F475388

General Info

Members Datasets Scaffolds Average Seq Length
689 274 1378 147

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10735447|Ga0207703_107354472
Length 175
Sequence MHRHPRCFATVWQTTGFTIEVGRLIIRAMLSRRDAVASFALFADLVASGRHLDALAQTTPAAPGTPPPPISRHDLPRVTMDDWEVTVSYVDYPPGRVGAAHHHAGFVLAYVLEGAVVTKISGQGEEKTYTVGQMFYEQPGATHEVSKNASQTQPARLLAMIFAKKGSTLTMPGPA

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 27.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10735447 3300026035 Bacteria 939
2 Ga0058863_11332999 3300004799 Bacteria 713
3 Ga0065704_10304040 3300005289 Unclassified 880
4 Ga0065712_10267094 3300005290 Unclassified 924
5 Ga0065715_10014205 3300005293 Bacteria 2165
6 Ga0065715_10105377 3300005293 Bacteria 2876
7 Ga0065715_10382837 3300005293 Bacteria 893
8 Ga0065715_11013547 3300005293 Bacteria 542
9 Ga0065715_11157041 3300005293 Unclassified 507
10 Ga0065707_10017938 3300005295 Bacteria 3349
11 Ga0065707_10298169 3300005295 Unclassified 1009
12 Ga0070676_10019922 3300005328 Unclassified 3738
13 Ga0070690_100044608 3300005330 Bacteria 2815
14 Ga0070690_100077917 3300005330 Bacteria 2165
15 Ga0070690_100098152 3300005330 Bacteria 1939
16 Ga0070690_100887440 3300005330 Unclassified 697
17 Ga0070670_100056545 3300005331 Bacteria 3367
18 Ga0070670_100192322 3300005331 Bacteria 1773
19 Ga0068869_100184698 3300005334 Unclassified 1636
20 Ga0068869_101051464 3300005334 Unclassified 711
21 Ga0070666_10005197 3300005335 Bacteria 7974
22 Ga0070666_10236424 3300005335 Unclassified 1291
23 Ga0068868_100447393 3300005338 Unclassified 1123
24 Ga0068868_100497558 3300005338 Bacteria 1067
25 Ga0068868_101236384 3300005338 Unclassified 692
26 Ga0070660_100116064 3300005339 Bacteria 2134
27 Ga0070660_100409308 3300005339 Bacteria 1122
28 Ga0070660_100776742 3300005339 Unclassified 805
29 Ga0070689_100004437 3300005340 Bacteria 9479
30 Ga0070689_100007594 3300005340 Bacteria 7596
31 Ga0070689_100064840 3300005340 Bacteria 2844
32 Ga0070689_100157305 3300005340 Bacteria 1835
33 Ga0070689_100176984 3300005340 Bacteria 1731
34 Ga0070689_100527183 3300005340 Bacteria 1015
35 Ga0070691_10197266 3300005341 Unclassified 1056
36 Ga0070691_10365503 3300005341 Unclassified 805
37 Ga0070687_100018069 3300005343 Bacteria 3254
38 Ga0070687_100339225 3300005343 Bacteria 966
39 Ga0070692_10069121 3300005345 Bacteria 1878
40 Ga0070692_10548435 3300005345 Bacteria 757
41 Ga0070692_10844625 3300005345 Unclassified 629
42 Ga0070692_11090658 3300005345 Unclassified 563
43 Ga0070668_100051959 3300005347 Bacteria 3159
44 Ga0070668_100537392 3300005347 Bacteria 1016
45 Ga0070668_100746430 3300005347 Bacteria 866
46 Ga0070669_100003956 3300005353 Bacteria 10716
47 Ga0070669_100013215 3300005353 Bacteria 5870
48 Ga0070669_100067210 3300005353 Unclassified 2644
49 Ga0070669_100129337 3300005353 Bacteria 1935
50 Ga0070669_100236595 3300005353 Unclassified 1449
51 Ga0070675_100000420 3300005354 Bacteria 28958
52 Ga0070675_100015160 3300005354 Bacteria 6087
53 Ga0070675_100149811 3300005354 Unclassified 2000
54 Ga0070675_100681561 3300005354 Bacteria 935
55 Ga0070675_100903125 3300005354 Unclassified 810
56 Ga0070671_100052813 3300005355 Bacteria 3379
57 Ga0070671_101453163 3300005355 Bacteria 606
58 Ga0070674_100034274 3300005356 Unclassified 3389
59 Ga0070674_100837878 3300005356 Bacteria 797
60 Ga0070673_100063095 3300005364 Bacteria 2947
61 Ga0070673_100151129 3300005364 Unclassified 1966
62 Ga0070688_100021695 3300005365 Bacteria 3754
63 Ga0070688_100025850 3300005365 Bacteria 3481
64 Ga0070688_100480872 3300005365 Bacteria 934
65 Ga0070659_100104759 3300005366 Bacteria 2279
66 Ga0070659_100914461 3300005366 Bacteria 767
67 Ga0070667_100006576 3300005367 Bacteria 9665
68 Ga0070667_101562284 3300005367 Bacteria 620
69 Ga0070703_10102669 3300005406 Unclassified 1010
70 Ga0070709_10097681 3300005434 Bacteria 1950
71 Ga0070713_100016406 3300005436 Bacteria 5569
72 Ga0070713_100851994 3300005436 Unclassified 875
73 Ga0070713_102043692 3300005436 Unclassified 556
74 Ga0070701_10006396 3300005438 Bacteria 4955
75 Ga0070701_10116861 3300005438 Unclassified 1497
76 Ga0070701_10248486 3300005438 Bacteria 1073
77 Ga0070701_10706231 3300005438 Bacteria 679
78 Ga0070711_100323950 3300005439 Bacteria 1232
79 Ga0070705_100000037 3300005440 Bacteria 66783
80 Ga0070705_100013278 3300005440 Bacteria 4209
81 Ga0070705_100035978 3300005440 Bacteria 2780
82 Ga0070705_100141952 3300005440 Bacteria 1582
83 Ga0070700_100021963 3300005441 Bacteria 3715
84 Ga0070700_100073743 3300005441 Bacteria 2185
85 Ga0070700_100161970 3300005441 Bacteria 1541
86 Ga0070700_100320739 3300005441 Bacteria 1138
87 Ga0070694_100001204 3300005444 Bacteria 14924
88 Ga0070694_100001228 3300005444 Bacteria 14815
89 Ga0070694_100010891 3300005444 Bacteria 5627
90 Ga0070694_100020555 3300005444 Bacteria 4211
91 Ga0070694_100188676 3300005444 Bacteria 1529
92 Ga0070694_100720437 3300005444 Bacteria 813
93 Ga0070694_100932405 3300005444 Bacteria 718
94 Ga0070708_100036000 3300005445 Unclassified 4316
95 Ga0070708_100581769 3300005445 Bacteria 1056
96 Ga0070708_101184080 3300005445 Bacteria 715
97 Ga0070678_100290418 3300005456 Bacteria 1386
98 Ga0070662_100024350 3300005457 Bacteria 4170
99 Ga0070662_100090590 3300005457 Bacteria 2296
100 Ga0070662_100121692 3300005457 Bacteria 2001
101 Ga0070662_100261771 3300005457 Unclassified 1394
102 Ga0070662_100912737 3300005457 Unclassified 750
103 Ga0070681_10020213 3300005458 Bacteria 6675
104 Ga0068867_100011482 3300005459 Bacteria 6252
105 Ga0068867_100048878 3300005459 Bacteria 3113
106 Ga0068867_101157175 3300005459 Bacteria 709
107 Ga0068867_101680530 3300005459 Bacteria 595
108 Ga0070706_100418119 3300005467 Bacteria 1248
109 Ga0070707_100083186 3300005468 Archaea 3092
110 Ga0070707_100132105 3300005468 Unclassified 2428
111 Ga0070707_100322630 3300005468 Unclassified 1501
112 Ga0070707_100836009 3300005468 Bacteria 885
113 Ga0070698_100000929 3300005471 Bacteria 32009
114 Ga0070698_100052702 3300005471 Bacteria 4137
115 Ga0070698_100354222 3300005471 Bacteria 1399
116 Ga0070698_101219248 3300005471 Unclassified 702
117 Ga0070699_100002294 3300005518 Bacteria 17216
118 Ga0070699_100019455 3300005518 Bacteria 5846
119 Ga0070699_100077668 3300005518 Unclassified 2891
120 Ga0070699_100088560 3300005518 Bacteria 2704
121 Ga0070699_101163483 3300005518 Bacteria 707
122 Ga0070679_100031839 3300005530 Bacteria 5214
123 Ga0070684_100581855 3300005535 Bacteria 1040
124 Ga0070697_100077672 3300005536 Archaea 2731
125 Ga0070697_100608516 3300005536 Unclassified 961
126 Ga0070697_101257660 3300005536 Bacteria 660
127 Ga0070672_100045709 3300005543 Unclassified 3389
128 Ga0070672_100060990 3300005543 Unclassified 2972
129 Ga0070672_100264523 3300005543 Bacteria 1451
130 Ga0070672_101258152 3300005543 Unclassified 660
131 Ga0070672_101484802 3300005543 Bacteria 607
132 Ga0070686_100678182 3300005544 Unclassified 820
133 Ga0070695_100000085 3300005545 Bacteria 39151
134 Ga0070695_100298064 3300005545 Bacteria 1191
135 Ga0070695_101123743 3300005545 Bacteria 644
136 Ga0070696_100000139 3300005546 Bacteria 39687
137 Ga0070696_100008917 3300005546 Bacteria 6712
138 Ga0070696_100207392 3300005546 Bacteria 1466
139 Ga0070696_100350568 3300005546 Bacteria 1143
140 Ga0070665_100007666 3300005548 Bacteria 10967
141 Ga0070665_100171575 3300005548 Bacteria 2170
142 Ga0070704_100000453 3300005549 Bacteria 19337
143 Ga0070704_100002706 3300005549 Bacteria 10021
144 Ga0070704_100025028 3300005549 Bacteria 3925
145 Ga0070704_100040294 3300005549 Bacteria 3214
146 Ga0070704_100042174 3300005549 Unclassified 3155
147 Ga0070704_100444049 3300005549 Bacteria 1116
148 Ga0070704_100533901 3300005549 Bacteria 1023
149 Ga0068855_100287927 3300005563 Bacteria 1822
150 Ga0068855_101133831 3300005563 Bacteria 816
151 Ga0070664_100422475 3300005564 Bacteria 1221
152 Ga0070664_101084422 3300005564 Unclassified 754
153 Ga0068857_100001266 3300005577 Bacteria 19807
154 Ga0068857_100181290 3300005577 Unclassified 1917
155 Ga0068857_101259772 3300005577 Bacteria 717
156 Ga0068854_100016621 3300005578 Bacteria 4909
157 Ga0068854_101153624 3300005578 Bacteria 692
158 Ga0070702_100030815 3300005615 Bacteria 2928
159 Ga0068852_100870742 3300005616 Unclassified 917
160 Ga0068859_100004813 3300005617 Bacteria 13744
161 Ga0068859_100005036 3300005617 Bacteria 13407
162 Ga0068859_100011030 3300005617 Bacteria 9092
163 Ga0068859_100013716 3300005617 Bacteria 8125
164 Ga0068859_100196467 3300005617 Unclassified 2102
165 Ga0068859_101539761 3300005617 Unclassified 734
166 Ga0068864_100097966 3300005618 Unclassified 2597
167 Ga0068864_100237196 3300005618 Unclassified 1689
168 Ga0068864_100479442 3300005618 Bacteria 1194
169 Ga0068866_10056148 3300005718 Unclassified 2025
170 Ga0068866_10159885 3300005718 Unclassified 1312
171 Ga0068866_10378931 3300005718 Unclassified 907
172 Ga0068866_11155705 3300005718 Unclassified 557
173 Ga0068861_100031278 3300005719 Unclassified 3909
174 Ga0068861_100096934 3300005719 Unclassified 2338
175 Ga0068861_100129069 3300005719 Bacteria 2050
176 Ga0068861_100243105 3300005719 Bacteria 1532
177 Ga0068861_100728803 3300005719 Bacteria 924
178 Ga0068870_10007388 3300005840 Bacteria 4894
179 Ga0068870_10009645 3300005840 Bacteria 4399
180 Ga0068863_100030531 3300005841 Bacteria 5145
181 Ga0068863_100657128 3300005841 Bacteria 1040
182 Ga0068858_100033758 3300005842 Bacteria 4745
183 Ga0068858_100037321 3300005842 Unclassified 4506
184 Ga0068858_100086239 3300005842 Bacteria 2921
185 Ga0068858_100097790 3300005842 Bacteria 2736
186 Ga0068858_100534659 3300005842 Bacteria 1134
187 Ga0068860_100008710 3300005843 Bacteria 10104
188 Ga0068860_100151514 3300005843 Unclassified 2233
189 Ga0068860_100452577 3300005843 Unclassified 1277
190 Ga0068860_100465341 3300005843 Bacteria 1259
191 Ga0068860_101878042 3300005843 Unclassified 621
192 Ga0068862_100006051 3300005844 Bacteria 10077
193 Ga0068862_100014260 3300005844 Bacteria 6591
194 Ga0068862_100078254 3300005844 Bacteria 2865
195 Ga0068862_100727062 3300005844 Bacteria 964
196 Ga0070717_10406113 3300006028 Unclassified 1224
197 Ga0070717_11372256 3300006028 Unclassified 642
198 Ga0075432_10070913 3300006058 Unclassified 1252
199 Ga0070715_10210119 3300006163 Unclassified 994
200 Ga0070715_10657774 3300006163 Unclassified 621
201 Ga0070716_100336903 3300006173 Unclassified 1063
202 Ga0070716_100638241 3300006173 Bacteria 806
203 Ga0070716_100754377 3300006173 Unclassified 749
204 Ga0070712_101009227 3300006175 Unclassified 720
205 Ga0097621_100036808 3300006237 Bacteria 3916
206 Ga0097621_101092074 3300006237 Bacteria 749
207 Ga0068871_100055583 3300006358 Unclassified 3214
208 Ga0068871_100148282 3300006358 Bacteria 1999
209 Ga0068871_100989659 3300006358 Unclassified 783
210 Ga0075428_100000056 3300006844 Bacteria 89990
211 Ga0075428_100002585 3300006844 Bacteria 19667
212 Ga0075428_100093273 3300006844 Bacteria 3282
213 Ga0075428_100236343 3300006844 Unclassified 1972
214 Ga0075428_100531833 3300006844 Unclassified 1257
215 Ga0075428_100740949 3300006844 Bacteria 1046
216 Ga0075428_100825542 3300006844 Unclassified 985
217 Ga0075428_100871365 3300006844 Unclassified 956
218 Ga0075428_101042020 3300006844 Bacteria 865
219 Ga0075428_101205477 3300006844 Unclassified 798
220 Ga0075430_100000072 3300006846 Bacteria 55365
221 Ga0075430_100242321 3300006846 Bacteria 1494
222 Ga0075430_100479450 3300006846 Bacteria 1026
223 Ga0075431_100013452 3300006847 Bacteria 8265
224 Ga0075431_100110346 3300006847 Bacteria 2839
225 Ga0075431_100364473 3300006847 Bacteria 1451
226 Ga0075431_101088522 3300006847 Unclassified 764
227 Ga0075433_10181092 3300006852 Bacteria 1875
228 Ga0075433_10186648 3300006852 Bacteria 1845
229 Ga0075433_10573214 3300006852 Unclassified 991
230 Ga0075434_100040479 3300006871 Bacteria 4614
231 Ga0075434_100043057 3300006871 Bacteria 4476
232 Ga0075434_100151091 3300006871 Unclassified 2343
233 Ga0075434_100155144 3300006871 Bacteria 2309
234 Ga0075434_100184004 3300006871 Bacteria 2110
235 Ga0075434_100217520 3300006871 Bacteria 1930
236 Ga0075434_100672911 3300006871 Bacteria 1053
237 Ga0075434_100761387 3300006871 Bacteria 985
238 Ga0075434_101207774 3300006871 Bacteria 768
239 Ga0075429_100019241 3300006880 Bacteria 5915
240 Ga0075429_100094158 3300006880 Bacteria 2613
241 Ga0075429_100670107 3300006880 Unclassified 909
242 Ga0075429_101039023 3300006880 Unclassified 716
243 Ga0075429_101556021 3300006880 Bacteria 575
244 Ga0068865_100250478 3300006881 Bacteria 1398
245 Ga0068865_100256718 3300006881 Unclassified 1382
246 Ga0075436_100017364 3300006914 Bacteria 4926
247 Ga0075436_100142621 3300006914 Bacteria 1684
248 Ga0097620_100004814 3300006931 Bacteria 13744
249 Ga0097620_100005036 3300006931 Bacteria 13407
250 Ga0097620_100011030 3300006931 Bacteria 9092
251 Ga0097620_100013716 3300006931 Bacteria 8125
252 Ga0097620_100025646 3300006931 Bacteria 5912
253 Ga0097620_100196467 3300006931 Unclassified 2102
254 Ga0097620_101539729 3300006931 Unclassified 734
255 Ga0075435_100000028 3300007076 Bacteria 82360
256 Ga0075435_100000962 3300007076 Bacteria 18187
257 Ga0075435_100031431 3300007076 Bacteria 4182
258 Ga0075435_100052058 3300007076 Bacteria 3299
259 Ga0075435_100292109 3300007076 Unclassified 1393
260 Ga0075435_100316552 3300007076 Bacteria 1335
261 Ga0075435_100476530 3300007076 Unclassified 1078
262 Ga0075435_100517469 3300007076 Unclassified 1032
263 Ga0111539_10000002 3300009094 Bacteria 983359
264 Ga0111539_10008678 3300009094 Bacteria 12900
265 Ga0111539_10020340 3300009094 Bacteria 8176
266 Ga0111539_10021656 3300009094 Bacteria 7907
267 Ga0111539_10043711 3300009094 Bacteria 5370
268 Ga0105245_10173726 3300009098 Bacteria 2053
269 Ga0105245_10216535 3300009098 Bacteria 1845
270 Ga0105245_10344157 3300009098 Bacteria 1475
271 Ga0105245_11026190 3300009098 Bacteria 870
272 Ga0105247_10009886 3300009101 Bacteria 5779
273 Ga0105247_10048684 3300009101 Bacteria 2604
274 Ga0114129_10001718 3300009147 Bacteria 29903
275 Ga0114129_10012031 3300009147 Bacteria 12307
276 Ga0114129_10022700 3300009147 Bacteria 8899
277 Ga0114129_10086253 3300009147 Bacteria 4354
278 Ga0114129_10207764 3300009147 Bacteria 2649
279 Ga0114129_10208473 3300009147 Bacteria 2643
280 Ga0114129_10284660 3300009147 Bacteria 2208
281 Ga0114129_10341257 3300009147 Unclassified 1987
282 Ga0114129_10601186 3300009147 Bacteria 1425
283 Ga0114129_10678885 3300009147 Unclassified 1326
284 Ga0114129_11329851 3300009147 Unclassified 889
285 Ga0114129_12322984 3300009147 Bacteria 643
286 Ga0105243_10145046 3300009148 Bacteria 2030
287 Ga0105243_10182668 3300009148 Bacteria 1825
288 Ga0105243_10545627 3300009148 Bacteria 1107
289 Ga0105243_11149257 3300009148 Unclassified 787
290 Ga0105243_11205774 3300009148 Unclassified 770
291 Ga0105241_10799240 3300009174 Bacteria 869
292 Ga0105242_10003405 3300009176 Bacteria 12367
293 Ga0105242_10142350 3300009176 Bacteria 2082
294 Ga0105242_10246450 3300009176 Bacteria 1608
295 Ga0105242_10263971 3300009176 Bacteria 1557
296 Ga0105242_10459796 3300009176 Bacteria 1202
297 Ga0105248_10036273 3300009177 Bacteria 5514
298 Ga0105248_10203524 3300009177 Bacteria 2231
299 Ga0105248_10252430 3300009177 Bacteria 1985
300 Ga0105248_10370785 3300009177 Unclassified 1612
301 Ga0105248_10466773 3300009177 Bacteria 1423
302 Ga0105248_10967486 3300009177 Bacteria 961
303 Ga0105248_11285264 3300009177 Bacteria 828
304 Ga0105248_12072581 3300009177 Unclassified 647
305 Ga0105249_10012175 3300009553 Bacteria 7575
306 Ga0105249_10345122 3300009553 Bacteria 1507
307 Ga0105249_12636839 3300009553 Unclassified 575
308 Ga0099796_10082764 3300010159 Bacteria 1180
309 Ga0105239_12002347 3300010375 Bacteria 672
310 Ga0105246_10505143 3300011119 Bacteria 1027
311 Ga0157378_10239618 3300013297 Bacteria 1732
312 Ga0157378_10243400 3300013297 Bacteria 1719
313 Ga0157378_11828923 3300013297 Unclassified 656
314 Ga0157378_12157689 3300013297 Bacteria 608
315 Ga0157378_12462910 3300013297 Unclassified 572
316 Ga0163162_10096350 3300013306 Bacteria 3047
317 Ga0163162_10179210 3300013306 Bacteria 2245
318 Ga0157372_10227110 3300013307 Bacteria 2164
319 Ga0157372_11734364 3300013307 Bacteria 718
320 Ga0157375_10002605 3300013308 Bacteria 15654
321 Ga0157375_10171475 3300013308 Bacteria 2317
322 Ga0157375_10359266 3300013308 Bacteria 1622
323 Ga0157375_10377499 3300013308 Bacteria 1584
324 Ga0163163_10037770 3300014325 Bacteria 4699
325 Ga0163163_10616231 3300014325 Bacteria 1149
326 Ga0157380_10037251 3300014326 Bacteria 3767
327 Ga0157380_10467495 3300014326 Unclassified 1216
328 Ga0157380_10958032 3300014326 Unclassified 886
329 Ga0157377_10058158 3300014745 Bacteria 2201
330 Ga0157379_10012294 3300014968 Bacteria 7477
331 Ga0157379_10412566 3300014968 Bacteria 1243
332 Ga0157379_11489864 3300014968 Bacteria 658
333 Ga0157376_10034851 3300014969 Bacteria 4067
334 Ga0157376_10141916 3300014969 Unclassified 2156
335 Ga0157376_10484951 3300014969 Bacteria 1212
336 Ga0182005_1148521 3300015265 Bacteria 681
337 Ga0207642_10372977 3300025899 Unclassified 847
338 Ga0207642_10739692 3300025899 Unclassified 622
339 Ga0207710_10078992 3300025900 Bacteria 1523
340 Ga0207710_10223050 3300025900 Bacteria 936
341 Ga0207688_10100206 3300025901 Bacteria 1672
342 Ga0207680_10003047 3300025903 Bacteria 7864
343 Ga0207680_10184829 3300025903 Unclassified 1412
344 Ga0207685_10663284 3300025905 Unclassified 565
345 Ga0207699_10056845 3300025906 Bacteria 2334
346 Ga0207699_10236969 3300025906 Bacteria 1252
347 Ga0207645_10015012 3300025907 Bacteria 5162
348 Ga0207643_10003059 3300025908 Bacteria 8994
349 Ga0207643_10003533 3300025908 Bacteria 8410
350 Ga0207654_10160375 3300025911 Unclassified 1452
351 Ga0207707_10158528 3300025912 Bacteria 1979
352 Ga0207693_10810326 3300025915 Unclassified 721
353 Ga0207660_10540977 3300025917 Unclassified 947
354 Ga0207662_10076280 3300025918 Bacteria 2037
355 Ga0207662_10160184 3300025918 Bacteria 1437
356 Ga0207662_11139563 3300025918 Unclassified 554
357 Ga0207657_10026590 3300025919 Bacteria 5313
358 Ga0207652_10044836 3300025921 Bacteria 3769
359 Ga0207646_10232911 3300025922 Bacteria 1664
360 Ga0207646_10761597 3300025922 Unclassified 864
361 Ga0207681_10001613 3300025923 Bacteria 14545
362 Ga0207681_10006385 3300025923 Bacteria 7238
363 Ga0207681_10020770 3300025923 Unclassified 4166
364 Ga0207681_10221754 3300025923 Unclassified 1463
365 Ga0207681_10562880 3300025923 Bacteria 939
366 Ga0207681_10605508 3300025923 Unclassified 906
367 Ga0207650_10105381 3300025925 Unclassified 2177
368 Ga0207650_10306765 3300025925 Bacteria 1297
369 Ga0207650_10865767 3300025925 Bacteria 767
370 Ga0207659_10177169 3300025926 Unclassified 1686
371 Ga0207659_11710316 3300025926 Unclassified 536
372 Ga0207687_10071059 3300025927 Unclassified 2486
373 Ga0207687_10344747 3300025927 Bacteria 1212
374 Ga0207700_10012994 3300025928 Bacteria 5396
375 Ga0207664_10271190 3300025929 Bacteria 1486
376 Ga0207644_10215835 3300025931 Bacteria 1518
377 Ga0207644_10578671 3300025931 Bacteria 931
378 Ga0207706_10043015 3300025933 Bacteria 4003
379 Ga0207706_10088280 3300025933 Bacteria 2726
380 Ga0207706_10140474 3300025933 Unclassified 2125
381 Ga0207706_10277433 3300025933 Bacteria 1462
382 Ga0207686_10060080 3300025934 Unclassified 2404
383 Ga0207709_10117223 3300025935 Bacteria 1791
384 Ga0207709_10433268 3300025935 Bacteria 1012
385 Ga0207670_10008405 3300025936 Bacteria 5827
386 Ga0207670_10012794 3300025936 Unclassified 4923
387 Ga0207670_10037370 3300025936 Bacteria 3164
388 Ga0207669_10442722 3300025937 Bacteria 1028
389 Ga0207669_10504017 3300025937 Bacteria 969
390 Ga0207669_11080888 3300025937 Bacteria 677
391 Ga0207704_10038785 3300025938 Unclassified 2767
392 Ga0207704_10113790 3300025938 Unclassified 1835
393 Ga0207704_10921979 3300025938 Unclassified 735
394 Ga0207665_10101987 3300025939 Bacteria 2005
395 Ga0207665_10353429 3300025939 Unclassified 1110
396 Ga0207665_10451880 3300025939 Bacteria 986
397 Ga0207691_10003774 3300025940 Bacteria 14711
398 Ga0207691_10060219 3300025940 Unclassified 3450
399 Ga0207691_10189119 3300025940 Bacteria 1796
400 Ga0207691_10863845 3300025940 Unclassified 758
401 Ga0207711_10033096 3300025941 Bacteria 4372
402 Ga0207711_10152869 3300025941 Unclassified 2084
403 Ga0207711_10779599 3300025941 Bacteria 891
404 Ga0207711_11277702 3300025941 Bacteria 676
405 Ga0207689_10279317 3300025942 Unclassified 1383
406 Ga0207679_10081320 3300025945 Unclassified 2477
407 Ga0207679_10790464 3300025945 Unclassified 865
408 Ga0207667_10133590 3300025949 Unclassified 2556
409 Ga0207651_10023303 3300025960 Bacteria 3805
410 Ga0207651_10223638 3300025960 Bacteria 1523
411 Ga0207712_10007323 3300025961 Bacteria 6966
412 Ga0207668_10014395 3300025972 Bacteria 4895
413 Ga0207668_10049380 3300025972 Bacteria 2892
414 Ga0207668_10080879 3300025972 Unclassified 2355
415 Ga0207668_10632155 3300025972 Bacteria 935
416 Ga0207640_10092137 3300025981 Bacteria 2101
417 Ga0207640_10418534 3300025981 Unclassified 1096
418 Ga0207658_10117457 3300025986 Bacteria 2114
419 Ga0207677_10295702 3300026023 Bacteria 1336
420 Ga0207677_10297655 3300026023 Bacteria 1332
421 Ga0207677_10468657 3300026023 Bacteria 1083
422 Ga0207703_10184501 3300026035 Bacteria 1843
423 Ga0207703_10190728 3300026035 Bacteria 1815
424 Ga0207703_10244652 3300026035 Bacteria 1614
425 Ga0207703_10465325 3300026035 Unclassified 1183
426 Ga0207703_11056503 3300026035 Bacteria 780
427 Ga0207678_10559844 3300026067 Bacteria 1000
428 Ga0207678_11499239 3300026067 Bacteria 595
429 Ga0207708_10035033 3300026075 Bacteria 3820
430 Ga0207708_10091229 3300026075 Unclassified 2349
431 Ga0207708_10105502 3300026075 Unclassified 2184
432 Ga0207708_11050039 3300026075 Bacteria 709
433 Ga0207708_11142270 3300026075 Bacteria 680
434 Ga0207641_10003478 3300026088 Bacteria 13952
435 Ga0207641_10199516 3300026088 Bacteria 1844
436 Ga0207648_10001866 3300026089 Bacteria 23037
437 Ga0207648_10025117 3300026089 Bacteria 5312
438 Ga0207648_10057452 3300026089 Unclassified 3395
439 Ga0207648_10817522 3300026089 Bacteria 868
440 Ga0207648_10881518 3300026089 Bacteria 835
441 Ga0207676_10078620 3300026095 Unclassified 2672
442 Ga0207674_10019158 3300026116 Bacteria 7420
443 Ga0207674_10062222 3300026116 Bacteria 3770
444 Ga0207674_10084419 3300026116 Bacteria 3174
445 Ga0207674_10193538 3300026116 Bacteria 1983
446 Ga0207674_10777553 3300026116 Bacteria 924
447 Ga0207675_100015632 3300026118 Bacteria 7078
448 Ga0207675_100048433 3300026118 Unclassified 3967
449 Ga0207675_100061265 3300026118 Unclassified 3513
450 Ga0207675_100084976 3300026118 Bacteria 2970
451 Ga0207675_100167340 3300026118 Bacteria 2100
452 Ga0207675_100169087 3300026118 Bacteria 2089
453 Ga0207675_100181116 3300026118 Bacteria 2018
454 Ga0207675_100275563 3300026118 Unclassified 1633
455 Ga0207683_10707836 3300026121 Bacteria 934
456 Ga0207698_10744277 3300026142 Unclassified 979
457 Ga0207428_10000004 3300027907 Bacteria 727800
458 Ga0207428_10003716 3300027907 Bacteria 14661
459 Ga0207428_10015331 3300027907 Bacteria 6632
460 Ga0207428_10084357 3300027907 Bacteria 2476
461 Ga0207428_10334440 3300027907 Unclassified 1116
462 Ga0207428_10347250 3300027907 Bacteria 1092
463 Ga0207428_11010378 3300027907 Bacteria 584
464 Ga0268266_10007524 3300028379 Bacteria 9815
465 Ga0268266_10347288 3300028379 Bacteria 1394
466 Ga0268265_10000421 3300028380 Bacteria 45504
467 Ga0268265_10019315 3300028380 Bacteria 4734
468 Ga0268265_10043652 3300028380 Unclassified 3334
469 Ga0268265_10129348 3300028380 Bacteria 2095
470 Ga0268265_10324891 3300028380 Bacteria 1395
471 Ga0268265_10411584 3300028380 Bacteria 1253
472 Ga0268265_10966190 3300028380 Bacteria 840
473 Ga0268265_11214484 3300028380 Bacteria 752
474 Ga0268264_10078655 3300028381 Bacteria 2812
475 Ga0268264_10103080 3300028381 Unclassified 2484
476 Ga0268264_10205267 3300028381 Bacteria 1805
477 Ga0268264_10421067 3300028381 Bacteria 1288
478 Ga0268264_10775127 3300028381 Bacteria 957
479 Ga0268264_11278527 3300028381 Unclassified 744
480 Ga0307406_10296600 3300031901 Bacteria 1240
481 Ga0373930_0004773 3300034816 Bacteria 2223
482 Ga0373950_0032529 3300034818 Bacteria 971
483 Ga0373959_0000414 3300034820 Bacteria 8214
484 Ga0373959_0075424 3300034820 Bacteria 769
485 Ga0373928_0001753 3300035084 Bacteria 4223
486 Ga0373929_0000819 3300035085 Bacteria 6060
487 Ga0373940_0000568 3300035088 Bacteria 5844
488 Ga0373940_0045565 3300035088 Bacteria 1218
489 Ga0373949_0001899 3300035090 Bacteria 5653
490 Ga0373951_0001057 3300035091 Bacteria 7396
491 Ga0373952_0001303 3300035092 Bacteria 4561
492 Ga0373952_0056544 3300035092 Unclassified 949
493 Ga0373923_0025960 3300035111 Bacteria 2327
494 Ga0373923_0030845 3300035111 Bacteria 2158
495 Ga0373932_0001327 3300035112 Bacteria 6946
496 Ga0373939_0002741 3300035114 Bacteria 4133
497 Ga0373941_0001420 3300035115 Bacteria 5054
498 Ga0373945_0074619 3300035116 Unclassified 1290
499 Ga0373953_0034209 3300035117 Bacteria 1991
500 Ga0373954_0105903 3300035118 Unclassified 1358
501 Ga0373954_0257278 3300035118 Unclassified 860
502 Ga0373954_0409771 3300035118 Unclassified 670
503 Ga0373956_0074960 3300035119 Bacteria 1547
504 Ga0373960_0000111 3300035121 Bacteria 13140
505 Ga0373960_0240367 3300035121 Bacteria 654
506 Ga0373943_0327640 3300035170 Unclassified 874
507 Ga0373946_0011756 3300035171 Bacteria 3273
508 Ga0373955_0038971 3300035172 Bacteria 2534
509 Ga0373955_0297689 3300035172 Bacteria 972
510 Ga0373942_0000209 3300035207 Bacteria 15209
511 Ga0373961_0002181 3300035241 Bacteria 5194
512 Ga0373962_0011729 3300035242 Bacteria 2200
513 Ga0373962_0069060 3300035242 Bacteria 1052
514 Ga0373924_0131436 3300035410 Bacteria 1089
515 Ga0373931_0002316 3300035691 Bacteria 8414
516 Ga0373935_0047950 3300035692 Bacteria 2703
517 Ga0373935_0060735 3300035692 Unclassified 2418
518 Ga0373935_0150129 3300035692 Bacteria 1581
519 Ga0373935_0366690 3300035692 Bacteria 1029
520 Ga0373935_0772090 3300035692 Unclassified 709
521 Ga0373927_0003122 3300035695 Bacteria 11979
522 Ga0373927_0161115 3300035695 Bacteria 1470
523 Ga0373927_0303384 3300035695 Bacteria 1051
524 Ga0373947_0203911 3300035725 Bacteria 1295
525 Ga0373947_0361599 3300035725 Bacteria 975
526 Ga0373947_0582128 3300035725 Unclassified 762
527 Ga0373937_0024576 3300036401 Bacteria 5436
528 Ga0373937_0024622 3300036401 Bacteria 5430
529 Ga0373937_0649532 3300036401 Bacteria 1000
530 Ga0373925_0007400 3300037068 Bacteria 8011
531 Ga0373925_1352407 3300037068 Bacteria 584
532 Ga0436364_1555357 3300037853 Unclassified 1410
533 Ga0439453_0009770 3300041408 Bacteria 1569
534 Ga0439435_0194826 3300042436 Bacteria 666
535 Ga0439460_0099428 3300042461 Bacteria 933
536 Ga0466963_0249627 3300044694 Bacteria 1245
537 Ga0453684_1753611 3300044712 Bacteria 633
538 Ga0451576_0040683 3300045051 Bacteria 4917
539 Ga0451576_0092252 3300045051 Bacteria 3150
540 Ga0451576_0113585 3300045051 Bacteria 2819
541 Ga0451576_0671639 3300045051 Bacteria 1089
542 Ga0466967_0336347 3300045976 Bacteria 1459
543 Ga0466967_1297180 3300045976 Unclassified 725
544 Ga0495592_0021194 3300046454 Bacteria 4942
545 Ga0495603_0362317 3300046455 Bacteria 832
546 Ga0495591_112438 3300046458 Bacteria 668
547 Ga0495651_0187952 3300046462 Bacteria 1456
548 Ga0495580_0008121 3300046472 Bacteria 8369
549 Ga0495580_0312073 3300046472 Unclassified 1070
550 Ga0495582_0573113 3300046473 Unclassified 653
551 Ga0495664_0175508 3300046477 Bacteria 1300
552 Ga0495594_0354566 3300046499 Bacteria 835
553 Ga0495594_0808988 3300046499 Bacteria 528
554 Ga0495608_0034081 3300046511 Bacteria 3438
555 Ga0495608_0300355 3300046511 Bacteria 994
556 Ga0495618_0477455 3300046514 Unclassified 754
557 Ga0495628_0030887 3300046516 Bacteria 4335
558 Ga0495630_0041023 3300046517 Bacteria 3457
559 Ga0495642_0014190 3300046528 Bacteria 3087
560 Ga0495665_0062789 3300046531 Bacteria 1961
561 Ga0495665_0454600 3300046531 Unclassified 647
562 Ga0495640_0126420 3300046533 Bacteria 1658
563 Ga0495640_0389277 3300046533 Unclassified 857
564 Ga0495587_0057380 3300046536 Bacteria 2289
565 Ga0495598_0140971 3300046537 Bacteria 834
566 Ga0495598_0174964 3300046537 Bacteria 763
567 Ga0495609_0113018 3300046538 Bacteria 1171
568 Ga0495621_0064202 3300046539 Unclassified 1339
569 Ga0495645_0332283 3300046543 Bacteria 984
570 Ga0495633_0358887 3300046558 Bacteria 660
571 Ga0495667_0394504 3300046559 Unclassified 872
572 Ga0495667_0500268 3300046559 Unclassified 761
573 Ga0495656_0636511 3300046615 Unclassified 572
574 Ga0495634_0079911 3300046642 Bacteria 2141
575 Ga0495634_0151009 3300046642 Unclassified 1469
576 Ga0495634_0410910 3300046642 Unclassified 803
577 Ga0495635_0240978 3300046663 Unclassified 1220
578 Ga0495635_0678360 3300046663 Unclassified 669
579 Ga0495659_0059166 3300046664 Bacteria 1411
580 Ga0495659_0389155 3300046664 Bacteria 600
581 Ga0495657_0389104 3300046675 Unclassified 822
582 Ga0495599_0065619 3300046678 Bacteria 2268
583 Ga0495646_0509723 3300046680 Unclassified 617
584 Ga0495647_0017778 3300046681 Bacteria 2521
585 Ga0495647_0467937 3300046681 Unclassified 585
586 Ga0495658_0077931 3300046683 Bacteria 1939
587 Ga0495658_0123757 3300046683 Bacteria 1567
588 Ga0495669_0158542 3300046684 Bacteria 1074
589 Ga0495613_0006776 3300046689 Bacteria 8551
590 Ga0495613_0055291 3300046689 Bacteria 2916
591 Ga0495613_0056038 3300046689 Bacteria 2895
592 Ga0495613_0224044 3300046689 Bacteria 1319
593 Ga0495613_0747537 3300046689 Unclassified 641
594 Ga0495581_0620688 3300047315 Unclassified 626
595 Ga0495604_0092753 3300047317 Unclassified 2236
596 Ga0495636_0412710 3300047318 Bacteria 644
597 Ga0495674_0052885 3300047319 Bacteria 3572
598 Ga0495674_0328178 3300047319 Bacteria 1245
599 Ga0495680_0100190 3300047322 Bacteria 2159
600 Ga0495685_031904 3300047447 Bacteria 1810
601 Ga0495684_0000053 3300047471 Bacteria 82157
602 Ga0495602_0158349 3300048088 Bacteria 1771
603 Ga0496100_0025659 3300048903 Bacteria 3606
604 Ga0496101_0002033 3300048904 Bacteria 12304
605 Ga0496101_0186390 3300048904 Unclassified 1600
606 Ga0496102_0468433 3300048905 Unclassified 1181
607 Ga0496104_0501925 3300048907 Bacteria 1124
608 Ga0496104_0936194 3300048907 Bacteria 771
609 Ga0496105_0853802 3300048908 Bacteria 689
610 Ga0496106_0218693 3300048909 Bacteria 1519
611 Ga0496109_0991075 3300048912 Bacteria 778
612 Ga0496112_0356814 3300048915 Bacteria 1404
613 Ga0496112_1347521 3300048915 Bacteria 629
614 Ga0496114_0000224 3300048917 Bacteria 41100
615 Ga0496114_0439598 3300048917 Unclassified 1155
616 Ga0496114_1261067 3300048917 Unclassified 626
617 Ga0501038_0484195 3300049574 Bacteria 948
618 Ga0501040_0002994 3300049576 Bacteria 10939
619 Ga0501041_0008795 3300049577 Bacteria 5943
620 Ga0501042_0018474 3300049578 Bacteria 4827
621 Ga0501043_0323227 3300049579 Bacteria 1176
622 Ga0501067_0072969 3300049583 Bacteria 1902
623 Ga0501067_0372914 3300049583 Bacteria 796
624 Ga0501077_0291136 3300049593 Bacteria 1040
625 Ga0501081_0173120 3300049743 Bacteria 1559
626 Ga0501045_0253639 3300049824 Bacteria 1309
627 nmdc:mga05p37_1286_c1 3300050507 Bacteria 29122
628 nmdc:mga05p37_1366299_c1 3300050507 Unclassified 716
629 nmdc:mga05p37_1682365_c1 3300050507 Bacteria 620
630 nmdc:mga05p37_2604_c2 3300050507 Bacteria 9380
631 nmdc:mga05p37_33262_c2 3300050507 Unclassified 3829
632 nmdc:mga05p37_51966_c1 3300050507 Bacteria 5039
633 nmdc:mga05p37_98504_c1 3300050507 Bacteria 3601
634 nmdc:mga09592_104089_c1 3300050508 Unclassified 2432
635 nmdc:mga09592_1391206_c1 3300050508 Bacteria 574
636 nmdc:mga09592_57384_c2 3300050508 Unclassified 2837
637 nmdc:mga09592_83643_c1 3300050508 Bacteria 2720
638 nmdc:mga09592_8582_c1 3300050508 Bacteria 8312
639 nmdc:mga0qj67_259059_c1 3300050509 Bacteria 1411
640 nmdc:mga06r32_299855_c1 3300050510 Bacteria 1593
641 nmdc:mga06r32_76337_c1 3300050510 Unclassified 3254
642 nmdc:mga06r32_79019_c1 3300050510 Bacteria 3199
643 nmdc:mga08y16_1456671_c1 3300050511 Unclassified 646
644 nmdc:mga08y16_16989_c1 3300050511 Bacteria 7663
645 nmdc:mga08y16_20147_c1 3300050511 Bacteria 7039
646 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
647 nmdc:mga08y16_527007_c1 3300050511 Bacteria 1198
648 nmdc:mga08y16_56559_c1 3300050511 Bacteria 4099
649 nmdc:mga0n895_1125415_c1 3300050512 Bacteria 762
650 nmdc:mga0n895_1372649_c1 3300050512 Unclassified 676
651 nmdc:mga0n895_155_c1 3300050512 Bacteria 42337
652 nmdc:mga0n895_22134_c1 3300050512 Bacteria 5957
653 nmdc:mga0n895_22949_c1 3300050512 Bacteria 5856
654 nmdc:mga0n895_278071_c1 3300050512 Bacteria 1698
655 nmdc:mga0n895_318284_c1 3300050512 Bacteria 1577
656 nmdc:mga0n895_332434_c1 3300050512 Unclassified 1539
657 nmdc:mga0n895_461514_c1 3300050512 Bacteria 1282
658 nmdc:mga0n895_569327_c1 3300050512 Bacteria 1138
659 nmdc:mga0rr50_110142_c1 3300050513 Bacteria 2178
660 nmdc:mga0rr50_1117979_c1 3300050513 Unclassified 670
661 nmdc:mga0rr50_130271_c1 3300050513 Bacteria 2013
662 nmdc:mga0rr50_147625_c1 3300050513 Bacteria 1897
663 nmdc:mga0rr50_2085_c1 3300050513 Bacteria 11170
664 nmdc:mga0rr50_279927_c1 3300050513 Bacteria 1392
665 nmdc:mga0rr50_421087_c1 3300050513 Bacteria 1130
666 nmdc:mga0rr50_572626_c1 3300050513 Bacteria 962
667 nmdc:mga0rr50_667167_c1 3300050513 Bacteria 887
668 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
669 nmdc:mga08x19_1236723_c1 3300050514 Bacteria 529
670 nmdc:mga08x19_518753_c1 3300050514 Unclassified 842
671 nmdc:mga08x19_6227_c1 3300050514 Bacteria 7060
672 nmdc:mga08x19_705276_c1 3300050514 Bacteria 716
673 nmdc:mga08x19_725289_c1 3300050514 Bacteria 706
674 nmdc:mga08x19_8441_c1 3300050514 Bacteria 6136
675 nmdc:mga0a205_124959_c1 3300050515 Unclassified 2472
676 nmdc:mga0a205_186381_c1 3300050515 Bacteria 1968
677 nmdc:mga0a205_345667_c1 3300050515 Bacteria 1356
678 nmdc:mga0a205_397971_c1 3300050515 Unclassified 1241
679 nmdc:mga0a205_461751_c1 3300050515 Unclassified 1129
680 nmdc:mga0a205_534994_c1 3300050515 Bacteria 1028
681 Ga0495601_0585699 3300053077 Unclassified 716
682 Ga0495595_0037229 3300053084 Unclassified 2211
683 Ga0495595_0152132 3300053084 Unclassified 1139
684 Ga0495619_0000467 3300053085 Bacteria 27272
685 Ga0495619_0115407 3300053085 Bacteria 1838
686 Ga0495619_0400805 3300053085 Bacteria 947
687 Ga0500658_0460415 3300053134 Unclassified 578
688 Ga0501084_0204622 3300054114 Bacteria 1666
689 Ga0530510_0302798 3300061734 Bacteria 1196
690 Ga0207703_10735447
691 Ga0058863_11332999
692 Ga0065704_10304040
693 Ga0065712_10267094
694 Ga0065715_10014205
695 Ga0065715_10105377
696 Ga0065715_10382837
697 Ga0065715_11013547
698 Ga0065715_11157041
699 Ga0065707_10017938
700 Ga0065707_10298169
701 Ga0070676_10019922
702 Ga0070690_100044608
703 Ga0070690_100077917
704 Ga0070690_100098152
705 Ga0070690_100887440
706 Ga0070670_100056545
707 Ga0070670_100192322
708 Ga0068869_100184698
709 Ga0068869_101051464
710 Ga0070666_10005197
711 Ga0070666_10236424
712 Ga0068868_100447393
713 Ga0068868_100497558
714 Ga0068868_101236384
715 Ga0070660_100116064
716 Ga0070660_100409308
717 Ga0070660_100776742
718 Ga0070689_100004437
719 Ga0070689_100007594
720 Ga0070689_100064840
721 Ga0070689_100157305
722 Ga0070689_100176984
723 Ga0070689_100527183
724 Ga0070691_10197266
725 Ga0070691_10365503
726 Ga0070687_100018069
727 Ga0070687_100339225
728 Ga0070692_10069121
729 Ga0070692_10548435
730 Ga0070692_10844625
731 Ga0070692_11090658
732 Ga0070668_100051959
733 Ga0070668_100537392
734 Ga0070668_100746430
735 Ga0070669_100003956
736 Ga0070669_100013215
737 Ga0070669_100067210
738 Ga0070669_100129337
739 Ga0070669_100236595
740 Ga0070675_100000420
741 Ga0070675_100015160
742 Ga0070675_100149811
743 Ga0070675_100681561
744 Ga0070675_100903125
745 Ga0070671_100052813
746 Ga0070671_101453163
747 Ga0070674_100034274
748 Ga0070674_100837878
749 Ga0070673_100063095
750 Ga0070673_100151129
751 Ga0070688_100021695
752 Ga0070688_100025850
753 Ga0070688_100480872
754 Ga0070659_100104759
755 Ga0070659_100914461
756 Ga0070667_100006576
757 Ga0070667_101562284
758 Ga0070703_10102669
759 Ga0070709_10097681
760 Ga0070713_100016406
761 Ga0070713_100851994
762 Ga0070713_102043692
763 Ga0070701_10006396
764 Ga0070701_10116861
765 Ga0070701_10248486
766 Ga0070701_10706231
767 Ga0070711_100323950
768 Ga0070705_100000037
769 Ga0070705_100013278
770 Ga0070705_100035978
771 Ga0070705_100141952
772 Ga0070700_100021963
773 Ga0070700_100073743
774 Ga0070700_100161970
775 Ga0070700_100320739
776 Ga0070694_100001204
777 Ga0070694_100001228
778 Ga0070694_100010891
779 Ga0070694_100020555
780 Ga0070694_100188676
781 Ga0070694_100720437
782 Ga0070694_100932405
783 Ga0070708_100036000
784 Ga0070708_100581769
785 Ga0070708_101184080
786 Ga0070678_100290418
787 Ga0070662_100024350
788 Ga0070662_100090590
789 Ga0070662_100121692
790 Ga0070662_100261771
791 Ga0070662_100912737
792 Ga0070681_10020213
793 Ga0068867_100011482
794 Ga0068867_100048878
795 Ga0068867_101157175
796 Ga0068867_101680530
797 Ga0070706_100418119
798 Ga0070707_100083186
799 Ga0070707_100132105
800 Ga0070707_100322630
801 Ga0070707_100836009
802 Ga0070698_100000929
803 Ga0070698_100052702
804 Ga0070698_100354222
805 Ga0070698_101219248
806 Ga0070699_100002294
807 Ga0070699_100019455
808 Ga0070699_100077668
809 Ga0070699_100088560
810 Ga0070699_101163483
811 Ga0070679_100031839
812 Ga0070684_100581855
813 Ga0070697_100077672
814 Ga0070697_100608516
815 Ga0070697_101257660
816 Ga0070672_100045709
817 Ga0070672_100060990
818 Ga0070672_100264523
819 Ga0070672_101258152
820 Ga0070672_101484802
821 Ga0070686_100678182
822 Ga0070695_100000085
823 Ga0070695_100298064
824 Ga0070695_101123743
825 Ga0070696_100000139
826 Ga0070696_100008917
827 Ga0070696_100207392
828 Ga0070696_100350568
829 Ga0070665_100007666
830 Ga0070665_100171575
831 Ga0070704_100000453
832 Ga0070704_100002706
833 Ga0070704_100025028
834 Ga0070704_100040294
835 Ga0070704_100042174
836 Ga0070704_100444049
837 Ga0070704_100533901
838 Ga0068855_100287927
839 Ga0068855_101133831
840 Ga0070664_100422475
841 Ga0070664_101084422
842 Ga0068857_100001266
843 Ga0068857_100181290
844 Ga0068857_101259772
845 Ga0068854_100016621
846 Ga0068854_101153624
847 Ga0070702_100030815
848 Ga0068852_100870742
849 Ga0068859_100004813
850 Ga0068859_100005036
851 Ga0068859_100011030
852 Ga0068859_100013716
853 Ga0068859_100196467
854 Ga0068859_101539761
855 Ga0068864_100097966
856 Ga0068864_100237196
857 Ga0068864_100479442
858 Ga0068866_10056148
859 Ga0068866_10159885
860 Ga0068866_10378931
861 Ga0068866_11155705
862 Ga0068861_100031278
863 Ga0068861_100096934
864 Ga0068861_100129069
865 Ga0068861_100243105
866 Ga0068861_100728803
867 Ga0068870_10007388
868 Ga0068870_10009645
869 Ga0068863_100030531
870 Ga0068863_100657128
871 Ga0068858_100033758
872 Ga0068858_100037321
873 Ga0068858_100086239
874 Ga0068858_100097790
875 Ga0068858_100534659
876 Ga0068860_100008710
877 Ga0068860_100151514
878 Ga0068860_100452577
879 Ga0068860_100465341
880 Ga0068860_101878042
881 Ga0068862_100006051
882 Ga0068862_100014260
883 Ga0068862_100078254
884 Ga0068862_100727062
885 Ga0070717_10406113
886 Ga0070717_11372256
887 Ga0075432_10070913
888 Ga0070715_10210119
889 Ga0070715_10657774
890 Ga0070716_100336903
891 Ga0070716_100638241
892 Ga0070716_100754377
893 Ga0070712_101009227
894 Ga0097621_100036808
895 Ga0097621_101092074
896 Ga0068871_100055583
897 Ga0068871_100148282
898 Ga0068871_100989659
899 Ga0075428_100000056
900 Ga0075428_100002585
901 Ga0075428_100093273
902 Ga0075428_100236343
903 Ga0075428_100531833
904 Ga0075428_100740949
905 Ga0075428_100825542
906 Ga0075428_100871365
907 Ga0075428_101042020
908 Ga0075428_101205477
909 Ga0075430_100000072
910 Ga0075430_100242321
911 Ga0075430_100479450
912 Ga0075431_100013452
913 Ga0075431_100110346
914 Ga0075431_100364473
915 Ga0075431_101088522
916 Ga0075433_10181092
917 Ga0075433_10186648
918 Ga0075433_10573214
919 Ga0075434_100040479
920 Ga0075434_100043057
921 Ga0075434_100151091
922 Ga0075434_100155144
923 Ga0075434_100184004
924 Ga0075434_100217520
925 Ga0075434_100672911
926 Ga0075434_100761387
927 Ga0075434_101207774
928 Ga0075429_100019241
929 Ga0075429_100094158
930 Ga0075429_100670107
931 Ga0075429_101039023
932 Ga0075429_101556021
933 Ga0068865_100250478
934 Ga0068865_100256718
935 Ga0075436_100017364
936 Ga0075436_100142621
937 Ga0097620_100004814
938 Ga0097620_100005036
939 Ga0097620_100011030
940 Ga0097620_100013716
941 Ga0097620_100025646
942 Ga0097620_100196467
943 Ga0097620_101539729
944 Ga0075435_100000028
945 Ga0075435_100000962
946 Ga0075435_100031431
947 Ga0075435_100052058
948 Ga0075435_100292109
949 Ga0075435_100316552
950 Ga0075435_100476530
951 Ga0075435_100517469
952 Ga0111539_10000002
953 Ga0111539_10008678
954 Ga0111539_10020340
955 Ga0111539_10021656
956 Ga0111539_10043711
957 Ga0105245_10173726
958 Ga0105245_10216535
959 Ga0105245_10344157
960 Ga0105245_11026190
961 Ga0105247_10009886
962 Ga0105247_10048684
963 Ga0114129_10001718
964 Ga0114129_10012031
965 Ga0114129_10022700
966 Ga0114129_10086253
967 Ga0114129_10207764
968 Ga0114129_10208473
969 Ga0114129_10284660
970 Ga0114129_10341257
971 Ga0114129_10601186
972 Ga0114129_10678885
973 Ga0114129_11329851
974 Ga0114129_12322984
975 Ga0105243_10145046
976 Ga0105243_10182668
977 Ga0105243_10545627
978 Ga0105243_11149257
979 Ga0105243_11205774
980 Ga0105241_10799240
981 Ga0105242_10003405
982 Ga0105242_10142350
983 Ga0105242_10246450
984 Ga0105242_10263971
985 Ga0105242_10459796
986 Ga0105248_10036273
987 Ga0105248_10203524
988 Ga0105248_10252430
989 Ga0105248_10370785
990 Ga0105248_10466773
991 Ga0105248_10967486
992 Ga0105248_11285264
993 Ga0105248_12072581
994 Ga0105249_10012175
995 Ga0105249_10345122
996 Ga0105249_12636839
997 Ga0099796_10082764
998 Ga0105239_12002347
999 Ga0105246_10505143
1000 Ga0157378_10239618
1001 Ga0157378_10243400
1002 Ga0157378_11828923
1003 Ga0157378_12157689
1004 Ga0157378_12462910
1005 Ga0163162_10096350
1006 Ga0163162_10179210
1007 Ga0157372_10227110
1008 Ga0157372_11734364
1009 Ga0157375_10002605
1010 Ga0157375_10171475
1011 Ga0157375_10359266
1012 Ga0157375_10377499
1013 Ga0163163_10037770
1014 Ga0163163_10616231
1015 Ga0157380_10037251
1016 Ga0157380_10467495
1017 Ga0157380_10958032
1018 Ga0157377_10058158
1019 Ga0157379_10012294
1020 Ga0157379_10412566
1021 Ga0157379_11489864
1022 Ga0157376_10034851
1023 Ga0157376_10141916
1024 Ga0157376_10484951
1025 Ga0182005_1148521
1026 Ga0207642_10372977
1027 Ga0207642_10739692
1028 Ga0207710_10078992
1029 Ga0207710_10223050
1030 Ga0207688_10100206
1031 Ga0207680_10003047
1032 Ga0207680_10184829
1033 Ga0207685_10663284
1034 Ga0207699_10056845
1035 Ga0207699_10236969
1036 Ga0207645_10015012
1037 Ga0207643_10003059
1038 Ga0207643_10003533
1039 Ga0207654_10160375
1040 Ga0207707_10158528
1041 Ga0207693_10810326
1042 Ga0207660_10540977
1043 Ga0207662_10076280
1044 Ga0207662_10160184
1045 Ga0207662_11139563
1046 Ga0207657_10026590
1047 Ga0207652_10044836
1048 Ga0207646_10232911
1049 Ga0207646_10761597
1050 Ga0207681_10001613
1051 Ga0207681_10006385
1052 Ga0207681_10020770
1053 Ga0207681_10221754
1054 Ga0207681_10562880
1055 Ga0207681_10605508
1056 Ga0207650_10105381
1057 Ga0207650_10306765
1058 Ga0207650_10865767
1059 Ga0207659_10177169
1060 Ga0207659_11710316
1061 Ga0207687_10071059
1062 Ga0207687_10344747
1063 Ga0207700_10012994
1064 Ga0207664_10271190
1065 Ga0207644_10215835
1066 Ga0207644_10578671
1067 Ga0207706_10043015
1068 Ga0207706_10088280
1069 Ga0207706_10140474
1070 Ga0207706_10277433
1071 Ga0207686_10060080
1072 Ga0207709_10117223
1073 Ga0207709_10433268
1074 Ga0207670_10008405
1075 Ga0207670_10012794
1076 Ga0207670_10037370
1077 Ga0207669_10442722
1078 Ga0207669_10504017
1079 Ga0207669_11080888
1080 Ga0207704_10038785
1081 Ga0207704_10113790
1082 Ga0207704_10921979
1083 Ga0207665_10101987
1084 Ga0207665_10353429
1085 Ga0207665_10451880
1086 Ga0207691_10003774
1087 Ga0207691_10060219
1088 Ga0207691_10189119
1089 Ga0207691_10863845
1090 Ga0207711_10033096
1091 Ga0207711_10152869
1092 Ga0207711_10779599
1093 Ga0207711_11277702
1094 Ga0207689_10279317
1095 Ga0207679_10081320
1096 Ga0207679_10790464
1097 Ga0207667_10133590
1098 Ga0207651_10023303
1099 Ga0207651_10223638
1100 Ga0207712_10007323
1101 Ga0207668_10014395
1102 Ga0207668_10049380
1103 Ga0207668_10080879
1104 Ga0207668_10632155
1105 Ga0207640_10092137
1106 Ga0207640_10418534
1107 Ga0207658_10117457
1108 Ga0207677_10295702
1109 Ga0207677_10297655
1110 Ga0207677_10468657
1111 Ga0207703_10184501
1112 Ga0207703_10190728
1113 Ga0207703_10244652
1114 Ga0207703_10465325
1115 Ga0207703_11056503
1116 Ga0207678_10559844
1117 Ga0207678_11499239
1118 Ga0207708_10035033
1119 Ga0207708_10091229
1120 Ga0207708_10105502
1121 Ga0207708_11050039
1122 Ga0207708_11142270
1123 Ga0207641_10003478
1124 Ga0207641_10199516
1125 Ga0207648_10001866
1126 Ga0207648_10025117
1127 Ga0207648_10057452
1128 Ga0207648_10817522
1129 Ga0207648_10881518
1130 Ga0207676_10078620
1131 Ga0207674_10019158
1132 Ga0207674_10062222
1133 Ga0207674_10084419
1134 Ga0207674_10193538
1135 Ga0207674_10777553
1136 Ga0207675_100015632
1137 Ga0207675_100048433
1138 Ga0207675_100061265
1139 Ga0207675_100084976
1140 Ga0207675_100167340
1141 Ga0207675_100169087
1142 Ga0207675_100181116
1143 Ga0207675_100275563
1144 Ga0207683_10707836
1145 Ga0207698_10744277
1146 Ga0207428_10000004
1147 Ga0207428_10003716
1148 Ga0207428_10015331
1149 Ga0207428_10084357
1150 Ga0207428_10334440
1151 Ga0207428_10347250
1152 Ga0207428_11010378
1153 Ga0268266_10007524
1154 Ga0268266_10347288
1155 Ga0268265_10000421
1156 Ga0268265_10019315
1157 Ga0268265_10043652
1158 Ga0268265_10129348
1159 Ga0268265_10324891
1160 Ga0268265_10411584
1161 Ga0268265_10966190
1162 Ga0268265_11214484
1163 Ga0268264_10078655
1164 Ga0268264_10103080
1165 Ga0268264_10205267
1166 Ga0268264_10421067
1167 Ga0268264_10775127
1168 Ga0268264_11278527
1169 Ga0307406_10296600
1170 Ga0373930_0004773
1171 Ga0373950_0032529
1172 Ga0373959_0000414
1173 Ga0373959_0075424
1174 Ga0373928_0001753
1175 Ga0373929_0000819
1176 Ga0373940_0000568
1177 Ga0373940_0045565
1178 Ga0373949_0001899
1179 Ga0373951_0001057
1180 Ga0373952_0001303
1181 Ga0373952_0056544
1182 Ga0373923_0025960
1183 Ga0373923_0030845
1184 Ga0373932_0001327
1185 Ga0373939_0002741
1186 Ga0373941_0001420
1187 Ga0373945_0074619
1188 Ga0373953_0034209
1189 Ga0373954_0105903
1190 Ga0373954_0257278
1191 Ga0373954_0409771
1192 Ga0373956_0074960
1193 Ga0373960_0000111
1194 Ga0373960_0240367
1195 Ga0373943_0327640
1196 Ga0373946_0011756
1197 Ga0373955_0038971
1198 Ga0373955_0297689
1199 Ga0373942_0000209
1200 Ga0373961_0002181
1201 Ga0373962_0011729
1202 Ga0373962_0069060
1203 Ga0373924_0131436
1204 Ga0373931_0002316
1205 Ga0373935_0047950
1206 Ga0373935_0060735
1207 Ga0373935_0150129
1208 Ga0373935_0366690
1209 Ga0373935_0772090
1210 Ga0373927_0003122
1211 Ga0373927_0161115
1212 Ga0373927_0303384
1213 Ga0373947_0203911
1214 Ga0373947_0361599
1215 Ga0373947_0582128
1216 Ga0373937_0024576
1217 Ga0373937_0024622
1218 Ga0373937_0649532
1219 Ga0373925_0007400
1220 Ga0373925_1352407
1221 Ga0436364_1555357
1222 Ga0439453_0009770
1223 Ga0439435_0194826
1224 Ga0439460_0099428
1225 Ga0466963_0249627
1226 Ga0453684_1753611
1227 Ga0451576_0040683
1228 Ga0451576_0092252
1229 Ga0451576_0113585
1230 Ga0451576_0671639
1231 Ga0466967_0336347
1232 Ga0466967_1297180
1233 Ga0495592_0021194
1234 Ga0495603_0362317
1235 Ga0495591_112438
1236 Ga0495651_0187952
1237 Ga0495580_0008121
1238 Ga0495580_0312073
1239 Ga0495582_0573113
1240 Ga0495664_0175508
1241 Ga0495594_0354566
1242 Ga0495594_0808988
1243 Ga0495608_0034081
1244 Ga0495608_0300355
1245 Ga0495618_0477455
1246 Ga0495628_0030887
1247 Ga0495630_0041023
1248 Ga0495642_0014190
1249 Ga0495665_0062789
1250 Ga0495665_0454600
1251 Ga0495640_0126420
1252 Ga0495640_0389277
1253 Ga0495587_0057380
1254 Ga0495598_0140971
1255 Ga0495598_0174964
1256 Ga0495609_0113018
1257 Ga0495621_0064202
1258 Ga0495645_0332283
1259 Ga0495633_0358887
1260 Ga0495667_0394504
1261 Ga0495667_0500268
1262 Ga0495656_0636511
1263 Ga0495634_0079911
1264 Ga0495634_0151009
1265 Ga0495634_0410910
1266 Ga0495635_0240978
1267 Ga0495635_0678360
1268 Ga0495659_0059166
1269 Ga0495659_0389155
1270 Ga0495657_0389104
1271 Ga0495599_0065619
1272 Ga0495646_0509723
1273 Ga0495647_0017778
1274 Ga0495647_0467937
1275 Ga0495658_0077931
1276 Ga0495658_0123757
1277 Ga0495669_0158542
1278 Ga0495613_0006776
1279 Ga0495613_0055291
1280 Ga0495613_0056038
1281 Ga0495613_0224044
1282 Ga0495613_0747537
1283 Ga0495581_0620688
1284 Ga0495604_0092753
1285 Ga0495636_0412710
1286 Ga0495674_0052885
1287 Ga0495674_0328178
1288 Ga0495680_0100190
1289 Ga0495685_031904
1290 Ga0495684_0000053
1291 Ga0495602_0158349
1292 Ga0496100_0025659
1293 Ga0496101_0002033
1294 Ga0496101_0186390
1295 Ga0496102_0468433
1296 Ga0496104_0501925
1297 Ga0496104_0936194
1298 Ga0496105_0853802
1299 Ga0496106_0218693
1300 Ga0496109_0991075
1301 Ga0496112_0356814
1302 Ga0496112_1347521
1303 Ga0496114_0000224
1304 Ga0496114_0439598
1305 Ga0496114_1261067
1306 Ga0501038_0484195
1307 Ga0501040_0002994
1308 Ga0501041_0008795
1309 Ga0501042_0018474
1310 Ga0501043_0323227
1311 Ga0501067_0072969
1312 Ga0501067_0372914
1313 Ga0501077_0291136
1314 Ga0501081_0173120
1315 Ga0501045_0253639
1316 nmdc:mga05p37_1286_c1
1317 nmdc:mga05p37_1366299_c1
1318 nmdc:mga05p37_1682365_c1
1319 nmdc:mga05p37_2604_c2
1320 nmdc:mga05p37_33262_c2
1321 nmdc:mga05p37_51966_c1
1322 nmdc:mga05p37_98504_c1
1323 nmdc:mga09592_104089_c1
1324 nmdc:mga09592_1391206_c1
1325 nmdc:mga09592_57384_c2
1326 nmdc:mga09592_83643_c1
1327 nmdc:mga09592_8582_c1
1328 nmdc:mga0qj67_259059_c1
1329 nmdc:mga06r32_299855_c1
1330 nmdc:mga06r32_76337_c1
1331 nmdc:mga06r32_79019_c1
1332 nmdc:mga08y16_1456671_c1
1333 nmdc:mga08y16_16989_c1
1334 nmdc:mga08y16_20147_c1
1335 nmdc:mga08y16_2_c1
1336 nmdc:mga08y16_527007_c1
1337 nmdc:mga08y16_56559_c1
1338 nmdc:mga0n895_1125415_c1
1339 nmdc:mga0n895_1372649_c1
1340 nmdc:mga0n895_155_c1
1341 nmdc:mga0n895_22134_c1
1342 nmdc:mga0n895_22949_c1
1343 nmdc:mga0n895_278071_c1
1344 nmdc:mga0n895_318284_c1
1345 nmdc:mga0n895_332434_c1
1346 nmdc:mga0n895_461514_c1
1347 nmdc:mga0n895_569327_c1
1348 nmdc:mga0rr50_110142_c1
1349 nmdc:mga0rr50_1117979_c1
1350 nmdc:mga0rr50_130271_c1
1351 nmdc:mga0rr50_147625_c1
1352 nmdc:mga0rr50_2085_c1
1353 nmdc:mga0rr50_279927_c1
1354 nmdc:mga0rr50_421087_c1
1355 nmdc:mga0rr50_572626_c1
1356 nmdc:mga0rr50_667167_c1
1357 nmdc:mga0rr50_8_c1
1358 nmdc:mga08x19_1236723_c1
1359 nmdc:mga08x19_518753_c1
1360 nmdc:mga08x19_6227_c1
1361 nmdc:mga08x19_705276_c1
1362 nmdc:mga08x19_725289_c1
1363 nmdc:mga08x19_8441_c1
1364 nmdc:mga0a205_124959_c1
1365 nmdc:mga0a205_186381_c1
1366 nmdc:mga0a205_345667_c1
1367 nmdc:mga0a205_397971_c1
1368 nmdc:mga0a205_461751_c1
1369 nmdc:mga0a205_534994_c1
1370 Ga0495601_0585699
1371 Ga0495595_0037229
1372 Ga0495595_0152132
1373 Ga0495619_0000467
1374 Ga0495619_0115407
1375 Ga0495619_0400805
1376 Ga0500658_0460415
1377 Ga0501084_0204622
1378 Ga0530510_0302798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

88

161

0.92

PF12973

Cupin_7

ChrR Cupin-like domain

55

167

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9197 57 132
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9179 57 135
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.9049 57 136
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.8938 59 132
3c3v-assembly1.cif.gz_A crystal structure of peanut major allergen ara h 3 0.8904 57 132
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9197 57 132 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9012 57 135 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8938 59 132 2.60.120.10
af_A1YQH2_38_212_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8856 57 132 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8847 57 144 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2XCV7-F1-model_v4 Cupin domain-containing protein 0.9552 54 147
AF-A0A255R774-F1-model_v4 Cupin type-2 domain-containing protein 0.9537 55 147
AF-L8MH88-F1-model_v4 deleted 0.9533 57 147
AF-A0A0N9XF37-F1-model_v4 Cupin type-2 domain-containing protein 0.9498 54 147
AF-K2SC26-F1-model_v4 Cupin RmlC-type 0.9487 53 137

Map