21928_10005467 3300002067 Bacteria 4213
11 JGI24738J21930_10001905 3300002075 Bacteria 5634
12 JGI25156J39149_1001121 3300002705 Bacteria 12125
13 JGI25156J39149_1010495 3300002705 Bacteria 2173
14 JGI25154J39366_1000558 3300002738 Bacteria 18325
15 JGI25165J46597_1002871 3300003214 Bacteria 4913
16 rootL2_10033819 3300003322 Bacteria 11237
17 rootH1_10169913 3300003323 Bacteria 1354
18 JGI25160J50197_1000818 3300003354 Bacteria 16694
19 Ga0055533_1000618 3300003756 Bacteria 11994
20 Ga0055533_1009008 3300003756 Bacteria 1216
21 Ga0055532_1000039 3300003758 Bacteria 198049
22 Ga0055532_1002103 3300003758 Bacteria 4520
23 Ga0055532_1002180 3300003758 Bacteria 4339
24 Ga0055527_1000024 3300003760 Bacteria 198049
25 Ga0055527_1000493 3300003760 Bacteria 14159
26 Ga0055527_1000532 3300003760 Bacteria 12837
27 Ga0055535_1000028 3300003761 Bacteria 198049
28 Ga0055535_1001248 3300003761 Bacteria 14159
29 Ga0055535_1001362 3300003761 Bacteria 12837
30 Ga0055542_1000047 3300003762 Bacteria 198049
31 Ga0055542_1001239 3300003762 Bacteria 14176
32 Ga0055542_1004506 3300003762 Bacteria 3363
33 Ga0055529_1000054 3300003763 Bacteria 198049
34 Ga0055529_1000492 3300003763 Bacteria 36023
35 Ga0055526_1000709 3300003771 Bacteria 25255
36 Ga0055528_1001475 3300003790 Bacteria 14296
37 Ga0065165_1002547 3300005262 Bacteria 15111
38 Ga0070658_10001863 3300005327 Bacteria 17769
39 Ga0070658_10004277 3300005327 Bacteria 11668
40 Ga0070666_10279696 3300005335 Bacteria 1186
41 Ga0070660_100000016 3300005339 Bacteria 102648
42 Ga0070661_100102233 3300005344 Bacteria 2133
43 Ga0070659_100000014 3300005366 Bacteria 178272
44 Ga0070659_100138694 3300005366 Bacteria 1979
45 Ga0070663_100002147 3300005455 Bacteria 11030
46 Ga0070663_100347671 3300005455 Bacteria 1200
47 Ga0070684_100379518 3300005535 Bacteria 1302
48 Ga0070665_100016567 3300005548 Bacteria 7389
49 Ga0068855_100002126 3300005563 Bacteria 24515
50 Ga0068855_100011135 3300005563 Bacteria 10858
51 Ga0068855_100155534 3300005563 Bacteria 2598
52 Ga0068855_100183129 3300005563 Bacteria 2367
53 Ga0068856_101238293 3300005614 Bacteria 762
54 Ga0068858_100043018 3300005842 Bacteria 4189
55 Ga0075363_100083055 3300006048 Bacteria 1755
56 Ga0075362_10005404 3300006177 Bacteria 4672
57 Ga0079104_1025720 3300006946 Bacteria 1532
58 Ga0105251_10001940 3300009011 Bacteria 16937
59 Ga0105251_10098430 3300009011 Bacteria 1338
60 Ga0105251_10117292 3300009011 Bacteria 1210
61 Ga0105244_10001408 3300009036 Bacteria 19468
62 Ga0105240_10005681 3300009093 Bacteria 18515
63 Ga0105240_10024403 3300009093 Bacteria 7969
64 Ga0105240_10031037 3300009093 Bacteria 6935
65 Ga0105240_10036958 3300009093 Bacteria 6277
66 Ga0105240_10038727 3300009093 Bacteria 6113
67 Ga0105240_10091007 3300009093 Bacteria 3728
68 Ga0105240_10103481 3300009093 Bacteria 3459
69 Ga0105240_10487230 3300009093 Bacteria 1373
70 Ga0105247_10050555 3300009101 Bacteria 2558
71 Ga0105241_10091472 3300009174 Bacteria 2400
72 Ga0105248_10451790 3300009177 Bacteria 1448
73 Ga0105237_10064356 3300009545 Bacteria 3663
74 Ga0105237_10867525 3300009545 Bacteria 909
75 Ga0105238_10004083 3300009551 Bacteria 14482
76 Ga0105238_10105936 3300009551 Bacteria 2793
77 Ga0105238_11091045 3300009551 Bacteria 821
78 Ga0105239_10006046 3300010375 Bacteria 14090
79 Ga0105239_10167743 3300010375 Bacteria 2455
80 Ga0105239_10327341 3300010375 Bacteria 1728
81 Ga0157373_10090002 3300013100 Bacteria 2161
82 Ga0157371_10004966 3300013102 Bacteria 11423
83 Ga0157370_10071414 3300013104 Bacteria 3275
84 Ga0157370_10330826 3300013104 Bacteria 1405
85 Ga0157370_10798941 3300013104 Bacteria 859
86 Ga0157369_10000820 3300013105 Bacteria 39707
87 Ga0157369_10001117 3300013105 Bacteria 33543
88 Ga0157369_10058799 3300013105 Bacteria 4146
89 Ga0157369_10149955 3300013105 Bacteria 2464
90 Ga0157369_10531280 3300013105 Bacteria 1216
91 Ga0157374_10060594 3300013296 Bacteria 3542
92 Ga0157374_10482756 3300013296 Bacteria 1242
93 Ga0157372_10665335 3300013307 Bacteria 1212
94 Ga0163163_10208473 3300014325 Bacteria 2003
95 Ga0182008_10153551 3300014497 Bacteria 1156
96 Ga0157376_10738959 3300014969 Bacteria 992
97 Ga0182006_1000211 3300015261 Bacteria 57444
98 Ga0182006_1005017 3300015261 Bacteria 6372
99 Ga0182006_1012863 3300015261 Bacteria 3651
100 Ga0182007_10002694 3300015262 Bacteria 8686
101 Ga0182007_10049519 3300015262 Bacteria 1388
102 Ga0182005_1000005 3300015265 Bacteria 537378
103 Ga0182005_1007213 3300015265 Bacteria 3346
104 Ga0224712_10000963 3300022467 Bacteria 6241
105 Ga0209566_100680 3300025225 Bacteria 20034
106 Ga0209674_100013 3300025226 Bacteria 813140
107 Ga0209674_100508 3300025226 Bacteria 16000
108 Ga0209674_104330 3300025226 Bacteria 2333
109 Ga0209672_100010 3300025228 Bacteria 873151
110 Ga0209672_100019 3300025228 Bacteria 432215
111 Ga0209672_100051 3300025228 Bacteria 234414
112 Ga0209147_100006 3300025229 Bacteria 873276
113 Ga0209147_100026 3300025229 Bacteria 421622
114 Ga0209147_100192 3300025229 Bacteria 70162
115 Ga0209147_100308 3300025229 Bacteria 38671
116 Ga0209563_100478 3300025230 Bacteria 13598
117 Ga0207427_100524 3300025231 Bacteria 19948
118 Ga0209258_100010 3300025242 Bacteria 873276
119 Ga0209258_100031 3300025242 Bacteria 463572
120 Ga0209258_100358 3300025242 Bacteria 61852
121 Ga0207425_1000766 3300025245 Bacteria 16595
122 Ga0209646_1000036 3300025246 Bacteria 358864
123 Ga0209148_1000018 3300025254 Bacteria 756247
124 Ga0209148_1000027 3300025254 Bacteria 616374
125 Ga0209148_1000400 3300025254 Bacteria 50569
126 Ga0209148_1001772 3300025254 Bacteria 9278
127 Ga0209759_1000147 3300025256 Bacteria 121320
128 Ga0209759_1000160 3300025256 Bacteria 116290
129 Ga0209759_1000617 3300025256 Bacteria 34037
130 Ga0209759_1000830 3300025256 Bacteria 24405
131 Ga0209233_1000135 3300025261 Bacteria 201057
132 Ga0209455_1000015 3300025272 Bacteria 756128
133 Ga0209455_1000213 3300025272 Bacteria 82040
134 Ga0209673_1000201 3300025273 Bacteria 120059
135 Ga0209130_1006747 3300025284 Bacteria 3670
136 Ga0209025_1007282 3300025294 Bacteria 8301
137 Ga0209564_1000032 3300025295 Bacteria 464041
138 Ga0209564_1000348 3300025295 Bacteria 86984
139 Ga0209564_1002172 3300025295 Bacteria 16506
140 Ga0209564_1005720 3300025295 Bacteria 6961
141 Ga0209758_1000340 3300025297 Bacteria 86646
142 Ga0207426_1000183 3300025302 Bacteria 154449
143 Ga0207655_1010294 3300025728 Bacteria 5679
144 Ga0207713_1001524 3300025735 Bacteria 18242
145 Ga0207647_10001598 3300025904 Bacteria 17402
146 Ga0207647_10018062 3300025904 Bacteria 4780
147 Ga0207647_10021133 3300025904 Bacteria 4349
148 Ga0207705_10000706 3300025909 Bacteria 27583
149 Ga0207707_10078643 3300025912 Bacteria 2880
150 Ga0207695_10002638 3300025913 Bacteria 26228
151 Ga0207695_10003550 3300025913 Bacteria 21855
152 Ga0207695_10004451 3300025913 Bacteria 19092
153 Ga0207695_10058334 3300025913 Bacteria 4007
154 Ga0207695_10119524 3300025913 Bacteria 2605
155 Ga0207671_10008552 3300025914 Bacteria 8659
156 Ga0207671_10132068 3300025914 Bacteria 1917
157 Ga0207657_10000001 3300025919 Bacteria 458536
158 Ga0207649_10328694 3300025920 Bacteria 1125
159 Ga0207694_10080147 3300025924 Bacteria 2562
160 Ga0207700_10106244 3300025928 Bacteria 2250
161 Ga0207690_10000006 3300025932 Bacteria 433880
162 Ga0207667_10001310 3300025949 Bacteria 31213
163 Ga0207667_10059722 3300025949 Bacteria 3992
164 Ga0207667_10613491 3300025949 Bacteria 1096
165 Ga0207658_10052982 3300025986 Bacteria 2996
166 Ga0207703_10029243 3300026035 Bacteria 4346
167 Ga0207703_10516054 3300026035 Bacteria 1123
168 Ga0207678_10000640 3300026067 Bacteria 32171
169 Ga0207678_10109690 3300026067 Bacteria 2354
170 Ga0207702_11138214 3300026078 Bacteria 774
171 Ga0207674_10062444 3300026116 Bacteria 3763
172 Ga0209281_1004199 3300027111 Bacteria 4388
173 Ga0209371_1000202 3300027312 Bacteria 85989
174 Ga0209371_1007990 3300027312 Bacteria 3585
175 Ga0268266_10002606 3300028379 Bacteria 19106
176 Ga0268266_10014962 3300028379 Bacteria 6661
177 Ga0268256_1000189 3300030500 Bacteria 72206
178 Ga0268256_1006535 3300030500 Bacteria 4315
179 Ga0265331_10006217 3300031250 Bacteria 7086
180 Ga0265327_10047534 3300031251 Bacteria 2263
181 Ga0307408_100006987 3300031548 Bacteria 7469
182 Ga0307405_10030128 3300031731 Bacteria 3179
183 Ga0307412_10000008 3300031911 Bacteria 461034
184 Ga0307416_100050490 3300032002 Bacteria 3316
185 Ga0373939_0104433 3300035114 Bacteria 977
186 Ga0395900_0001172 3300037418 Bacteria 32710
187 Ga0395900_0539860 3300037418 Bacteria 1112
188 Ga0395898_0001373 3300037466 Bacteria 34999
189 Ga0395898_0143474 3300037466 Bacteria 2286
190 Ga0395905_0033181 3300037471 Bacteria 4850
191 Ga0395901_0000011 3300038443 Bacteria 400724
192 Ga0395901_0000264 3300038443 Bacteria 65306
193 Ga0436365_0124429 3300039437 Bacteria 2257
194 Ga0466969_0004678 3300044656 Bacteria 7291
195 Ga0466969_0005458 3300044656 Bacteria 6763
196 Ga0466969_0013814 3300044656 Bacteria 4251
197 Ga0466969_0084527 3300044656 Bacteria 1510
198 Ga0466980_0240838 3300044668 Bacteria 1130
199 Ga0466965_0000606 3300044683 Bacteria 13073
200 Ga0466965_0001401 3300044683 Bacteria 9706
201 Ga0466966_0000066 3300044684 Bacteria 69299
202 Ga0466966_0000227 3300044684 Bacteria 37516
203 Ga0466966_0006963 3300044684 Bacteria 7485
204 Ga0466966_0089831 3300044684 Bacteria 1908
205 Ga0466961_0000037 3300044693 Bacteria 80759
206 Ga0466961_0001393 3300044693 Bacteria 14971
207 Ga0466961_0002686 3300044693 Bacteria 11035
208 Ga0466961_0004562 3300044693 Bacteria 8687
209 Ga0466961_0016531 3300044693 Bacteria 4740
210 Ga0466961_0025387 3300044693 Bacteria 3810
211 Ga0466963_0002315 3300044694 Bacteria 10606
212 Ga0466963_0003459 3300044694 Bacteria 9046
213 Ga0466963_0015198 3300044694 Bacteria 4761
214 Ga0466963_0203010 3300044694 Bacteria 1387
215 Ga0466964_0006690 3300044706 Bacteria 4297
216 Ga0466964_0017023 3300044706 Bacteria 2780
217 Ga0466971_0000253 3300044719 Bacteria 20381
218 Ga0466971_0001402 3300044719 Bacteria 10119
219 Ga0466971_0008797 3300044719 Bacteria 4406
220 Ga0466971_0026634 3300044719 Bacteria 2585
221 Ga0466968_0090169 3300044735 Bacteria 1357
222 Ga0466970_0000417 3300044765 Bacteria 20826
223 Ga0466970_0001726 3300044765 Bacteria 10528
224 Ga0466970_0028923 3300044765 Bacteria 2915
225 Ga0466970_0240916 3300044765 Bacteria 1012
226 Ga0466970_0302820 3300044765 Bacteria 902
227 Ga0466957_0003013 3300044842 Bacteria 9146
228 Ga0466957_0009195 3300044842 Bacteria 5638
229 Ga0466957_0009985 3300044842 Bacteria 5432
230 Ga0466957_0121737 3300044842 Bacteria 1664
231 Ga0466957_0273899 3300044842 Bacteria 1128
232 Ga0466959_0001227 3300045049 Bacteria 15480
233 Ga0466959_0004990 3300045049 Bacteria 9003
234 Ga0466959_0011060 3300045049 Bacteria 6476
235 Ga0466959_0020718 3300045049 Bacteria 4845
236 Ga0466959_0023700 3300045049 Bacteria 4542
237 Ga0466959_0062796 3300045049 Bacteria 2699
238 Ga0466959_0419504 3300045049 Bacteria 908
239 Ga0451576_0265453 3300045051 Bacteria 1794
240 Ga0466958_0000736 3300045836 Bacteria 14318
241 Ga0466958_0006656 3300045836 Bacteria 6302
242 Ga0466958_0007917 3300045836 Bacteria 5873
243 Ga0466958_0369004 3300045836 Bacteria 925
244 Ga0495617_000005 3300046452 Bacteria 404687
245 Ga0495627_000033 3300046453 Bacteria 220621
246 Ga0495592_0030564 3300046454 Bacteria 4074
247 Ga0495592_0123576 3300046454 Bacteria 1818
248 Ga0495603_0001415 3300046455 Bacteria 13954
249 Ga0495603_0003952 3300046455 Bacteria 8830
250 Ga0495603_0068454 3300046455 Bacteria 2089
251 Ga0495603_0221202 3300046455 Bacteria 1092
252 Ga0495590_0004876 3300046457 Bacteria 5364
253 Ga0495590_0071581 3300046457 Bacteria 1217
254 Ga0495591_001984 3300046458 Bacteria 11948
255 Ga0495629_0000060 3300046459 Bacteria 100921
256 Ga0495629_0002826 3300046459 Bacteria 13260
257 Ga0495629_0005449 3300046459 Bacteria 9489
258 Ga0495629_0069072 3300046459 Bacteria 2465
259 Ga0495638_0017801 3300046460 Bacteria 4730
260 Ga0495641_0011078 3300046461 Bacteria 5164
261 Ga0495641_0080589 3300046461 Bacteria 1458
262 Ga0495651_0001821 3300046462 Bacteria 16457
263 Ga0495651_0050510 3300046462 Bacteria 3208
264 Ga0495651_0121796 3300046462 Bacteria 1915
265 Ga0495653_0000008 3300046463 Bacteria 307868
266 Ga0495653_0001720 3300046463 Bacteria 17247
267 Ga0495653_0011779 3300046463 Bacteria 7142
268 Ga0495653_0037633 3300046463 Bacteria 3799
269 Ga0495653_0043338 3300046463 Bacteria 3498
270 Ga0495653_0252990 3300046463 Bacteria 1168
271 Ga0495653_0277940 3300046463 Bacteria 1100
272 Ga0495653_0297524 3300046463 Bacteria 1053
273 Ga0495650_0000365 3300046471 Bacteria 79708
274 Ga0495650_0018902 3300046471 Bacteria 3411
275 Ga0495650_0045722 3300046471 Bacteria 1841
276 Ga0495650_0107555 3300046471 Bacteria 1039
277 Ga0495580_0000291 3300046472 Bacteria 40835
278 Ga0495580_0000728 3300046472 Bacteria 28205
279 Ga0495580_0001191 3300046472 Bacteria 22906
280 Ga0495580_0002463 3300046472 Bacteria 16164
281 Ga0495580_0009416 3300046472 Bacteria 7684
282 Ga0495580_0031609 3300046472 Bacteria 3823
283 Ga0495580_0049554 3300046472 Bacteria 2972
284 Ga0495580_0535047 3300046472 Bacteria 779
285 Ga0495580_0563473 3300046472 Bacteria 755
286 Ga0495582_0007338 3300046473 Bacteria 6108
287 Ga0495582_0015768 3300046473 Bacteria 4144
288 Ga0495605_0000082 3300046474 Bacteria 125136
289 Ga0495605_0013666 3300046474 Bacteria 4463
290 Ga0495662_0013125 3300046476 Bacteria 4035
291 Ga0495662_0161782 3300046476 Bacteria 1103
292 Ga0495662_0171673 3300046476 Bacteria 1068
293 Ga0495664_0000037 3300046477 Bacteria 70108
294 Ga0495664_0001638 3300046477 Bacteria 11882
295 Ga0495664_0009072 3300046477 Bacteria 5560
296 Ga0495664_0044051 3300046477 Bacteria 2644
297 Ga0495584_0129357 3300046491 Bacteria 1281
298 Ga0495585_0005923 3300046492 Bacteria 7650
299 Ga0495594_0152934 3300046499 Bacteria 1310
300 Ga0495596_0003678 3300046500 Bacteria 7672
301 Ga0495607_0040877 3300046501 Bacteria 2757
302 Ga0495583_0002702 3300046506 Bacteria 14733
303 Ga0495583_0008290 3300046506 Bacteria 6371
304 Ga0495606_0000048 3300046507 Bacteria 207840
305 Ga0495606_0001916 3300046507 Bacteria 25879
306 Ga0495606_0029193 3300046507 Bacteria 3877
307 Ga0495606_0048597 3300046507 Bacteria 2788
308 Ga0495606_0124527 3300046507 Bacteria 1538
309 Ga0495606_0141797 3300046507 Bacteria 1418
310 Ga0495606_0148720 3300046507 Bacteria 1376
311 Ga0495606_0242562 3300046507 Bacteria 1004
312 Ga0495606_0291649 3300046507 Bacteria 887
313 Ga0495608_0072460 3300046511 Bacteria 2247
314 Ga0495608_0107160 3300046511 Bacteria 1798
315 Ga0495610_0002900 3300046512 Bacteria 13881
316 Ga0495618_0015491 3300046514 Bacteria 4653
317 Ga0495618_0070084 3300046514 Bacteria 2229
318 Ga0495618_0134741 3300046514 Bacteria 1580
319 Ga0495628_0007659 3300046516 Bacteria 9336
320 Ga0495628_0011864 3300046516 Bacteria 7353
321 Ga0495628_0085018 3300046516 Bacteria 2454
322 Ga0495628_0091074 3300046516 Bacteria 2360
323 Ga0495628_0144548 3300046516 Bacteria 1813
324 Ga0495628_0341787 3300046516 Bacteria 1101
325 Ga0495630_0008007 3300046517 Bacteria 7591
326 Ga0495630_0009248 3300046517 Bacteria 7084
327 Ga0495630_0020044 3300046517 Bacteria 4924
328 Ga0495630_0024525 3300046517 Bacteria 4459
329 Ga0495630_0043721 3300046517 Bacteria 3347
330 Ga0495643_0098364 3300046522 Bacteria 1502
331 Ga0495644_0029156 3300046523 Bacteria 2086
332 Ga0495648_0004350 3300046524 Bacteria 12127
333 Ga0495648_0015798 3300046524 Bacteria 5459
334 Ga0495648_0077574 3300046524 Bacteria 1903
335 Ga0495648_0160135 3300046524 Bacteria 1164
336 Ga0495666_0001133 3300046526 Bacteria 12770
337 Ga0495666_0007812 3300046526 Bacteria 5356
338 Ga0495666_0069458 3300046526 Bacteria 1676
339 Ga0495666_0083078 3300046526 Bacteria 1514
340 Ga0495642_0014286 3300046528 Bacteria 3076
341 Ga0495652_0035956 3300046529 Bacteria 4308
342 Ga0495652_0040238 3300046529 Bacteria 4039
343 Ga0495652_0113708 3300046529 Bacteria 2173
344 Ga0495652_0134159 3300046529 Bacteria 1955
345 Ga0495652_0165455 3300046529 Bacteria 1712
346 Ga0495654_0004264 3300046530 Bacteria 8544
347 Ga0495665_0000627 3300046531 Bacteria 17967
348 Ga0495665_0004869 3300046531 Bacteria 7241
349 Ga0495665_0012822 3300046531 Bacteria 4535
350 Ga0495665_0023929 3300046531 Bacteria 3281
351 Ga0495640_0002615 3300046533 Bacteria 14472
352 Ga0495640_0076010 3300046533 Bacteria 2241
353 Ga0495640_0222803 3300046533 Bacteria 1189
354 Ga0495586_0005674 3300046535 Bacteria 6675
355 Ga0495586_0066157 3300046535 Bacteria 1970
356 Ga0495586_0214280 3300046535 Bacteria 1093
357 Ga0495587_0002254 3300046536 Bacteria 12891
358 Ga0495609_0002061 3300046538 Bacteria 12653
359 Ga0495597_0023395 3300046542 Bacteria 2857
360 Ga0495597_0104168 3300046542 Bacteria 1194
361 Ga0495645_0009157 3300046543 Bacteria 6917
362 Ga0495645_0026898 3300046543 Bacteria 4178
363 Ga0495645_0141132 3300046543 Bacteria 1680
364 Ga0495645_0184160 3300046543 Bacteria 1428
365 Ga0495622_0000190 3300046557 Bacteria 49410
366 Ga0495622_0144102 3300046557 Bacteria 1080
367 Ga0495633_0078550 3300046558 Bacteria 1536
368 Ga0495668_0001210 3300046616 Bacteria 26115
369 Ga0495634_0050780 3300046642 Bacteria 2783
370 Ga0495634_0271729 3300046642 Bacteria 1031
371 Ga0495611_0039435 3300046648 Bacteria 2102
372 Ga0495625_0026873 3300046660 Bacteria 4341
373 Ga0495625_0079286 3300046660 Bacteria 2290
374 Ga0495635_0027251 3300046663 Bacteria 3975
375 Ga0495635_0032464 3300046663 Bacteria 3622
376 Ga0495635_0036555 3300046663 Bacteria 3403
377 Ga0495635_0114327 3300046663 Bacteria 1842
378 Ga0495661_0001085 3300046665 Bacteria 23930
379 Ga0495661_0008422 3300046665 Bacteria 7131
380 Ga0495661_0012262 3300046665 Bacteria 5790
381 Ga0495588_0036956 3300046674 Bacteria 2480
382 Ga0495588_0218878 3300046674 Bacteria 1005
383 Ga0495657_0059546 3300046675 Bacteria 2533
384 Ga0495599_0025715 3300046678 Bacteria 3686
385 Ga0495599_0034888 3300046678 Bacteria 3158
386 Ga0495599_0037140 3300046678 Bacteria 3060
387 Ga0495599_0211291 3300046678 Bacteria 1189
388 Ga0495599_0290785 3300046678 Bacteria 988
389 Ga0495623_0008586 3300046679 Bacteria 6633
390 Ga0495623_0012430 3300046679 Bacteria 5511
391 Ga0495623_0073663 3300046679 Bacteria 2122
392 Ga0495646_0000964 3300046680 Bacteria 16453
393 Ga0495646_0004030 3300046680 Bacteria 9207
394 Ga0495646_0032040 3300046680 Bacteria 3272
395 Ga0495646_0088903 3300046680 Bacteria 1788
396 Ga0495646_0204087 3300046680 Bacteria 1075
397 Ga0495646_0356025 3300046680 Bacteria 766
398 Ga0495669_0110993 3300046684 Bacteria 1280
399 Ga0495613_0006326 3300046689 Bacteria 8857
400 Ga0495613_0023271 3300046689 Bacteria 4615
401 Ga0495624_0023620 3300046690 Bacteria 4052
402 Ga0495624_0087956 3300046690 Bacteria 1918
403 Ga0495624_0104436 3300046690 Bacteria 1743
404 Ga0495624_0343081 3300046690 Bacteria 898
405 Ga0495671_0130104 3300046692 Bacteria 1227
406 Ga0495649_0129032 3300046694 Bacteria 1334
407 Ga0495649_0261768 3300046694 Bacteria 886
408 Ga0495649_0275613 3300046694 Bacteria 860
409 Ga0495589_0001627 3300046794 Bacteria 12881
410 Ga0495589_0054384 3300046794 Bacteria 1974
411 Ga0495589_0125580 3300046794 Bacteria 1234
412 Ga0495600_0018398 3300046809 Bacteria 4450
413 Ga0495600_0026670 3300046809 Bacteria 3730
414 Ga0495600_0370792 3300046809 Bacteria 894
415 Ga0495660_0002949 3300046810 Bacteria 10657
416 Ga0495660_0040832 3300046810 Bacteria 2570
417 Ga0495660_0240522 3300046810 Bacteria 844
418 Ga0495581_0003064 3300047315 Bacteria 9562
419 Ga0495581_0080258 3300047315 Bacteria 1888
420 Ga0495581_0084929 3300047315 Bacteria 1835
421 Ga0495604_0025505 3300047317 Bacteria 4710
422 Ga0495604_0083289 3300047317 Bacteria 2391
423 Ga0495604_0155065 3300047317 Bacteria 1623
424 Ga0495674_0004711 3300047319 Bacteria 13121
425 Ga0495674_0005533 3300047319 Bacteria 12118
426 Ga0495674_0025521 3300047319 Bacteria 5417
427 Ga0495674_0091647 3300047319 Bacteria 2595
428 Ga0495674_0459986 3300047319 Bacteria 1021
429 Ga0495672_0037013 3300047320 Bacteria 2990
430 Ga0495672_0046511 3300047320 Bacteria 2587
431 Ga0495676_0005402 3300047321 Bacteria 11710
432 Ga0495676_0037460 3300047321 Bacteria 4036
433 Ga0495676_0113346 3300047321 Bacteria 1985
434 Ga0495676_0373948 3300047321 Bacteria 949
435 Ga0495680_0001059 3300047322 Bacteria 30455
436 Ga0495680_0022923 3300047322 Bacteria 5198
437 Ga0495680_0051099 3300047322 Bacteria 3229
438 Ga0495680_0080600 3300047322 Bacteria 2459
439 Ga0495680_0104145 3300047322 Bacteria 2111
440 Ga0495683_0005028 3300047323 Bacteria 7408
441 Ga0495683_0005067 3300047323 Bacteria 7374
442 Ga0495683_0019110 3300047323 Bacteria 3537
443 Ga0495683_0025164 3300047323 Bacteria 3052
444 Ga0495683_0035414 3300047323 Bacteria 2537
445 Ga0495683_0048986 3300047323 Bacteria 2117
446 Ga0495687_033403 3300047443 Bacteria 2334
447 Ga0495687_037834 3300047443 Bacteria 2146
448 Ga0495675_0014442 3300047444 Bacteria 4989
449 Ga0495675_0016656 3300047444 Bacteria 4646
450 Ga0495675_0079572 3300047444 Bacteria 2064
451 Ga0495679_000038 3300047446 Bacteria 157311
452 Ga0495679_000990 3300047446 Bacteria 17515
453 Ga0495679_001096 3300047446 Bacteria 16376
454 Ga0495679_101651 3300047446 Bacteria 798
455 Ga0495673_0000098 3300047469 Bacteria 182002
456 Ga0495673_0007845 3300047469 Bacteria 6070
457 Ga0495673_0039163 3300047469 Bacteria 2151
458 Ga0495681_0007634 3300047470 Bacteria 6879
459 Ga0495684_0031732 3300047471 Bacteria 4058
460 Ga0495684_0248974 3300047471 Bacteria 1293
461 Ga0495686_0037158 3300047472 Bacteria 3122
462 Ga0495593_0001558 3300047673 Bacteria 13525
463 Ga0495593_0005158 3300047673 Bacteria 7721
464 Ga0495593_0007154 3300047673 Bacteria 6545
465 Ga0495593_0023225 3300047673 Bacteria 3448
466 Ga0495593_0092841 3300047673 Bacteria 1553
467 Ga0495593_0156070 3300047673 Bacteria 1153
468 Ga0495602_0018601 3300048088 Bacteria 6929
469 Ga0495602_0024213 3300048088 Bacteria 5893
470 Ga0495602_0029041 3300048088 Bacteria 5280
471 Ga0495602_0112711 3300048088 Bacteria 2206
472 Ga0495602_0254188 3300048088 Bacteria 1307
473 Ga0495602_0361114 3300048088 Bacteria 1045
474 Ga0495614_0003398 3300048089 Bacteria 7124
475 Ga0495614_0005862 3300048089 Bacteria 5534
476 Ga0495614_0057547 3300048089 Bacteria 1669
477 Ga0495614_0058640 3300048089 Bacteria 1653
478 Ga0495626_0019139 3300048091 Bacteria 3426
479 Ga0496100_0002473 3300048903 Bacteria 9388
480 Ga0496100_0003752 3300048903 Bacteria 7954
481 Ga0496100_0028796 3300048903 Bacteria 3429
482 Ga0496100_0136002 3300048903 Bacteria 1736
483 Ga0496101_0001448 3300048904 Bacteria 14161
484 Ga0496101_0036182 3300048904 Bacteria 3496
485 Ga0496101_0041601 3300048904 Bacteria 3277
486 Ga0496102_0003516 3300048905 Bacteria 13279
487 Ga0496102_0004637 3300048905 Bacteria 11630
488 Ga0496102_0049400 3300048905 Bacteria 3827
489 Ga0496102_0204784 3300048905 Bacteria 1860
490 Ga0496102_0656200 3300048905 Bacteria 972
491 Ga0496103_0002086 3300048906 Bacteria 12767
492 Ga0496103_0002298 3300048906 Bacteria 12076
493 Ga0496103_0005467 3300048906 Bacteria 7596
494 Ga0496103_0015875 3300048906 Bacteria 4490
495 Ga0496103_0066234 3300048906 Bacteria 2254
496 Ga0496104_0059386 3300048907 Bacteria 3620
497 Ga0496104_0407738 3300048907 Bacteria 1271
498 Ga0496105_0087787 3300048908 Bacteria 2569
499 Ga0496105_0392988 3300048908 Bacteria 1102
500 Ga0496106_0110128 3300048909 Bacteria 2143
501 Ga0496107_0037568 3300048910 Bacteria 3475
502 Ga0496108_0227949 3300048911 Bacteria 1619
503 Ga0496109_0073221 3300048912 Bacteria 3148
504 Ga0496110_0090939 3300048913 Bacteria 2729
505 Ga0496111_0039631 3300048914 Bacteria 3379
506 Ga0496112_0021900 3300048915 Bacteria 6082
507 Ga0496112_0023099 3300048915 Bacteria 5936
508 Ga0496113_0011252 3300048916 Bacteria 5959
509 Ga0496113_0037435 3300048916 Bacteria 3560
510 Ga0496115_0057931 3300048918 Bacteria 3117
511 Ga0496115_0308801 3300048918 Bacteria 1295
512 Ga0496115_0380464 3300048918 Bacteria 1148
513 Ga0496115_0494218 3300048918 Bacteria 984
514 Ga0496116_0012813 3300048919 Bacteria 6814
515 Ga0496116_0022544 3300048919 Bacteria 4716
516 Ga0496116_0032690 3300048919 Bacteria 3704
517 Ga0496116_0068010 3300048919 Bacteria 2272
518 Ga0496116_0161415 3300048919 Bacteria 1229
519 Ga0496116_0197967 3300048919 Bacteria 1055
520 Ga0496117_0003564 3300048920 Bacteria 17969
521 Ga0496117_0005225 3300048920 Bacteria 13798
522 Ga0496117_0010730 3300048920 Bacteria 8283
523 Ga0496117_0049233 3300048920 Bacteria 3000
524 Ga0496118_0001410 3300048921 Bacteria 36234
525 Ga0496118_0004991 3300048921 Bacteria 15338
526 Ga0496118_0005234 3300048921 Bacteria 14834
527 Ga0496118_0026293 3300048921 Bacteria 4962
528 Ga0496118_0028440 3300048921 Bacteria 4706
529 Ga0496118_0060402 3300048921 Bacteria 2815
530 Ga0496119_0199273 3300048922 Bacteria 1037
531 Ga0496119_0252703 3300048922 Bacteria 888
532 Ga0496121_0003570 3300048924 Bacteria 21990
533 Ga0496121_0007511 3300048924 Bacteria 13151
534 Ga0496121_0031530 3300048924 Bacteria 4839
535 Ga0496121_0047707 3300048924 Bacteria 3651
536 Ga0496121_0050756 3300048924 Bacteria 3501
537 Ga0496121_0107949 3300048924 Bacteria 2130
538 Ga0496121_0110782 3300048924 Bacteria 2094
539 Ga0496122_0012927 3300048925 Bacteria 8240
540 Ga0496122_0275011 3300048925 Bacteria 925
541 Ga0496123_0009874 3300048926 Bacteria 8521
542 Ga0496124_0010905 3300048927 Bacteria 9145
543 Ga0496124_0099208 3300048927 Bacteria 2362
544 Ga0496124_0427593 3300048927 Bacteria 910
545 Ga0496126_0000706 3300048929 Bacteria 60980
546 Ga0496126_0001223 3300048929 Bacteria 41744
547 Ga0496126_0006478 3300048929 Bacteria 13039
548 Ga0496126_0009208 3300048929 Bacteria 10531
549 Ga0496126_0028853 3300048929 Bacteria 5280
550 Ga0496126_0420893 3300048929 Bacteria 1080
551 Ga0495678_000001 3300049459 Bacteria 1060340
552 Ga0495678_008322 3300049459 Bacteria 5246
553 Ga0495682_0022703 3300049460 Bacteria 2346
554 Ga0501031_0181958 3300049568 Bacteria 1373
555 Ga0501032_0191219 3300049569 Bacteria 1338
556 Ga0501033_0018316 3300049570 Bacteria 5291
557 Ga0501036_0005955 3300049572 Bacteria 9883
558 Ga0501036_0280946 3300049572 Bacteria 1393
559 Ga0501037_0048639 3300049573 Bacteria 3106
560 Ga0501038_0012767 3300049574 Bacteria 7673
561 Ga0501038_0013159 3300049574 Bacteria 7546
562 Ga0501039_0003471 3300049575 Bacteria 11777
563 Ga0501039_0044990 3300049575 Bacteria 3409
564 Ga0501040_0005113 3300049576 Bacteria 8480
565 Ga0501040_0005312 3300049576 Bacteria 8329
566 Ga0501041_0005447 3300049577 Bacteria 7451
567 Ga0501041_0005640 3300049577 Bacteria 7311
568 Ga0501042_0014805 3300049578 Bacteria 5327
569 Ga0501042_0028904 3300049578 Bacteria 3909
570 Ga0501043_0018050 3300049579 Bacteria 5534
571 Ga0501046_0027896 3300049580 Bacteria 4603
572 Ga0501046_0118499 3300049580 Bacteria 2016
573 Ga0501048_0021988 3300049582 Bacteria 4668
574 Ga0501068_0021663 3300049584 Bacteria 3755
575 Ga0501070_0606313 3300049586 Bacteria 872
576 Ga0501071_0000534 3300049587 Bacteria 19489
577 Ga0501072_0008540 3300049588 Bacteria 7768
578 Ga0501072_0014970 3300049588 Bacteria 5945
579 Ga0501072_0907148 3300049588 Bacteria 688
580 Ga0501074_0018563 3300049590 Bacteria 5052
581 Ga0501074_0351210 3300049590 Bacteria 1046
582 Ga0501075_0011006 3300049591 Bacteria 6383
583 Ga0501077_0010411 3300049593 Bacteria 5787
584 Ga0501077_0461535 3300049593 Bacteria 813
585 Ga0501079_0012238 3300049741 Bacteria 6551
586 Ga0501079_0121604 3300049741 Bacteria 2030
587 Ga0501080_0033258 3300049742 Bacteria 4812
588 Ga0501080_0034682 3300049742 Bacteria 4712
589 Ga0501081_0004723 3300049743 Bacteria 8760
590 Ga0501269_000145 3300049766 Bacteria 22006
591 Ga0501035_0035238 3300049822 Bacteria 4542
592 Ga0501035_0102065 3300049822 Bacteria 2516
593 Ga0501044_0307450 3300049823 Bacteria 1513
594 Ga0501045_0015934 3300049824 Bacteria 5332
595 Ga0501045_0067242 3300049824 Bacteria 2631
596 nmdc:mga03683_8147_c1 3300050489 Bacteria 3671
597 Ga0495655_0022673 3300053083 Bacteria 1438
598 Ga0500586_002407 3300053145 Bacteria 4217
599 Ga0500634_0016878 3300053161 Bacteria 3902
600 Ga0500637_0041092 3300053178 Bacteria 2614
601 Ga0500596_020735 3300053735 Bacteria 989
602 Ga0501084_0023931 3300054114 Bacteria 5095
603 Ga0501084_0027073 3300054114 Bacteria 4790
604 Ga0501082_0009269 3300060353 Bacteria 8485
605 Ga0501082_0020664 3300060353 Bacteria 5675
606 Ga0466962_0000472 3300061719 Bacteria 17495
607 Ga0466962_0001486 3300061719 Bacteria 10935
608 Ga0466962_0020544 3300061719 Bacteria 3172
609 Ga0466962_0022583 3300061719 Bacteria 3023
610 Ga0530510_0016081 3300061734 Bacteria 5289
611 2509131436 2508501125 Bacteria 7208311
612 2510251845 2510065045 Bacteria 7761063
613 2512345187 2512047030 Bacteria 9031815
614 2513961414 2513237151 Bacteria 6309801
615 2514053370 2513237166 Bacteria 10373764
616 2515684277 2515154122 Bacteria 8609520
617 2515691573 2515154123 Bacteria 6387382
618 2519458207 2519103095 Bacteria 6629912
619 2527080696 2526164713 Bacteria 6780608
620 2563059275 2562617112 Bacteria 10918404
621 2585294739 2582581311 Bacteria 6763856
622 2599738069 2599185239 Bacteria 8686614
623 2599742559 2599185240 Bacteria 7968121
624 2600204677 2599185355 Bacteria 7968906
625 2600810865 2600255067 Bacteria 6795583
626 2676741663 2675903129 Bacteria 7964495
627 2713479791 2711768613 Bacteria 11048459
628 2719640956 2718217991 Bacteria 7829542
629 2738819034 2738541296 Bacteria 7285013
630 2738827303 2738541297 Bacteria 6549566
631 2738830810 2738541298 Bacteria 7286732
632 2738872337 2738541306 Bacteria 7284992
633 2739151100 2738541357 Bacteria 6549408
634 2739183967 2738543002 Bacteria 7284546
635 2739193019 2738543003 Bacteria 6549560
636 2739218937 2738543008 Bacteria 7282815
637 2739319496 2738543026 Bacteria 6549408
638 2739337737 2738543029 Bacteria 6549249
639 2746088216 2744054900 Bacteria 8399525
640 2746096890 2744054901 Bacteria 8397047
641 2753567671 2751185846 Bacteria 7242164
642 2792839740 2791355137 Bacteria 9654227
643 2808969976 2808606384 Bacteria 8474373
644 2809005177 2808606390 Bacteria 8476311
645 2809011682 2808606391 Bacteria 8308166
646 2817260359 2816332253 Bacteria 6764532
647 2817278047 2816332256 Bacteria 6891714
648 2817455614 2816332286 Bacteria 6853759
649 2819623531 2818991450 Bacteria 6962147
650 2819632885 2818991452 Bacteria 8442785
651 2842325049 2842324504 Bacteria 9364110
652 2842349327 2842348783 Bacteria 9002918
653 2842459930 2842454564 Bacteria 8730687
654 2857557892 2857553236 Bacteria 6166726
655 2863421896 2863421361 Bacteria 7300805
656 2870072162 2870068957 Bacteria 8925310
657 2885271045 2885270888 Bacteria 9831543
658 2900637773 2900634093 Bacteria 10263517
659 2902687367 2902682994 Bacteria 8951596
660 2904430009 2904424332 Bacteria 7633521
661 2904487447 2904483920 Bacteria 7545285
662 2904566061 2904564687 Bacteria 7609577
663 2904573105 2904571731 Bacteria 7608790
664 2904623594 2904615490 Bacteria 10047340
665 2919479597 2919476304 Bacteria 5888696
666 2919528754 2919527303 Bacteria 7718827
667 2921653457 2921643360 Bacteria 11448031
668 2928110882 2928108538 Bacteria 7360024
669 2928137560 2928135762 Bacteria 7259641
670 2928159523 2928157003 Bacteria 7522202
671 2928164417 2928163908 Bacteria 7561269
672 2928177599 2928170801 Bacteria 8785406
673 2928505733 2928503688 Bacteria 7268108
674 2928538373 2928536128 Bacteria 7657547
675 2945937715 2945934425 Bacteria 7444609
676 2981993957 2981990288 Bacteria 7590678
677 2990705567 2990703756 Bacteria 7715990
678 642417926 641736154 Bacteria 7689995
679 642592541 642555112 Bacteria 8676562
680 642622543 642555113 Bacteria 8214658
681 8018850330 8018845410 Bacteria 8933938
682 8020808888 8020807995 Bacteria 6801506
683 8020947266 8020945358 Bacteria 8467355
684 8021122792 8021120328 Bacteria 8782274
685 8039102728 8039098773 Bacteria 6602928
686 8040169339 8040167225 Bacteria 6542727
687 8040174958 8040173305 Bacteria 6827067
688 8055226985 8055225921 Bacteria 3341787
689 8055267000 8055266321 Bacteria 7999742
690 8055301685 8055301274 Bacteria 8587385
691 Ga0495592_0003149
692 JGI24740J21852_10000321
693 JGI24739J22299_10005570
694 JGI24739J22299_10007598
695 JGI24739J22299_10024097
696 JGI24739J22299_10028840
697 JGI24737J22298_10022298
698 JGI24735J21928_10000211
699 JGI24735J21928_10001050
700 JGI24735J21928_10005467
701 JGI24738J21930_10001905
702 JGI25156J39149_1001121
703 JGI25156J39149_1010495
704 JGI25154J39366_1000558
705 JGI25165J46597_1002871
706 rootL2_10033819
707 rootH1_10169913
708 JGI25160J50197_1000818
709 Ga0055533_1000618
710 Ga0055533_1009008
711 Ga0055532_1000039
712 Ga0055532_1002103
713 Ga0055532_1002180
714 Ga0055527_1000024
715 Ga0055527_1000493
716 Ga0055527_1000532
717 Ga0055535_1000028
718 Ga0055535_1001248
719 Ga0055535_1001362
720 Ga0055542_1000047
721 Ga0055542_1001239
722 Ga0055542_1004506
723 Ga0055529_1000054
724 Ga0055529_1000492
725 Ga0055526_1000709
726 Ga0055528_1001475
727 Ga0065165_1002547
728 Ga0070658_10001863
729 Ga0070658_10004277
730 Ga0070666_10279696
731 Ga0070660_100000016
732 Ga0070661_100102233
733 Ga0070659_100000014
734 Ga0070659_100138694
735 Ga0070663_100002147
736 Ga0070663_100347671
737 Ga0070684_100379518
738 Ga0070665_100016567
739 Ga0068855_100002126
740 Ga0068855_100011135
741 Ga0068855_100155534
742 Ga0068855_100183129
743 Ga0068856_101238293
744 Ga0068858_100043018
745 Ga0075363_100083055
746 Ga0075362_10005404
747 Ga0079104_1025720
748 Ga0105251_10001940
749 Ga0105251_10098430
750 Ga0105251_10117292
751 Ga0105244_10001408
752 Ga0105240_10005681
753 Ga0105240_10024403
754 Ga0105240_10031037
755 Ga0105240_10036958
756 Ga0105240_10038727
757 Ga0105240_10091007
758 Ga0105240_10103481
759 Ga0105240_10487230
760 Ga0105247_10050555
761 Ga0105241_10091472
762 Ga0105248_10451790
763 Ga0105237_10064356
764 Ga0105237_10867525
765 Ga0105238_10004083
766 Ga0105238_10105936
767 Ga0105238_11091045
768 Ga0105239_10006046
769 Ga0105239_10167743
770 Ga0105239_10327341
771 Ga0157373_10090002
772 Ga0157371_10004966
773 Ga0157370_10071414
774 Ga0157370_10330826
775 Ga0157370_10798941
776 Ga0157369_10000820
777 Ga0157369_10001117
778 Ga0157369_10058799
779 Ga0157369_10149955
780 Ga0157369_10531280
781 Ga0157374_10060594
782 Ga0157374_10482756
783 Ga0157372_10665335
784 Ga0163163_10208473
785 Ga0182008_10153551
786 Ga0157376_10738959
787 Ga0182006_1000211
788 Ga0182006_1005017
789 Ga0182006_1012863
790 Ga0182007_10002694
791 Ga0182007_10049519
792 Ga0182005_1000005
793 Ga0182005_1007213
794 Ga0224712_10000963
795 Ga0209566_100680
796 Ga0209674_100013
797 Ga0209674_100508
798 Ga0209674_104330
799 Ga0209672_100010
800 Ga0209672_100019
801 Ga0209672_100051
802 Ga0209147_100006
803 Ga0209147_100026
804 Ga0209147_100192
805 Ga0209147_100308
806 Ga0209563_100478
807 Ga0207427_100524
808 Ga0209258_100010
809 Ga0209258_100031
810 Ga0209258_100358
811 Ga0207425_1000766
812 Ga0209646_1000036
813 Ga0209148_1000018
814 Ga0209148_1000027
815 Ga0209148_1000400
816 Ga0209148_1001772
817 Ga0209759_1000147
818 Ga0209759_1000160
819 Ga0209759_1000617
820 Ga0209759_1000830
821 Ga0209233_1000135
822 Ga0209455_1000015
823 Ga0209455_1000213
824 Ga0209673_1000201
825 Ga0209130_1006747
826 Ga0209025_1007282
827 Ga0209564_1000032
828 Ga0209564_1000348
829 Ga0209564_1002172
830 Ga0209564_1005720
831 Ga0209758_1000340
832 Ga0207426_1000183
833 Ga0207655_1010294
834 Ga0207713_1001524
835 Ga0207647_10001598
836 Ga0207647_10018062
837 Ga0207647_10021133
838 Ga0207705_10000706
839 Ga0207707_10078643
840 Ga0207695_10002638
841 Ga0207695_10003550
842 Ga0207695_10004451
843 Ga0207695_10058334
844 Ga0207695_10119524
845 Ga0207671_10008552
846 Ga0207671_10132068
847 Ga0207657_10000001
848 Ga0207649_10328694
849 Ga0207694_10080147
850 Ga0207700_10106244
851 Ga0207690_10000006
852 Ga0207667_10001310
853 Ga0207667_10059722
854 Ga0207667_10613491
855 Ga0207658_10052982
856 Ga0207703_10029243
857 Ga0207703_10516054
858 Ga0207678_10000640
859 Ga0207678_10109690
860 Ga0207702_11138214
861 Ga0207674_10062444
862 Ga0209281_1004199
863 Ga0209371_1000202
864 Ga0209371_1007990
865 Ga0268266_10002606
866 Ga0268266_10014962
867 Ga0268256_1000189
868 Ga0268256_1006535
869 Ga0265331_10006217
870 Ga0265327_10047534
871 Ga0307408_100006987
872 Ga0307405_10030128
873 Ga0307412_10000008
874 Ga0307416_100050490
875 Ga0373939_0104433
876 Ga0395900_0001172
877 Ga0395900_0539860
878 Ga0395898_0001373
879 Ga0395898_0143474
880 Ga0395905_0033181
881 Ga0395901_0000011
882 Ga0395901_0000264
883 Ga0436365_0124429
884 Ga0466969_0004678
885 Ga0466969_0005458
886 Ga0466969_0013814
887 Ga0466969_0084527
888 Ga0466980_0240838
889 Ga0466965_0000606
890 Ga0466965_0001401
891 Ga0466966_0000066
892 Ga0466966_0000227
893 Ga0466966_0006963
894 Ga0466966_0089831
895 Ga0466961_0000037
896 Ga0466961_0001393
897 Ga0466961_0002686
898 Ga0466961_0004562
899 Ga0466961_0016531
900 Ga0466961_0025387
901 Ga0466963_0002315
902 Ga0466963_0003459
903 Ga0466963_0015198
904 Ga0466963_0203010
905 Ga0466964_0006690
906 Ga0466964_0017023
907 Ga0466971_0000253
908 Ga0466971_0001402
909 Ga0466971_0008797
910 Ga0466971_0026634
911 Ga0466968_0090169
912 Ga0466970_0000417
913 Ga0466970_0001726
914 Ga0466970_0028923
915 Ga0466970_0240916
916 Ga0466970_0302820
917 Ga0466957_0003013
918 Ga0466957_0009195
919 Ga0466957_0009985
920 Ga0466957_0121737
921 Ga0466957_0273899
922 Ga0466959_0001227
923 Ga0466959_0004990
924 Ga0466959_0011060
925 Ga0466959_0020718
926 Ga0466959_0023700
927 Ga0466959_0062796
928 Ga0466959_0419504
929 Ga0451576_0265453
930 Ga0466958_0000736
931 Ga0466958_0006656
932 Ga0466958_0007917
933 Ga0466958_0369004
934 Ga0495617_000005
935 Ga0495627_000033
936 Ga0495592_0030564
937 Ga0495592_0123576
938 Ga0495603_0001415
939 Ga0495603_0003952
940 Ga0495603_0068454
941 Ga0495603_0221202
942 Ga0495590_0004876
943 Ga0495590_0071581
944 Ga0495591_001984
945 Ga0495629_0000060
946 Ga0495629_0002826
947 Ga0495629_0005449
948 Ga0495629_0069072
949 Ga0495638_0017801
950 Ga0495641_0011078
951 Ga0495641_0080589
952 Ga0495651_0001821
953 Ga0495651_0050510
954 Ga0495651_0121796
955 Ga0495653_0000008
956 Ga0495653_0001720
957 Ga0495653_0011779
958 Ga0495653_0037633
959 Ga0495653_0043338
960 Ga0495653_0252990
961 Ga0495653_0277940
962 Ga0495653_0297524
963 Ga0495650_0000365
964 Ga0495650_0018902
965 Ga0495650_0045722
966 Ga0495650_0107555
967 Ga0495580_0000291
968 Ga0495580_0000728
969 Ga0495580_0001191
970 Ga0495580_0002463
971 Ga0495580_0009416
972 Ga0495580_0031609
973 Ga0495580_0049554
974 Ga0495580_0535047
975 Ga0495580_0563473
976 Ga0495582_0007338
977 Ga0495582_0015768
978 Ga0495605_0000082
979 Ga0495605_0013666
980 Ga0495662_0013125
981 Ga0495662_0161782
982 Ga0495662_0171673
983 Ga0495664_0000037
984 Ga0495664_0001638
985 Ga0495664_0009072
986 Ga0495664_0044051
987 Ga0495584_0129357
988 Ga0495585_0005923
989 Ga0495594_0152934
990 Ga0495596_0003678
991 Ga0495607_0040877
992 Ga0495583_0002702
993 Ga0495583_0008290
994 Ga0495606_0000048
995 Ga0495606_0001916
996 Ga0495606_0029193
997 Ga0495606_0048597
998 Ga0495606_0124527
999 Ga0495606_0141797
1000 Ga0495606_0148720
1001 Ga0495606_0242562
1002 Ga0495606_0291649
1003 Ga0495608_0072460
1004 Ga0495608_0107160
1005 Ga0495610_0002900
1006 Ga0495618_0015491
1007 Ga0495618_0070084
1008 Ga0495618_0134741
1009 Ga0495628_0007659
1010 Ga0495628_0011864
1011 Ga0495628_0085018
1012 Ga0495628_0091074
1013 Ga0495628_0144548
1014 Ga0495628_0341787
1015 Ga0495630_0008007
1016 Ga0495630_0009248
1017 Ga0495630_0020044
1018 Ga0495630_0024525
1019 Ga0495630_0043721
1020 Ga0495643_0098364
1021 Ga0495644_0029156
1022 Ga0495648_0004350
1023 Ga0495648_0015798
1024 Ga0495648_0077574
1025 Ga0495648_0160135
1026 Ga0495666_0001133
1027 Ga0495666_0007812
1028 Ga0495666_0069458
1029 Ga0495666_0083078
1030 Ga0495642_0014286
1031 Ga0495652_0035956
1032 Ga0495652_0040238
1033 Ga0495652_0113708
1034 Ga0495652_0134159
1035 Ga0495652_0165455
1036 Ga0495654_0004264
1037 Ga0495665_0000627
1038 Ga0495665_0004869
1039 Ga0495665_0012822
1040 Ga0495665_0023929
1041 Ga0495640_0002615
1042 Ga0495640_0076010
1043 Ga0495640_0222803
1044 Ga0495586_0005674
1045 Ga0495586_0066157
1046 Ga0495586_0214280
1047 Ga0495587_0002254
1048 Ga0495609_0002061
1049 Ga0495597_0023395
1050 Ga0495597_0104168
1051 Ga0495645_0009157
1052 Ga0495645_0026898
1053 Ga0495645_0141132
1054 Ga0495645_0184160
1055 Ga0495622_0000190
1056 Ga0495622_0144102
1057 Ga0495633_0078550
1058 Ga0495668_0001210
1059 Ga0495634_0050780
1060 Ga0495634_0271729
1061 Ga0495611_0039435
1062 Ga0495625_0026873
1063 Ga0495625_0079286
1064 Ga0495635_0027251
1065 Ga0495635_0032464
1066 Ga0495635_0036555
1067 Ga0495635_0114327
1068 Ga0495661_0001085
1069 Ga0495661_0008422
1070 Ga0495661_0012262
1071 Ga0495588_0036956
1072 Ga0495588_0218878
1073 Ga0495657_0059546
1074 Ga0495599_0025715
1075 Ga0495599_0034888
1076 Ga0495599_0037140
1077 Ga0495599_0211291
1078 Ga0495599_0290785
1079 Ga0495623_0008586
1080 Ga0495623_0012430
1081 Ga0495623_0073663
1082 Ga0495646_0000964
1083 Ga0495646_0004030
1084 Ga0495646_0032040
1085 Ga0495646_0088903
1086 Ga0495646_0204087
1087 Ga0495646_0356025
1088 Ga0495669_0110993
1089 Ga0495613_0006326
1090 Ga0495613_0023271
1091 Ga0495624_0023620
1092 Ga0495624_0087956
1093 Ga0495624_0104436
1094 Ga0495624_0343081
1095 Ga0495671_0130104
1096 Ga0495649_0129032
1097 Ga0495649_0261768
1098 Ga0495649_0275613
1099 Ga0495589_0001627
1100 Ga0495589_0054384
1101 Ga0495589_0125580
1102 Ga0495600_0018398
1103 Ga0495600_0026670
1104 Ga0495600_0370792
1105 Ga0495660_0002949
1106 Ga0495660_0040832
1107 Ga0495660_0240522
1108 Ga0495581_0003064
1109 Ga0495581_0080258
1110 Ga0495581_0084929
1111 Ga0495604_0025505
1112 Ga0495604_0083289
1113 Ga0495604_0155065
1114 Ga0495674_0004711
1115 Ga0495674_0005533
1116 Ga0495674_0025521
1117 Ga0495674_0091647
1118 Ga0495674_0459986
1119 Ga0495672_0037013
1120 Ga0495672_0046511
1121 Ga0495676_0005402
1122 Ga0495676_0037460
1123 Ga0495676_0113346
1124 Ga0495676_0373948
1125 Ga0495680_0001059
1126 Ga0495680_0022923
1127 Ga0495680_0051099
1128 Ga0495680_0080600
1129 Ga0495680_0104145
1130 Ga0495683_0005028
1131 Ga0495683_0005067
1132 Ga0495683_0019110
1133 Ga0495683_0025164
1134 Ga0495683_0035414
1135 Ga0495683_0048986
1136 Ga0495687_033403
1137 Ga0495687_037834
1138 Ga0495675_0014442
1139 Ga0495675_0016656
1140 Ga0495675_0079572
1141 Ga0495679_000038
1142 Ga0495679_000990
1143 Ga0495679_001096
1144 Ga0495679_101651
1145 Ga0495673_0000098
1146 Ga0495673_0007845
1147 Ga0495673_0039163
1148 Ga0495681_0007634
1149 Ga0495684_0031732
1150 Ga0495684_0248974
1151 Ga0495686_0037158
1152 Ga0495593_0001558
1153 Ga0495593_0005158
1154 Ga0495593_0007154
1155 Ga0495593_0023225
1156 Ga0495593_0092841
1157 Ga0495593_0156070
1158 Ga0495602_0018601
1159 Ga0495602_0024213
1160 Ga0495602_0029041
1161 Ga0495602_0112711
1162 Ga0495602_0254188
1163 Ga0495602_0361114
1164 Ga0495614_0003398
1165 Ga0495614_0005862
1166 Ga0495614_0057547
1167 Ga0495614_0058640
1168 Ga0495626_0019139
1169 Ga0496100_0002473
1170 Ga0496100_0003752
1171 Ga0496100_0028796
1172 Ga0496100_0136002
1173 Ga0496101_0001448
1174 Ga0496101_0036182
1175 Ga0496101_0041601
1176 Ga0496102_0003516
1177 Ga0496102_0004637
1178 Ga0496102_0049400
1179 Ga0496102_0204784
1180 Ga0496102_0656200
1181 Ga0496103_0002086
1182 Ga0496103_0002298
1183 Ga0496103_0005467
1184 Ga0496103_0015875
1185 Ga0496103_0066234
1186 Ga0496104_0059386
1187 Ga0496104_0407738
1188 Ga0496105_0087787
1189 Ga0496105_0392988
1190 Ga0496106_0110128
1191 Ga0496107_0037568
1192 Ga0496108_0227949
1193 Ga0496109_0073221
1194 Ga0496110_0090939
1195 Ga0496111_0039631
1196 Ga0496112_0021900
1197 Ga0496112_0023099
1198 Ga0496113_0011252
1199 Ga0496113_0037435
1200 Ga0496115_0057931
1201 Ga0496115_0308801
1202 Ga0496115_0380464
1203 Ga0496115_0494218
1204 Ga0496116_0012813
1205 Ga0496116_0022544
1206 Ga0496116_0032690
1207 Ga0496116_0068010
1208 Ga0496116_0161415
1209 Ga0496116_0197967
1210 Ga0496117_0003564
1211 Ga0496117_0005225
1212 Ga0496117_0010730
1213 Ga0496117_0049233
1214 Ga0496118_0001410
1215 Ga0496118_0004991
1216 Ga0496118_0005234
1217 Ga0496118_0026293
1218 Ga0496118_0028440
1219 Ga0496118_0060402
1220 Ga0496119_0199273
1221 Ga0496119_0252703
1222 Ga0496121_0003570
1223 Ga0496121_0007511
1224 Ga0496121_0031530
1225 Ga0496121_0047707
1226 Ga0496121_0050756
1227 Ga0496121_0107949
1228 Ga0496121_0110782
1229 Ga0496122_0012927
1230 Ga0496122_0275011
1231 Ga0496123_0009874
1232 Ga0496124_0010905
1233 Ga0496124_0099208
1234 Ga0496124_0427593
1235 Ga0496126_0000706
1236 Ga0496126_0001223
1237 Ga0496126_0006478
1238 Ga0496126_0009208
1239 Ga0496126_0028853
1240 Ga0496126_0420893
1241 Ga0495678_000001
1242 Ga0495678_008322
1243 Ga0495682_0022703
1244 Ga0501031_0181958
1245 Ga0501032_0191219
1246 Ga0501033_0018316
1247 Ga0501036_0005955
1248 Ga0501036_0280946
1249 Ga0501037_0048639
1250 Ga0501038_0012767
1251 Ga0501038_0013159
1252 Ga0501039_0003471
1253 Ga0501039_0044990
1254 Ga0501040_0005113
1255 Ga0501040_0005312
1256 Ga0501041_0005447
1257 Ga0501041_0005640
1258 Ga0501042_0014805
1259 Ga0501042_0028904
1260 Ga0501043_0018050
1261 Ga0501046_0027896
1262 Ga0501046_0118499
1263 Ga0501048_0021988
1264 Ga0501068_0021663
1265 Ga0501070_0606313
1266 Ga0501071_0000534
1267 Ga0501072_0008540
1268 Ga0501072_0014970
1269 Ga0501072_0907148
1270 Ga0501074_0018563
1271 Ga0501074_0351210
1272 Ga0501075_0011006
1273 Ga0501077_0010411
1274 Ga0501077_0461535
1275 Ga0501079_0012238
1276 Ga0501079_0121604
1277 Ga0501080_0033258
1278 Ga0501080_0034682
1279 Ga0501081_0004723
1280 Ga0501269_000145
1281 Ga0501035_0035238
1282 Ga0501035_0102065
1283 Ga0501044_0307450
1284 Ga0501045_0015934
1285 Ga0501045_0067242
1286 nmdc:mga03683_8147_c1
1287 Ga0495655_0022673
1288 Ga0500586_002407
1289 Ga0500634_0016878
1290 Ga0500637_0041092
1291 Ga0500596_020735
1292 Ga0501084_0023931
1293 Ga0501084_0027073
1294 Ga0501082_0009269
1295 Ga0501082_0020664
1296 Ga0466962_0000472
1297 Ga0466962_0001486
1298 Ga0466962_0020544
1299 Ga0466962_0022583
1300 Ga0530510_0016081
1301 2509131436
1302 2510251845
1303 2512345187
1304 2513961414
1305 2514053370
1306 2515684277
1307 2515691573
1308 2519458207
1309 2527080696
1310 2563059275
1311 2585294739
1312 2599738069
1313 2599742559
1314 2600204677
1315 2600810865
1316 2676741663
1317 2713479791
1318 2719640956
1319 2738819034
1320 2738827303
1321 2738830810
1322 2738872337
1323 2739151100
1324 2739183967
1325 2739193019
1326 2739218937
1327 2739319496
1328 2739337737
1329 2746088216
1330 2746096890
1331 2753567671
1332 2792839740
1333 2808969976
1334 2809005177
1335 2809011682
1336 2817260359
1337 2817278047
1338 2817455614
1339 2819623531
1340 2819632885
1341 2842325049
1342 2842349327
1343 2842459930
1344 2857557892
1345 2863421896
1346 2870072162
1347 2885271045
1348 2900637773
1349 2902687367
1350 2904430009
1351 2904487447
1352 2904566061
1353 2904573105
1354 2904623594
1355 2919479597
1356 2919528754
1357 2921653457
1358 2928110882
1359 2928137560
1360 2928159523
1361 2928164417
1362 2928177599
1363 2928505733
1364 2928538373
1365 2945937715
1366 2981993957
1367 2990705567
1368 642417926
1369 642592541
1370 642622543
1371 8018850330
1372 8020808888
1373 8020947266
1374 8021122792
1375 8039102728
1376 8040169339
1377 8040174958
1378 8055226985
1379 8055267000
1380 8055301685

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

81

207

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.8532 63 178
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.848 61 171
5qgk-assembly1.cif.gz_A pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt7 in complex with fmopl000679a 0.8391 57 237
6uuf-assembly1.cif.gz_A crystal structure of a nudix hydrolase from m. smegmatis, renu 0.8379 60 171
3cng-assembly1.cif.gz_B crystal structure of nudix hydrolase from nitrosomonas europaea 0.8274 57 170
ID Description Score Start End Superfamily
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.917 31 233 3.90.79.10
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8978 64 151 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8977 31 233 3.90.79.10
af_E7FAS2_11_192_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8593 55 233 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.848 61 171 3.90.79.10
ID Description Score Start End GO Terms
AF-W0VA56-F1-model_v4 NUDIX domain protein 0.9799 68 238 GO:0010945
AF-C4KS39-F1-model_v4 deleted 0.9749 4 238
AF-Q2SXZ7-F1-model_v4 Pyrophosphatase, MutT/nudix family 0.9713 3 238 GO:0010945
AF-Q3JQ11-F1-model_v4 Pyrophosphatase, MutT/nudix family 0.971 3 238 GO:0010945
AF-A0A537RS48-F1-model_v4 CoA pyrophosphatase 0.971 58 233 GO:0010945

Map