F475334

General Info

Members Datasets Scaffolds Average Seq Length
688 236 1376 138

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10915482|Ga0207679_109154821
Length 163
Sequence VRSAARLLVRDRPAAPLRPEKGDAMRTELGILAACGLLVVSAAPAFAHHAFNAEFDANKPVRFQGTITKMLWVNPHAWIYVDVKKPDGTVEEWMIETGTPNTLLRRGFTRESLKTGTLITVDGYQSKDGSLRANGRDLTLPDGKTLFLGSSGTGAPYEDKSKK

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 29.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10915482 3300025945 Unclassified 802
2 JGI24750J21931_1010374 3300002070 Bacteria 1213
3 JGI24035J26624_1035225 3300002126 Bacteria 552
4 JGI25406J46586_10000709 3300003203 Bacteria 15581
5 Ga0065704_10127228 3300005289 Unclassified 1678
6 Ga0065704_10202076 3300005289 Bacteria 1142
7 Ga0065712_10024491 3300005290 Bacteria 1770
8 Ga0065715_10037993 3300005293 Bacteria 1611
9 Ga0065715_10204242 3300005293 Bacteria 1345
10 Ga0065715_10472212 3300005293 Bacteria 805
11 Ga0065707_10015978 3300005295 Bacteria 2549
12 Ga0065707_10045640 3300005295 Bacteria 801
13 Ga0065707_10124720 3300005295 Unclassified 2029
14 Ga0065707_10269842 3300005295 Unclassified 1074
15 Ga0065707_10671057 3300005295 Unclassified 653
16 Ga0070676_10015523 3300005328 Bacteria 4202
17 Ga0070676_10017549 3300005328 Bacteria 3960
18 Ga0070690_100015608 3300005330 Bacteria 4536
19 Ga0070690_100035546 3300005330 Bacteria 3127
20 Ga0070670_100011285 3300005331 Bacteria 7637
21 Ga0070670_100042367 3300005331 Unclassified 3913
22 Ga0070677_10172982 3300005333 Bacteria 1022
23 Ga0070677_10179241 3300005333 Unclassified 1008
24 Ga0068869_100007346 3300005334 Bacteria 7032
25 Ga0068869_100086973 3300005334 Bacteria 2344
26 Ga0068869_100642900 3300005334 Unclassified 900
27 Ga0070666_10016833 3300005335 Unclassified 4681
28 Ga0070666_10192451 3300005335 Unclassified 1433
29 Ga0070666_10219447 3300005335 Bacteria 1341
30 Ga0070666_10343494 3300005335 Bacteria 1067
31 Ga0070666_10703712 3300005335 Bacteria 741
32 Ga0070682_100734981 3300005337 Bacteria 795
33 Ga0070689_100297987 3300005340 Bacteria 1342
34 Ga0070689_100856163 3300005340 Bacteria 802
35 Ga0070691_10051537 3300005341 Unclassified 1966
36 Ga0070691_10403143 3300005341 Bacteria 771
37 Ga0070661_100021249 3300005344 Bacteria 4633
38 Ga0070661_100984335 3300005344 Bacteria 699
39 Ga0070692_10248921 3300005345 Bacteria 1063
40 Ga0070692_10967502 3300005345 Bacteria 593
41 Ga0070668_100067682 3300005347 Unclassified 2775
42 Ga0070668_100221821 3300005347 Bacteria 1560
43 Ga0070668_100256588 3300005347 Bacteria 1453
44 Ga0070668_100548911 3300005347 Bacteria 1005
45 Ga0070669_100009904 3300005353 Bacteria 6787
46 Ga0070669_100042666 3300005353 Bacteria 3301
47 Ga0070669_100080299 3300005353 Bacteria 2427
48 Ga0070669_100112137 3300005353 Bacteria 2071
49 Ga0070669_100178369 3300005353 Unclassified 1660
50 Ga0070669_100288990 3300005353 Unclassified 1315
51 Ga0070669_100392443 3300005353 Viruses 1134
52 Ga0070675_100001899 3300005354 Bacteria 15415
53 Ga0070675_100028300 3300005354 Bacteria 4511
54 Ga0070675_100030823 3300005354 Unclassified 4331
55 Ga0070675_100034055 3300005354 Unclassified 4132
56 Ga0070675_100158647 3300005354 Bacteria 1944
57 Ga0070675_100285058 3300005354 Bacteria 1452
58 Ga0070671_100004920 3300005355 Bacteria 10638
59 Ga0070671_100511809 3300005355 Unclassified 1033
60 Ga0070671_100677453 3300005355 Bacteria 894
61 Ga0070671_101868582 3300005355 Unclassified 534
62 Ga0070674_100000714 3300005356 Bacteria 16924
63 Ga0070674_100368237 3300005356 Bacteria 1165
64 Ga0070674_100425270 3300005356 Bacteria 1091
65 Ga0070674_100764306 3300005356 Bacteria 831
66 Ga0070673_100011201 3300005364 Bacteria 6115
67 Ga0070673_100034165 3300005364 Unclassified 3845
68 Ga0070673_100038041 3300005364 Bacteria 3671
69 Ga0070673_100131388 3300005364 Bacteria 2101
70 Ga0070673_100188308 3300005364 Bacteria 1771
71 Ga0070673_100215320 3300005364 Bacteria 1660
72 Ga0070673_101010348 3300005364 Bacteria 775
73 Ga0070688_100099881 3300005365 Bacteria 1911
74 Ga0070688_100221750 3300005365 Unclassified 1333
75 Ga0070659_100029589 3300005366 Unclassified 4234
76 Ga0070667_100021006 3300005367 Bacteria 5424
77 Ga0070667_100851329 3300005367 Bacteria 848
78 Ga0070709_10299889 3300005434 Bacteria 1173
79 Ga0070710_10260091 3300005437 Bacteria 1119
80 Ga0070701_10008665 3300005438 Bacteria 4413
81 Ga0070701_10059504 3300005438 Bacteria 2009
82 Ga0070701_10095300 3300005438 Bacteria 1639
83 Ga0070701_10144294 3300005438 Unclassified 1365
84 Ga0070701_10771883 3300005438 Bacteria 653
85 Ga0070711_100033569 3300005439 Bacteria 3417
86 Ga0070705_100008639 3300005440 Bacteria 5045
87 Ga0070705_100034224 3300005440 Bacteria 2839
88 Ga0070705_100426246 3300005440 Bacteria 989
89 Ga0070705_101158632 3300005440 Unclassified 635
90 Ga0070700_100005844 3300005441 Bacteria 6532
91 Ga0070700_100092770 3300005441 Bacteria 1974
92 Ga0070700_100385311 3300005441 Bacteria 1050
93 Ga0070700_100414192 3300005441 Bacteria 1017
94 Ga0070694_100383738 3300005444 Bacteria 1096
95 Ga0070694_100472285 3300005444 Unclassified 994
96 Ga0070694_100530800 3300005444 Unclassified 940
97 Ga0070694_100544260 3300005444 Unclassified 929
98 Ga0070694_100737041 3300005444 Bacteria 804
99 Ga0070708_100267117 3300005445 Bacteria 1609
100 Ga0070708_101295656 3300005445 Bacteria 681
101 Ga0070708_101375425 3300005445 Bacteria 659
102 Ga0070663_100680102 3300005455 Unclassified 873
103 Ga0070678_100012814 3300005456 Bacteria 5230
104 Ga0070678_100076614 3300005456 Bacteria 2520
105 Ga0070678_100185953 3300005456 Bacteria 1705
106 Ga0070678_100485511 3300005456 Bacteria 1088
107 Ga0070678_101221450 3300005456 Bacteria 698
108 Ga0070662_100017995 3300005457 Unclassified 4773
109 Ga0070662_100409914 3300005457 Bacteria 1119
110 Ga0070662_100704086 3300005457 Unclassified 855
111 Ga0068867_100009367 3300005459 Bacteria 6912
112 Ga0068867_100622536 3300005459 Bacteria 944
113 Ga0068867_100825088 3300005459 Unclassified 829
114 Ga0070685_10038060 3300005466 Unclassified 2727
115 Ga0070706_100857473 3300005467 Bacteria 840
116 Ga0070706_101492574 3300005467 Unclassified 618
117 Ga0070706_101789128 3300005467 Bacteria 559
118 Ga0070707_100020146 3300005468 Bacteria 6289
119 Ga0070707_100094209 3300005468 Bacteria 2900
120 Ga0070707_100146710 3300005468 Bacteria 2297
121 Ga0070707_101206427 3300005468 Unclassified 723
122 Ga0070698_100069574 3300005471 Bacteria 3533
123 Ga0070698_101496418 3300005471 Unclassified 626
124 Ga0070699_100576755 3300005518 Unclassified 1025
125 Ga0070699_100846114 3300005518 Bacteria 838
126 Ga0070699_101339295 3300005518 Bacteria 657
127 Ga0070679_102058940 3300005530 Unclassified 520
128 Ga0070697_100043544 3300005536 Unclassified 3635
129 Ga0070697_100335421 3300005536 Unclassified 1304
130 Ga0070697_101283439 3300005536 Bacteria 653
131 Ga0068853_100403961 3300005539 Bacteria 1279
132 Ga0070672_100001421 3300005543 Bacteria 14794
133 Ga0070672_100064952 3300005543 Unclassified 2885
134 Ga0070672_100147516 3300005543 Bacteria 1944
135 Ga0070672_100199372 3300005543 Bacteria 1673
136 Ga0070672_100718218 3300005543 Unclassified 875
137 Ga0070672_100867014 3300005543 Unclassified 796
138 Ga0070686_100064518 3300005544 Bacteria 2376
139 Ga0070686_100132447 3300005544 Bacteria 1726
140 Ga0070686_100225783 3300005544 Bacteria 1356
141 Ga0070686_100397876 3300005544 Unclassified 1047
142 Ga0070686_100429447 3300005544 Bacteria 1011
143 Ga0070686_100807420 3300005544 Unclassified 757
144 Ga0070695_100092733 3300005545 Bacteria 2020
145 Ga0070695_101128319 3300005545 Bacteria 643
146 Ga0070696_100097022 3300005546 Bacteria 2107
147 Ga0070696_100300805 3300005546 Unclassified 1229
148 Ga0070696_101285317 3300005546 Bacteria 621
149 Ga0070693_101046023 3300005547 Bacteria 620
150 Ga0070693_101264971 3300005547 Unclassified 569
151 Ga0070665_100033300 3300005548 Bacteria 5185
152 Ga0070704_100010487 3300005549 Bacteria 5640
153 Ga0070704_100162697 3300005549 Bacteria 1766
154 Ga0070704_100195330 3300005549 Bacteria 1630
155 Ga0070704_100312425 3300005549 Unclassified 1314
156 Ga0068855_100174293 3300005563 Bacteria 2434
157 Ga0070664_100027425 3300005564 Bacteria 4733
158 Ga0070664_100477600 3300005564 Unclassified 1147
159 Ga0070664_100534555 3300005564 Bacteria 1083
160 Ga0068857_100210897 3300005577 Bacteria 1772
161 Ga0068854_100603706 3300005578 Bacteria 937
162 Ga0068854_101381024 3300005578 Unclassified 636
163 Ga0068856_100742128 3300005614 Unclassified 1002
164 Ga0070702_100084830 3300005615 Bacteria 1906
165 Ga0070702_100115038 3300005615 Bacteria 1675
166 Ga0070702_100258970 3300005615 Bacteria 1183
167 Ga0070702_101868377 3300005615 Unclassified 503
168 Ga0068859_100023135 3300005617 Bacteria 6234
169 Ga0068859_100100939 3300005617 Bacteria 2942
170 Ga0068859_100422633 3300005617 Bacteria 1429
171 Ga0068859_100613386 3300005617 Bacteria 1181
172 Ga0068859_100890325 3300005617 Unclassified 975
173 Ga0068859_101135313 3300005617 Bacteria 860
174 Ga0068859_101153634 3300005617 Unclassified 853
175 Ga0068859_101683737 3300005617 Viruses 701
176 Ga0068864_100044624 3300005618 Bacteria 3801
177 Ga0068864_100342099 3300005618 Bacteria 1410
178 Ga0068864_100409738 3300005618 Bacteria 1289
179 Ga0068864_100513030 3300005618 Bacteria 1155
180 Ga0068864_101015989 3300005618 Bacteria 823
181 Ga0068864_101909323 3300005618 Unclassified 599
182 Ga0068866_10084240 3300005718 Bacteria 1715
183 Ga0068866_10146098 3300005718 Bacteria 1364
184 Ga0068866_10454135 3300005718 Bacteria 839
185 Ga0068861_100011692 3300005719 Bacteria 6107
186 Ga0068861_100020770 3300005719 Bacteria 4708
187 Ga0068861_100185486 3300005719 Bacteria 1735
188 Ga0068861_100244113 3300005719 Bacteria 1529
189 Ga0068861_100961606 3300005719 Unclassified 813
190 Ga0068861_102055741 3300005719 Unclassified 571
191 Ga0068870_10052247 3300005840 Bacteria 2166
192 Ga0068870_10113001 3300005840 Bacteria 1554
193 Ga0068870_10531821 3300005840 Bacteria 789
194 Ga0068870_10560559 3300005840 Bacteria 771
195 Ga0068863_100218703 3300005841 Unclassified 1835
196 Ga0068863_100272307 3300005841 Bacteria 1639
197 Ga0068863_100287090 3300005841 Bacteria 1595
198 Ga0068863_101333722 3300005841 Unclassified 725
199 Ga0068858_100000554 3300005842 Bacteria 38982
200 Ga0068858_100002848 3300005842 Bacteria 17391
201 Ga0068858_100012866 3300005842 Bacteria 7891
202 Ga0068858_100072399 3300005842 Unclassified 3198
203 Ga0068858_100219677 3300005842 Bacteria 1800
204 Ga0068858_100882978 3300005842 Unclassified 874
205 Ga0068858_101282699 3300005842 Unclassified 721
206 Ga0068860_100037777 3300005843 Bacteria 4621
207 Ga0068860_100137580 3300005843 Bacteria 2346
208 Ga0068860_100813618 3300005843 Unclassified 948
209 Ga0068860_101270426 3300005843 Bacteria 757
210 Ga0068860_101529685 3300005843 Bacteria 689
211 Ga0068860_101871471 3300005843 Unclassified 622
212 Ga0068862_100014641 3300005844 Bacteria 6515
213 Ga0068862_100204181 3300005844 Bacteria 1783
214 Ga0068862_100339563 3300005844 Unclassified 1391
215 Ga0068862_101051435 3300005844 Unclassified 807
216 Ga0068862_101111576 3300005844 Unclassified 786
217 Ga0068862_101321840 3300005844 Unclassified 722
218 Ga0081539_10000025 3300005985 Bacteria 340255
219 Ga0097621_100002462 3300006237 Bacteria 12674
220 Ga0097621_100074339 3300006237 Bacteria 2815
221 Ga0097621_100118408 3300006237 Bacteria 2245
222 Ga0097621_100197290 3300006237 Bacteria 1746
223 Ga0097621_101629305 3300006237 Bacteria 614
224 Ga0068871_100005019 3300006358 Bacteria 9244
225 Ga0068871_100016320 3300006358 Bacteria 5590
226 Ga0068871_100048242 3300006358 Bacteria 3437
227 Ga0068871_100166775 3300006358 Bacteria 1886
228 Ga0068871_100992122 3300006358 Unclassified 782
229 Ga0068871_101763885 3300006358 Bacteria 587
230 Ga0075428_100026119 3300006844 Bacteria 6466
231 Ga0075428_100065930 3300006844 Bacteria 3965
232 Ga0075428_100081099 3300006844 Unclassified 3541
233 Ga0075428_100976974 3300006844 Bacteria 897
234 Ga0075430_100011124 3300006846 Bacteria 7628
235 Ga0075430_100040707 3300006846 Bacteria 3933
236 Ga0075430_100052268 3300006846 Bacteria 3441
237 Ga0075430_100119096 3300006846 Unclassified 2201
238 Ga0075431_100000430 3300006847 Bacteria 34249
239 Ga0075431_100020688 3300006847 Bacteria 6724
240 Ga0075431_100099964 3300006847 Bacteria 2993
241 Ga0075431_100130935 3300006847 Bacteria 2587
242 Ga0075431_100590892 3300006847 Unclassified 1095
243 Ga0075433_10000380 3300006852 Bacteria 28067
244 Ga0075433_10000468 3300006852 Bacteria 26291
245 Ga0075433_10000617 3300006852 Bacteria 23739
246 Ga0075433_10095425 3300006852 Bacteria 2632
247 Ga0075433_10915907 3300006852 Bacteria 764
248 Ga0075433_11219348 3300006852 Unclassified 653
249 Ga0075434_100000225 3300006871 Bacteria 38685
250 Ga0075434_100012536 3300006871 Bacteria 8039
251 Ga0075434_100012808 3300006871 Bacteria 7961
252 Ga0075434_100039874 3300006871 Unclassified 4651
253 Ga0075434_100053923 3300006871 Unclassified 3994
254 Ga0075434_100064536 3300006871 Unclassified 3646
255 Ga0075434_100133487 3300006871 Bacteria 2502
256 Ga0075434_100181099 3300006871 Unclassified 2127
257 Ga0075434_100193822 3300006871 Bacteria 2052
258 Ga0075434_100318456 3300006871 Bacteria 1576
259 Ga0075434_100334753 3300006871 Bacteria 1534
260 Ga0075434_100459037 3300006871 Bacteria 1295
261 Ga0075434_100624247 3300006871 Unclassified 1096
262 Ga0075429_100023114 3300006880 Bacteria 5391
263 Ga0075429_100025855 3300006880 Bacteria 5096
264 Ga0075429_100048632 3300006880 Bacteria 3688
265 Ga0075429_100102676 3300006880 Bacteria 2496
266 Ga0075429_100179429 3300006880 Bacteria 1856
267 Ga0075429_100410414 3300006880 Bacteria 1186
268 Ga0068865_100006786 3300006881 Bacteria 7007
269 Ga0068865_100137065 3300006881 Bacteria 1841
270 Ga0075436_100068792 3300006914 Bacteria 2446
271 Ga0075436_100375858 3300006914 Bacteria 1027
272 Ga0075436_100637211 3300006914 Bacteria 787
273 Ga0097620_100023129 3300006931 Bacteria 6234
274 Ga0097620_100100936 3300006931 Bacteria 2942
275 Ga0097620_100422619 3300006931 Bacteria 1429
276 Ga0097620_100613351 3300006931 Bacteria 1181
277 Ga0097620_100890373 3300006931 Unclassified 975
278 Ga0097620_101135598 3300006931 Bacteria 860
279 Ga0097620_101153370 3300006931 Unclassified 853
280 Ga0097620_101683572 3300006931 Viruses 701
281 Ga0075435_100009503 3300007076 Bacteria 7045
282 Ga0075435_100102751 3300007076 Bacteria 2370
283 Ga0075435_100221891 3300007076 Bacteria 1605
284 Ga0075435_100229681 3300007076 Unclassified 1576
285 Ga0099794_10062256 3300007265 Bacteria 1814
286 Ga0099794_10142478 3300007265 Bacteria 1214
287 Ga0111539_10001810 3300009094 Bacteria 28468
288 Ga0111539_10002807 3300009094 Bacteria 23140
289 Ga0111539_10004390 3300009094 Bacteria 18452
290 Ga0111539_10015291 3300009094 Bacteria 9561
291 Ga0111539_10025985 3300009094 Bacteria 7166
292 Ga0111539_10034053 3300009094 Bacteria 6180
293 Ga0111539_10473768 3300009094 Bacteria 1458
294 Ga0111539_10801105 3300009094 Unclassified 1096
295 Ga0105245_10041126 3300009098 Bacteria 4120
296 Ga0105245_11365218 3300009098 Bacteria 758
297 Ga0105245_12655908 3300009098 Unclassified 554
298 Ga0105247_10028032 3300009101 Bacteria 3406
299 Ga0105247_10047679 3300009101 Unclassified 2631
300 Ga0105247_10160338 3300009101 Bacteria 1489
301 Ga0114129_10006674 3300009147 Bacteria 16392
302 Ga0114129_10008050 3300009147 Bacteria 15019
303 Ga0114129_10012190 3300009147 Bacteria 12231
304 Ga0114129_10022721 3300009147 Bacteria 8894
305 Ga0114129_10047211 3300009147 Bacteria 6052
306 Ga0114129_10049823 3300009147 Bacteria 5884
307 Ga0114129_10081276 3300009147 Bacteria 4504
308 Ga0114129_10196158 3300009147 Bacteria 2738
309 Ga0114129_10817284 3300009147 Bacteria 1188
310 Ga0114129_12739685 3300009147 Unclassified 587
311 Ga0105243_10023122 3300009148 Bacteria 4728
312 Ga0105243_10190778 3300009148 Bacteria 1790
313 Ga0105243_10986324 3300009148 Bacteria 844
314 Ga0105241_10058469 3300009174 Bacteria 2961
315 Ga0105241_11028041 3300009174 Bacteria 772
316 Ga0105242_10007816 3300009176 Bacteria 8230
317 Ga0105242_10349392 3300009176 Unclassified 1365
318 Ga0105248_10015869 3300009177 Bacteria 8299
319 Ga0105248_10092502 3300009177 Bacteria 3406
320 Ga0105248_10360139 3300009177 Bacteria 1638
321 Ga0105248_10365929 3300009177 Unclassified 1623
322 Ga0105248_10824712 3300009177 Bacteria 1047
323 Ga0105248_11227475 3300009177 Unclassified 848
324 Ga0105248_11856852 3300009177 Bacteria 684
325 Ga0105248_11987752 3300009177 Unclassified 660
326 Ga0105238_10017744 3300009551 Bacteria 7236
327 Ga0105238_11011750 3300009551 Unclassified 852
328 Ga0105249_10002628 3300009553 Bacteria 15554
329 Ga0105249_10585640 3300009553 Unclassified 1169
330 Ga0105249_10888312 3300009553 Unclassified 958
331 Ga0105249_11409560 3300009553 Unclassified 769
332 Ga0105246_10108677 3300011119 Bacteria 2033
333 Ga0105246_10341701 3300011119 Bacteria 1224
334 Ga0105246_10595013 3300011119 Unclassified 955
335 Ga0105246_10642880 3300011119 Bacteria 922
336 Ga0157315_1007077 3300012508 Bacteria 898
337 Ga0157374_10619154 3300013296 Unclassified 1093
338 Ga0157378_10007010 3300013297 Bacteria 9834
339 Ga0157378_10824536 3300013297 Unclassified 955
340 Ga0157378_11462731 3300013297 Bacteria 727
341 Ga0163162_10142797 3300013306 Unclassified 2508
342 Ga0163162_10434250 3300013306 Bacteria 1445
343 Ga0163162_11628497 3300013306 Unclassified 736
344 Ga0157372_10257743 3300013307 Bacteria 2025
345 Ga0157375_10112638 3300013308 Bacteria 2821
346 Ga0157375_10208518 3300013308 Bacteria 2111
347 Ga0157375_10474619 3300013308 Bacteria 1416
348 Ga0157375_12190092 3300013308 Unclassified 658
349 Ga0163163_10025411 3300014325 Bacteria 5646
350 Ga0163163_10086089 3300014325 Bacteria 3151
351 Ga0163163_10130564 3300014325 Bacteria 2552
352 Ga0163163_10607806 3300014325 Bacteria 1157
353 Ga0157380_10005290 3300014326 Bacteria 9022
354 Ga0157380_10055083 3300014326 Bacteria 3157
355 Ga0157380_10098682 3300014326 Bacteria 2427
356 Ga0157380_11965412 3300014326 Unclassified 646
357 Ga0157380_12653776 3300014326 Unclassified 567
358 Ga0157377_10021959 3300014745 Unclassified 3365
359 Ga0157377_10136512 3300014745 Unclassified 1503
360 Ga0157377_10520157 3300014745 Bacteria 835
361 Ga0157377_10633263 3300014745 Bacteria 767
362 Ga0157379_10010849 3300014968 Bacteria 7945
363 Ga0157379_10948066 3300014968 Unclassified 818
364 Ga0157379_10995811 3300014968 Unclassified 799
365 Ga0157379_11163647 3300014968 Bacteria 741
366 Ga0157376_10100118 3300014969 Bacteria 2530
367 Ga0157376_11288134 3300014969 Bacteria 761
368 Ga0157376_11319457 3300014969 Unclassified 752
369 Ga0157376_11559050 3300014969 Unclassified 694
370 Ga0157376_11602261 3300014969 Bacteria 685
371 Ga0163161_10226528 3300017792 Bacteria 1449
372 Ga0163161_10448850 3300017792 Bacteria 1042
373 Ga0163161_10492443 3300017792 Unclassified 997
374 Ga0207697_10008533 3300025315 Bacteria 4476
375 Ga0207682_10002374 3300025893 Bacteria 8477
376 Ga0207682_10021203 3300025893 Bacteria 2555
377 Ga0207682_10048828 3300025893 Unclassified 1745
378 Ga0207642_10065706 3300025899 Bacteria 1705
379 Ga0207642_10536557 3300025899 Unclassified 721
380 Ga0207710_10051147 3300025900 Bacteria 1855
381 Ga0207710_10059916 3300025900 Bacteria 1724
382 Ga0207688_10154944 3300025901 Unclassified 1355
383 Ga0207688_10268596 3300025901 Bacteria 1037
384 Ga0207680_10087592 3300025903 Unclassified 1972
385 Ga0207680_10116955 3300025903 Bacteria 1738
386 Ga0207680_10310500 3300025903 Bacteria 1101
387 Ga0207680_10585731 3300025903 Bacteria 797
388 Ga0207680_10738588 3300025903 Unclassified 706
389 Ga0207645_10005010 3300025907 Bacteria 9705
390 Ga0207645_10019121 3300025907 Bacteria 4498
391 Ga0207645_10092213 3300025907 Bacteria 1949
392 Ga0207645_10353030 3300025907 Bacteria 984
393 Ga0207643_10000827 3300025908 Bacteria 18785
394 Ga0207643_10099713 3300025908 Unclassified 1702
395 Ga0207643_10272188 3300025908 Unclassified 1048
396 Ga0207643_10675950 3300025908 Bacteria 667
397 Ga0207684_10359549 3300025910 Bacteria 1253
398 Ga0207684_10933994 3300025910 Bacteria 728
399 Ga0207654_10195146 3300025911 Bacteria 1330
400 Ga0207662_10052294 3300025918 Bacteria 2431
401 Ga0207662_10175156 3300025918 Bacteria 1378
402 Ga0207649_10058448 3300025920 Bacteria 2415
403 Ga0207646_10120772 3300025922 Bacteria 2354
404 Ga0207646_11257692 3300025922 Bacteria 647
405 Ga0207681_10199180 3300025923 Bacteria 1536
406 Ga0207681_10463047 3300025923 Unclassified 1033
407 Ga0207681_10968404 3300025923 Bacteria 713
408 Ga0207681_11219159 3300025923 Unclassified 632
409 Ga0207694_10584993 3300025924 Unclassified 938
410 Ga0207650_10215522 3300025925 Bacteria 1543
411 Ga0207650_11158492 3300025925 Bacteria 658
412 Ga0207659_10008054 3300025926 Bacteria 6525
413 Ga0207659_10033954 3300025926 Bacteria 3515
414 Ga0207659_10056146 3300025926 Bacteria 2819
415 Ga0207659_10079064 3300025926 Bacteria 2425
416 Ga0207659_10084601 3300025926 Unclassified 2354
417 Ga0207659_10173712 3300025926 Bacteria 1702
418 Ga0207659_10291269 3300025926 Bacteria 1338
419 Ga0207659_10376601 3300025926 Bacteria 1183
420 Ga0207687_10796549 3300025927 Bacteria 806
421 Ga0207644_10013432 3300025931 Bacteria 5459
422 Ga0207644_10365840 3300025931 Bacteria 1174
423 Ga0207644_11131410 3300025931 Bacteria 658
424 Ga0207644_11237977 3300025931 Unclassified 627
425 Ga0207690_10063232 3300025932 Unclassified 2523
426 Ga0207706_10067941 3300025933 Bacteria 3137
427 Ga0207706_10237279 3300025933 Bacteria 1594
428 Ga0207706_10278514 3300025933 Unclassified 1459
429 Ga0207706_10481040 3300025933 Bacteria 1073
430 Ga0207706_11286048 3300025933 Unclassified 605
431 Ga0207686_10001029 3300025934 Bacteria 16493
432 Ga0207686_10913865 3300025934 Bacteria 709
433 Ga0207686_10933123 3300025934 Unclassified 702
434 Ga0207686_11103492 3300025934 Unclassified 647
435 Ga0207709_10010354 3300025935 Bacteria 5135
436 Ga0207709_10088684 3300025935 Bacteria 2014
437 Ga0207709_10163627 3300025935 Bacteria 1554
438 Ga0207670_10507378 3300025936 Unclassified 980
439 Ga0207669_10004687 3300025937 Bacteria 6047
440 Ga0207669_10071207 3300025937 Bacteria 2183
441 Ga0207704_10011185 3300025938 Bacteria 4408
442 Ga0207704_10068629 3300025938 Bacteria 2236
443 Ga0207691_10057781 3300025940 Unclassified 3529
444 Ga0207691_10065493 3300025940 Bacteria 3289
445 Ga0207691_10097067 3300025940 Bacteria 2634
446 Ga0207691_10179647 3300025940 Bacteria 1850
447 Ga0207691_10526817 3300025940 Bacteria 1003
448 Ga0207691_10740691 3300025940 Unclassified 828
449 Ga0207691_10753288 3300025940 Unclassified 820
450 Ga0207711_10034616 3300025941 Bacteria 4278
451 Ga0207711_10288230 3300025941 Bacteria 1513
452 Ga0207711_10374979 3300025941 Bacteria 1320
453 Ga0207711_10687633 3300025941 Bacteria 954
454 Ga0207711_11215944 3300025941 Unclassified 695
455 Ga0207711_11902160 3300025941 Unclassified 538
456 Ga0207689_10002519 3300025942 Bacteria 17017
457 Ga0207689_10024989 3300025942 Bacteria 5007
458 Ga0207689_10057889 3300025942 Bacteria 3188
459 Ga0207689_10126538 3300025942 Bacteria 2102
460 Ga0207689_10419182 3300025942 Unclassified 1117
461 Ga0207689_10576710 3300025942 Bacteria 946
462 Ga0207679_10095714 3300025945 Bacteria 2309
463 Ga0207679_10465779 3300025945 Bacteria 1123
464 Ga0207679_11130808 3300025945 Unclassified 719
465 Ga0207667_10252536 3300025949 Bacteria 1804
466 Ga0207651_10002372 3300025960 Bacteria 8986
467 Ga0207651_10033782 3300025960 Bacteria 3303
468 Ga0207651_10201386 3300025960 Bacteria 1596
469 Ga0207651_10220586 3300025960 Bacteria 1532
470 Ga0207712_10231675 3300025961 Bacteria 1483
471 Ga0207712_10729609 3300025961 Unclassified 867
472 Ga0207712_11048926 3300025961 Unclassified 724
473 Ga0207668_10083636 3300025972 Bacteria 2323
474 Ga0207640_10056392 3300025981 Bacteria 2578
475 Ga0207640_10793728 3300025981 Unclassified 820
476 Ga0207677_10834713 3300026023 Unclassified 827
477 Ga0207703_10003230 3300026035 Bacteria 13705
478 Ga0207703_10010925 3300026035 Bacteria 7076
479 Ga0207703_10053768 3300026035 Bacteria 3273
480 Ga0207703_10076496 3300026035 Unclassified 2777
481 Ga0207703_10473327 3300026035 Unclassified 1173
482 Ga0207703_10863374 3300026035 Viruses 866
483 Ga0207678_10886366 3300026067 Unclassified 789
484 Ga0207708_10010244 3300026075 Bacteria 6961
485 Ga0207708_10028012 3300026075 Bacteria 4266
486 Ga0207708_10049610 3300026075 Bacteria 3197
487 Ga0207702_10010324 3300026078 Bacteria 7822
488 Ga0207641_10045130 3300026088 Bacteria 3710
489 Ga0207641_10261835 3300026088 Unclassified 1620
490 Ga0207641_11111087 3300026088 Bacteria 789
491 Ga0207641_11235684 3300026088 Unclassified 747
492 Ga0207648_10059927 3300026089 Bacteria 3320
493 Ga0207648_10060169 3300026089 Bacteria 3312
494 Ga0207648_10140822 3300026089 Bacteria 2125
495 Ga0207648_10334853 3300026089 Bacteria 1362
496 Ga0207648_10657549 3300026089 Bacteria 969
497 Ga0207676_10289985 3300026095 Bacteria 1489
498 Ga0207674_10022641 3300026116 Bacteria 6743
499 Ga0207674_11093492 3300026116 Unclassified 767
500 Ga0207674_11219699 3300026116 Unclassified 722
501 Ga0207675_100019819 3300026118 Bacteria 6277
502 Ga0207675_100088889 3300026118 Bacteria 2902
503 Ga0207675_100217542 3300026118 Bacteria 1840
504 Ga0207675_100459169 3300026118 Bacteria 1263
505 Ga0207675_100716326 3300026118 Bacteria 1010
506 Ga0207675_100748944 3300026118 Unclassified 988
507 Ga0207675_101592380 3300026118 Unclassified 674
508 Ga0207683_10039117 3300026121 Bacteria 4137
509 Ga0207683_10041849 3300026121 Unclassified 4001
510 Ga0207683_10097491 3300026121 Bacteria 2622
511 Ga0207683_10198930 3300026121 Bacteria 1821
512 Ga0207683_10387200 3300026121 Bacteria 1285
513 Ga0207683_10469546 3300026121 Bacteria 1161
514 Ga0207698_10780839 3300026142 Bacteria 956
515 Ga0210002_1100268 3300027617 Unclassified 523
516 Ga0209971_1058822 3300027682 Unclassified 930
517 Ga0207428_10001189 3300027907 Bacteria 28012
518 Ga0207428_10022512 3300027907 Bacteria 5316
519 Ga0207428_10064340 3300027907 Bacteria 2895
520 Ga0207428_10084549 3300027907 Unclassified 2473
521 Ga0207428_10098446 3300027907 Bacteria 2263
522 Ga0207428_10174203 3300027907 Unclassified 1628
523 Ga0268266_10021806 3300028379 Bacteria 5457
524 Ga0268266_10172519 3300028379 Bacteria 1964
525 Ga0268265_10023512 3300028380 Unclassified 4345
526 Ga0268265_10066665 3300028380 Bacteria 2783
527 Ga0268265_10474851 3300028380 Unclassified 1173
528 Ga0268265_10498424 3300028380 Bacteria 1147
529 Ga0268265_10671466 3300028380 Unclassified 998
530 Ga0268265_10719403 3300028380 Bacteria 966
531 Ga0268265_10812879 3300028380 Unclassified 912
532 Ga0268264_10032438 3300028381 Bacteria 4286
533 Ga0268264_10386074 3300028381 Unclassified 1342
534 Ga0268264_10556127 3300028381 Bacteria 1126
535 Ga0268264_10913705 3300028381 Unclassified 881
536 Ga0268264_12287504 3300028381 Unclassified 548
537 Ga0373949_0041030 3300035090 Bacteria 1138
538 Ga0373932_0208314 3300035112 Bacteria 698
539 Ga0373939_0116895 3300035114 Bacteria 936
540 Ga0373941_0082608 3300035115 Unclassified 1088
541 Ga0373953_0204188 3300035117 Bacteria 855
542 Ga0373954_0174714 3300035118 Bacteria 1053
543 Ga0373956_0341181 3300035119 Bacteria 714
544 Ga0373943_0129826 3300035170 Bacteria 1348
545 Ga0373955_0063955 3300035172 Bacteria 2038
546 Ga0373924_0262655 3300035410 Bacteria 765
547 Ga0373931_0851440 3300035691 Bacteria 610
548 Ga0373927_0593922 3300035695 Bacteria 732
549 Ga0373947_0092794 3300035725 Bacteria 1886
550 Ga0373937_0224097 3300036401 Bacteria 1770
551 Ga0439450_013267 3300042008 Bacteria 1652
552 Ga0439450_127170 3300042008 Bacteria 659
553 Ga0439435_0013170 3300042436 Bacteria 2017
554 Ga0439444_0023486 3300042437 Unclassified 1107
555 Ga0439459_0220926 3300042438 Unclassified 525
556 Ga0439460_0048177 3300042461 Bacteria 1271
557 Ga0451577_0477327 3300042876 Bacteria 1132
558 Ga0439440_0010747 3300042993 Bacteria 1920
559 Ga0439440_0085543 3300042993 Bacteria 840
560 Ga0453684_1555988 3300044712 Bacteria 680
561 Ga0451576_0042847 3300045051 Bacteria 4778
562 Ga0451576_0047179 3300045051 Bacteria 4530
563 Ga0451576_0074726 3300045051 Bacteria 3526
564 Ga0451576_2522327 3300045051 Bacteria 525
565 Ga0495592_0146292 3300046454 Bacteria 1638
566 Ga0495580_0026535 3300046472 Bacteria 4223
567 Ga0495580_0388229 3300046472 Unclassified 942
568 Ga0495585_0434998 3300046492 Bacteria 629
569 Ga0495594_0024070 3300046499 Bacteria 3268
570 Ga0495594_0610807 3300046499 Unclassified 618
571 Ga0495616_0324480 3300046513 Unclassified 646
572 Ga0495628_0261753 3300046516 Bacteria 1289
573 Ga0495630_0380626 3300046517 Bacteria 1081
574 Ga0495663_0298882 3300046525 Unclassified 579
575 Ga0495642_0047562 3300046528 Unclassified 1757
576 Ga0495586_0045955 3300046535 Bacteria 2354
577 Ga0495586_0115865 3300046535 Bacteria 1494
578 Ga0495598_0016860 3300046537 Bacteria 1872
579 Ga0495598_0076232 3300046537 Unclassified 1067
580 Ga0495598_0275172 3300046537 Unclassified 630
581 Ga0495609_0115170 3300046538 Bacteria 1158
582 Ga0495609_0141137 3300046538 Bacteria 1028
583 Ga0495621_0002494 3300046539 Bacteria 4966
584 Ga0495621_0027251 3300046539 Bacteria 1934
585 Ga0495621_0061537 3300046539 Bacteria 1364
586 Ga0495621_0183749 3300046539 Unclassified 836
587 Ga0495621_0245323 3300046539 Unclassified 730
588 Ga0495645_0132855 3300046543 Bacteria 1743
589 Ga0495633_0140455 3300046558 Bacteria 1117
590 Ga0495633_0316846 3300046558 Unclassified 708
591 Ga0495656_0005686 3300046615 Unclassified 4319
592 Ga0495656_0039198 3300046615 Bacteria 1967
593 Ga0495656_0735896 3300046615 Unclassified 531
594 Ga0495668_0473402 3300046616 Unclassified 690
595 Ga0495634_0054645 3300046642 Unclassified 2672
596 Ga0495659_0049688 3300046664 Unclassified 1523
597 Ga0495659_0076389 3300046664 Bacteria 1264
598 Ga0495659_0117438 3300046664 Bacteria 1044
599 Ga0495659_0229565 3300046664 Bacteria 768
600 Ga0495659_0278766 3300046664 Bacteria 702
601 Ga0495588_0027195 3300046674 Bacteria 2858
602 Ga0495658_0056413 3300046683 Unclassified 2240
603 Ga0495669_0019590 3300046684 Bacteria 2922
604 Ga0495669_0265081 3300046684 Unclassified 826
605 Ga0495636_0034268 3300047318 Bacteria 2089
606 Ga0495636_0457809 3300047318 Bacteria 613
607 Ga0495677_0237247 3300047445 Unclassified 712
608 Ga0496104_0746493 3300048907 Unclassified 886
609 Ga0496107_1035232 3300048910 Bacteria 595
610 Ga0496108_1132547 3300048911 Unclassified 664
611 Ga0496110_1361624 3300048913 Unclassified 619
612 Ga0496112_0121623 3300048915 Bacteria 2581
613 Ga0501031_0724407 3300049568 Unclassified 638
614 Ga0501036_0072561 3300049572 Bacteria 2910
615 Ga0501039_0115272 3300049575 Unclassified 2103
616 Ga0501040_0010309 3300049576 Bacteria 6112
617 Ga0501041_0050733 3300049577 Bacteria 2528
618 Ga0501042_0091014 3300049578 Unclassified 2189
619 Ga0501048_0030013 3300049582 Bacteria 3938
620 Ga0501068_0084208 3300049584 Unclassified 1956
621 Ga0501072_0022596 3300049588 Bacteria 4878
622 Ga0501075_0014024 3300049591 Bacteria 5737
623 Ga0501076_0004266 3300049592 Bacteria 10119
624 Ga0501077_1105896 3300049593 Unclassified 510
625 Ga0501081_0082788 3300049743 Bacteria 2248
626 Ga0501045_0021954 3300049824 Bacteria 4568
627 nmdc:mga05p37_1375000_c1 3300050507 Unclassified 713
628 nmdc:mga05p37_1438872_c1 3300050507 Bacteria 691
629 nmdc:mga05p37_154008_c1 3300050507 Bacteria 2810
630 nmdc:mga05p37_21223_c1 3300050507 Bacteria 7861
631 nmdc:mga05p37_29823_c2 3300050507 Bacteria 3481
632 nmdc:mga05p37_34191_c1 3300050507 Bacteria 6225
633 nmdc:mga05p37_441683_c1 3300050507 Bacteria 1509
634 nmdc:mga05p37_54512_c1 3300050507 Bacteria 4919
635 nmdc:mga05p37_64490_c1 3300050507 Unclassified 4507
636 nmdc:mga05p37_66114_c1 3300050507 Bacteria 3926
637 nmdc:mga05p37_7726_c1 3300050507 Bacteria 12691
638 nmdc:mga05p37_806097_c1 3300050507 Unclassified 1026
639 nmdc:mga09592_1940_c1 3300050508 Bacteria 16652
640 nmdc:mga09592_27498_c1 3300050508 Bacteria 4719
641 nmdc:mga09592_44647_c1 3300050508 Bacteria 3731
642 nmdc:mga09592_871586_c1 3300050508 Unclassified 758
643 nmdc:mga0qj67_137361_c1 3300050509 Bacteria 1981
644 nmdc:mga0qj67_182334_c1 3300050509 Bacteria 1705
645 nmdc:mga0qj67_195645_c1 3300050509 Unclassified 1643
646 nmdc:mga0qj67_342223_c1 3300050509 Bacteria 1210
647 nmdc:mga0qj67_55661_c1 3300050509 Bacteria 3134
648 nmdc:mga06r32_17487_c1 3300050510 Bacteria 6545
649 nmdc:mga06r32_17830_c1 3300050510 Bacteria 6488
650 nmdc:mga06r32_1786688_c1 3300050510 Bacteria 551
651 nmdc:mga06r32_585720_c1 3300050510 Unclassified 1087
652 nmdc:mga06r32_88045_c1 3300050510 Bacteria 3031
653 nmdc:mga08y16_41700_c1 3300050511 Bacteria 4808
654 nmdc:mga08y16_5624_c1 3300050511 Bacteria 13128
655 nmdc:mga08y16_56652_c1 3300050511 Bacteria 4096
656 nmdc:mga08y16_57604_c1 3300050511 Bacteria 4060
657 nmdc:mga08y16_63846_c1 3300050511 Unclassified 3846
658 nmdc:mga08y16_658967_c1 3300050511 Bacteria 1050
659 nmdc:mga08y16_684099_c1 3300050511 Unclassified 1027
660 nmdc:mga08y16_691486_c1 3300050511 Unclassified 1021
661 nmdc:mga0n895_16662_c1 3300050512 Bacteria 6749
662 nmdc:mga0n895_213245_c1 3300050512 Bacteria 1961
663 nmdc:mga0n895_245971_c1 3300050512 Bacteria 1815
664 nmdc:mga0n895_332_c1 3300050512 Bacteria 31515
665 nmdc:mga0n895_39770_c1 3300050512 Unclassified 4566
666 nmdc:mga0n895_497098_c1 3300050512 Unclassified 1229
667 nmdc:mga0n895_5886_c1 3300050512 Bacteria 10304
668 nmdc:mga0n895_66854_c1 3300050512 Bacteria 3559
669 nmdc:mga0n895_679551_c1 3300050512 Bacteria 1027
670 nmdc:mga0n895_8543_c1 3300050512 Bacteria 8876
671 nmdc:mga0n895_890532_c1 3300050512 Unclassified 876
672 nmdc:mga0rr50_216120_c1 3300050513 Bacteria 1581
673 nmdc:mga0rr50_37487_c1 3300050513 Unclassified 3500
674 nmdc:mga0rr50_7058_c1 3300050513 Bacteria 6894
675 nmdc:mga08x19_15400_c1 3300050514 Bacteria 4653
676 nmdc:mga08x19_295117_c1 3300050514 Unclassified 1125
677 nmdc:mga08x19_329325_c1 3300050514 Bacteria 1064
678 nmdc:mga0a205_1006966_c1 3300050515 Unclassified 680
679 nmdc:mga0a205_1178032_c1 3300050515 Unclassified 614
680 nmdc:mga0a205_226270_c1 3300050515 Bacteria 1755
681 nmdc:mga0a205_3122_c1 3300050515 Bacteria 14699
682 nmdc:mga0a205_36178_c1 3300050515 Bacteria 4743
683 nmdc:mga0a205_481_c1 3300050515 Bacteria 12546
684 nmdc:mga0a205_53479_c1 3300050515 Bacteria 3897
685 nmdc:mga0a205_657022_c1 3300050515 Unclassified 900
686 nmdc:mga0a205_983_c1 3300050515 Bacteria 23572
687 Ga0501084_0011142 3300054114 Bacteria 7448
688 Ga0501082_0078885 3300060353 Bacteria 2840
689 Ga0207679_10915482
690 JGI24750J21931_1010374
691 JGI24035J26624_1035225
692 JGI25406J46586_10000709
693 Ga0065704_10127228
694 Ga0065704_10202076
695 Ga0065712_10024491
696 Ga0065715_10037993
697 Ga0065715_10204242
698 Ga0065715_10472212
699 Ga0065707_10015978
700 Ga0065707_10045640
701 Ga0065707_10124720
702 Ga0065707_10269842
703 Ga0065707_10671057
704 Ga0070676_10015523
705 Ga0070676_10017549
706 Ga0070690_100015608
707 Ga0070690_100035546
708 Ga0070670_100011285
709 Ga0070670_100042367
710 Ga0070677_10172982
711 Ga0070677_10179241
712 Ga0068869_100007346
713 Ga0068869_100086973
714 Ga0068869_100642900
715 Ga0070666_10016833
716 Ga0070666_10192451
717 Ga0070666_10219447
718 Ga0070666_10343494
719 Ga0070666_10703712
720 Ga0070682_100734981
721 Ga0070689_100297987
722 Ga0070689_100856163
723 Ga0070691_10051537
724 Ga0070691_10403143
725 Ga0070661_100021249
726 Ga0070661_100984335
727 Ga0070692_10248921
728 Ga0070692_10967502
729 Ga0070668_100067682
730 Ga0070668_100221821
731 Ga0070668_100256588
732 Ga0070668_100548911
733 Ga0070669_100009904
734 Ga0070669_100042666
735 Ga0070669_100080299
736 Ga0070669_100112137
737 Ga0070669_100178369
738 Ga0070669_100288990
739 Ga0070669_100392443
740 Ga0070675_100001899
741 Ga0070675_100028300
742 Ga0070675_100030823
743 Ga0070675_100034055
744 Ga0070675_100158647
745 Ga0070675_100285058
746 Ga0070671_100004920
747 Ga0070671_100511809
748 Ga0070671_100677453
749 Ga0070671_101868582
750 Ga0070674_100000714
751 Ga0070674_100368237
752 Ga0070674_100425270
753 Ga0070674_100764306
754 Ga0070673_100011201
755 Ga0070673_100034165
756 Ga0070673_100038041
757 Ga0070673_100131388
758 Ga0070673_100188308
759 Ga0070673_100215320
760 Ga0070673_101010348
761 Ga0070688_100099881
762 Ga0070688_100221750
763 Ga0070659_100029589
764 Ga0070667_100021006
765 Ga0070667_100851329
766 Ga0070709_10299889
767 Ga0070710_10260091
768 Ga0070701_10008665
769 Ga0070701_10059504
770 Ga0070701_10095300
771 Ga0070701_10144294
772 Ga0070701_10771883
773 Ga0070711_100033569
774 Ga0070705_100008639
775 Ga0070705_100034224
776 Ga0070705_100426246
777 Ga0070705_101158632
778 Ga0070700_100005844
779 Ga0070700_100092770
780 Ga0070700_100385311
781 Ga0070700_100414192
782 Ga0070694_100383738
783 Ga0070694_100472285
784 Ga0070694_100530800
785 Ga0070694_100544260
786 Ga0070694_100737041
787 Ga0070708_100267117
788 Ga0070708_101295656
789 Ga0070708_101375425
790 Ga0070663_100680102
791 Ga0070678_100012814
792 Ga0070678_100076614
793 Ga0070678_100185953
794 Ga0070678_100485511
795 Ga0070678_101221450
796 Ga0070662_100017995
797 Ga0070662_100409914
798 Ga0070662_100704086
799 Ga0068867_100009367
800 Ga0068867_100622536
801 Ga0068867_100825088
802 Ga0070685_10038060
803 Ga0070706_100857473
804 Ga0070706_101492574
805 Ga0070706_101789128
806 Ga0070707_100020146
807 Ga0070707_100094209
808 Ga0070707_100146710
809 Ga0070707_101206427
810 Ga0070698_100069574
811 Ga0070698_101496418
812 Ga0070699_100576755
813 Ga0070699_100846114
814 Ga0070699_101339295
815 Ga0070679_102058940
816 Ga0070697_100043544
817 Ga0070697_100335421
818 Ga0070697_101283439
819 Ga0068853_100403961
820 Ga0070672_100001421
821 Ga0070672_100064952
822 Ga0070672_100147516
823 Ga0070672_100199372
824 Ga0070672_100718218
825 Ga0070672_100867014
826 Ga0070686_100064518
827 Ga0070686_100132447
828 Ga0070686_100225783
829 Ga0070686_100397876
830 Ga0070686_100429447
831 Ga0070686_100807420
832 Ga0070695_100092733
833 Ga0070695_101128319
834 Ga0070696_100097022
835 Ga0070696_100300805
836 Ga0070696_101285317
837 Ga0070693_101046023
838 Ga0070693_101264971
839 Ga0070665_100033300
840 Ga0070704_100010487
841 Ga0070704_100162697
842 Ga0070704_100195330
843 Ga0070704_100312425
844 Ga0068855_100174293
845 Ga0070664_100027425
846 Ga0070664_100477600
847 Ga0070664_100534555
848 Ga0068857_100210897
849 Ga0068854_100603706
850 Ga0068854_101381024
851 Ga0068856_100742128
852 Ga0070702_100084830
853 Ga0070702_100115038
854 Ga0070702_100258970
855 Ga0070702_101868377
856 Ga0068859_100023135
857 Ga0068859_100100939
858 Ga0068859_100422633
859 Ga0068859_100613386
860 Ga0068859_100890325
861 Ga0068859_101135313
862 Ga0068859_101153634
863 Ga0068859_101683737
864 Ga0068864_100044624
865 Ga0068864_100342099
866 Ga0068864_100409738
867 Ga0068864_100513030
868 Ga0068864_101015989
869 Ga0068864_101909323
870 Ga0068866_10084240
871 Ga0068866_10146098
872 Ga0068866_10454135
873 Ga0068861_100011692
874 Ga0068861_100020770
875 Ga0068861_100185486
876 Ga0068861_100244113
877 Ga0068861_100961606
878 Ga0068861_102055741
879 Ga0068870_10052247
880 Ga0068870_10113001
881 Ga0068870_10531821
882 Ga0068870_10560559
883 Ga0068863_100218703
884 Ga0068863_100272307
885 Ga0068863_100287090
886 Ga0068863_101333722
887 Ga0068858_100000554
888 Ga0068858_100002848
889 Ga0068858_100012866
890 Ga0068858_100072399
891 Ga0068858_100219677
892 Ga0068858_100882978
893 Ga0068858_101282699
894 Ga0068860_100037777
895 Ga0068860_100137580
896 Ga0068860_100813618
897 Ga0068860_101270426
898 Ga0068860_101529685
899 Ga0068860_101871471
900 Ga0068862_100014641
901 Ga0068862_100204181
902 Ga0068862_100339563
903 Ga0068862_101051435
904 Ga0068862_101111576
905 Ga0068862_101321840
906 Ga0081539_10000025
907 Ga0097621_100002462
908 Ga0097621_100074339
909 Ga0097621_100118408
910 Ga0097621_100197290
911 Ga0097621_101629305
912 Ga0068871_100005019
913 Ga0068871_100016320
914 Ga0068871_100048242
915 Ga0068871_100166775
916 Ga0068871_100992122
917 Ga0068871_101763885
918 Ga0075428_100026119
919 Ga0075428_100065930
920 Ga0075428_100081099
921 Ga0075428_100976974
922 Ga0075430_100011124
923 Ga0075430_100040707
924 Ga0075430_100052268
925 Ga0075430_100119096
926 Ga0075431_100000430
927 Ga0075431_100020688
928 Ga0075431_100099964
929 Ga0075431_100130935
930 Ga0075431_100590892
931 Ga0075433_10000380
932 Ga0075433_10000468
933 Ga0075433_10000617
934 Ga0075433_10095425
935 Ga0075433_10915907
936 Ga0075433_11219348
937 Ga0075434_100000225
938 Ga0075434_100012536
939 Ga0075434_100012808
940 Ga0075434_100039874
941 Ga0075434_100053923
942 Ga0075434_100064536
943 Ga0075434_100133487
944 Ga0075434_100181099
945 Ga0075434_100193822
946 Ga0075434_100318456
947 Ga0075434_100334753
948 Ga0075434_100459037
949 Ga0075434_100624247
950 Ga0075429_100023114
951 Ga0075429_100025855
952 Ga0075429_100048632
953 Ga0075429_100102676
954 Ga0075429_100179429
955 Ga0075429_100410414
956 Ga0068865_100006786
957 Ga0068865_100137065
958 Ga0075436_100068792
959 Ga0075436_100375858
960 Ga0075436_100637211
961 Ga0097620_100023129
962 Ga0097620_100100936
963 Ga0097620_100422619
964 Ga0097620_100613351
965 Ga0097620_100890373
966 Ga0097620_101135598
967 Ga0097620_101153370
968 Ga0097620_101683572
969 Ga0075435_100009503
970 Ga0075435_100102751
971 Ga0075435_100221891
972 Ga0075435_100229681
973 Ga0099794_10062256
974 Ga0099794_10142478
975 Ga0111539_10001810
976 Ga0111539_10002807
977 Ga0111539_10004390
978 Ga0111539_10015291
979 Ga0111539_10025985
980 Ga0111539_10034053
981 Ga0111539_10473768
982 Ga0111539_10801105
983 Ga0105245_10041126
984 Ga0105245_11365218
985 Ga0105245_12655908
986 Ga0105247_10028032
987 Ga0105247_10047679
988 Ga0105247_10160338
989 Ga0114129_10006674
990 Ga0114129_10008050
991 Ga0114129_10012190
992 Ga0114129_10022721
993 Ga0114129_10047211
994 Ga0114129_10049823
995 Ga0114129_10081276
996 Ga0114129_10196158
997 Ga0114129_10817284
998 Ga0114129_12739685
999 Ga0105243_10023122
1000 Ga0105243_10190778
1001 Ga0105243_10986324
1002 Ga0105241_10058469
1003 Ga0105241_11028041
1004 Ga0105242_10007816
1005 Ga0105242_10349392
1006 Ga0105248_10015869
1007 Ga0105248_10092502
1008 Ga0105248_10360139
1009 Ga0105248_10365929
1010 Ga0105248_10824712
1011 Ga0105248_11227475
1012 Ga0105248_11856852
1013 Ga0105248_11987752
1014 Ga0105238_10017744
1015 Ga0105238_11011750
1016 Ga0105249_10002628
1017 Ga0105249_10585640
1018 Ga0105249_10888312
1019 Ga0105249_11409560
1020 Ga0105246_10108677
1021 Ga0105246_10341701
1022 Ga0105246_10595013
1023 Ga0105246_10642880
1024 Ga0157315_1007077
1025 Ga0157374_10619154
1026 Ga0157378_10007010
1027 Ga0157378_10824536
1028 Ga0157378_11462731
1029 Ga0163162_10142797
1030 Ga0163162_10434250
1031 Ga0163162_11628497
1032 Ga0157372_10257743
1033 Ga0157375_10112638
1034 Ga0157375_10208518
1035 Ga0157375_10474619
1036 Ga0157375_12190092
1037 Ga0163163_10025411
1038 Ga0163163_10086089
1039 Ga0163163_10130564
1040 Ga0163163_10607806
1041 Ga0157380_10005290
1042 Ga0157380_10055083
1043 Ga0157380_10098682
1044 Ga0157380_11965412
1045 Ga0157380_12653776
1046 Ga0157377_10021959
1047 Ga0157377_10136512
1048 Ga0157377_10520157
1049 Ga0157377_10633263
1050 Ga0157379_10010849
1051 Ga0157379_10948066
1052 Ga0157379_10995811
1053 Ga0157379_11163647
1054 Ga0157376_10100118
1055 Ga0157376_11288134
1056 Ga0157376_11319457
1057 Ga0157376_11559050
1058 Ga0157376_11602261
1059 Ga0163161_10226528
1060 Ga0163161_10448850
1061 Ga0163161_10492443
1062 Ga0207697_10008533
1063 Ga0207682_10002374
1064 Ga0207682_10021203
1065 Ga0207682_10048828
1066 Ga0207642_10065706
1067 Ga0207642_10536557
1068 Ga0207710_10051147
1069 Ga0207710_10059916
1070 Ga0207688_10154944
1071 Ga0207688_10268596
1072 Ga0207680_10087592
1073 Ga0207680_10116955
1074 Ga0207680_10310500
1075 Ga0207680_10585731
1076 Ga0207680_10738588
1077 Ga0207645_10005010
1078 Ga0207645_10019121
1079 Ga0207645_10092213
1080 Ga0207645_10353030
1081 Ga0207643_10000827
1082 Ga0207643_10099713
1083 Ga0207643_10272188
1084 Ga0207643_10675950
1085 Ga0207684_10359549
1086 Ga0207684_10933994
1087 Ga0207654_10195146
1088 Ga0207662_10052294
1089 Ga0207662_10175156
1090 Ga0207649_10058448
1091 Ga0207646_10120772
1092 Ga0207646_11257692
1093 Ga0207681_10199180
1094 Ga0207681_10463047
1095 Ga0207681_10968404
1096 Ga0207681_11219159
1097 Ga0207694_10584993
1098 Ga0207650_10215522
1099 Ga0207650_11158492
1100 Ga0207659_10008054
1101 Ga0207659_10033954
1102 Ga0207659_10056146
1103 Ga0207659_10079064
1104 Ga0207659_10084601
1105 Ga0207659_10173712
1106 Ga0207659_10291269
1107 Ga0207659_10376601
1108 Ga0207687_10796549
1109 Ga0207644_10013432
1110 Ga0207644_10365840
1111 Ga0207644_11131410
1112 Ga0207644_11237977
1113 Ga0207690_10063232
1114 Ga0207706_10067941
1115 Ga0207706_10237279
1116 Ga0207706_10278514
1117 Ga0207706_10481040
1118 Ga0207706_11286048
1119 Ga0207686_10001029
1120 Ga0207686_10913865
1121 Ga0207686_10933123
1122 Ga0207686_11103492
1123 Ga0207709_10010354
1124 Ga0207709_10088684
1125 Ga0207709_10163627
1126 Ga0207670_10507378
1127 Ga0207669_10004687
1128 Ga0207669_10071207
1129 Ga0207704_10011185
1130 Ga0207704_10068629
1131 Ga0207691_10057781
1132 Ga0207691_10065493
1133 Ga0207691_10097067
1134 Ga0207691_10179647
1135 Ga0207691_10526817
1136 Ga0207691_10740691
1137 Ga0207691_10753288
1138 Ga0207711_10034616
1139 Ga0207711_10288230
1140 Ga0207711_10374979
1141 Ga0207711_10687633
1142 Ga0207711_11215944
1143 Ga0207711_11902160
1144 Ga0207689_10002519
1145 Ga0207689_10024989
1146 Ga0207689_10057889
1147 Ga0207689_10126538
1148 Ga0207689_10419182
1149 Ga0207689_10576710
1150 Ga0207679_10095714
1151 Ga0207679_10465779
1152 Ga0207679_11130808
1153 Ga0207667_10252536
1154 Ga0207651_10002372
1155 Ga0207651_10033782
1156 Ga0207651_10201386
1157 Ga0207651_10220586
1158 Ga0207712_10231675
1159 Ga0207712_10729609
1160 Ga0207712_11048926
1161 Ga0207668_10083636
1162 Ga0207640_10056392
1163 Ga0207640_10793728
1164 Ga0207677_10834713
1165 Ga0207703_10003230
1166 Ga0207703_10010925
1167 Ga0207703_10053768
1168 Ga0207703_10076496
1169 Ga0207703_10473327
1170 Ga0207703_10863374
1171 Ga0207678_10886366
1172 Ga0207708_10010244
1173 Ga0207708_10028012
1174 Ga0207708_10049610
1175 Ga0207702_10010324
1176 Ga0207641_10045130
1177 Ga0207641_10261835
1178 Ga0207641_11111087
1179 Ga0207641_11235684
1180 Ga0207648_10059927
1181 Ga0207648_10060169
1182 Ga0207648_10140822
1183 Ga0207648_10334853
1184 Ga0207648_10657549
1185 Ga0207676_10289985
1186 Ga0207674_10022641
1187 Ga0207674_11093492
1188 Ga0207674_11219699
1189 Ga0207675_100019819
1190 Ga0207675_100088889
1191 Ga0207675_100217542
1192 Ga0207675_100459169
1193 Ga0207675_100716326
1194 Ga0207675_100748944
1195 Ga0207675_101592380
1196 Ga0207683_10039117
1197 Ga0207683_10041849
1198 Ga0207683_10097491
1199 Ga0207683_10198930
1200 Ga0207683_10387200
1201 Ga0207683_10469546
1202 Ga0207698_10780839
1203 Ga0210002_1100268
1204 Ga0209971_1058822
1205 Ga0207428_10001189
1206 Ga0207428_10022512
1207 Ga0207428_10064340
1208 Ga0207428_10084549
1209 Ga0207428_10098446
1210 Ga0207428_10174203
1211 Ga0268266_10021806
1212 Ga0268266_10172519
1213 Ga0268265_10023512
1214 Ga0268265_10066665
1215 Ga0268265_10474851
1216 Ga0268265_10498424
1217 Ga0268265_10671466
1218 Ga0268265_10719403
1219 Ga0268265_10812879
1220 Ga0268264_10032438
1221 Ga0268264_10386074
1222 Ga0268264_10556127
1223 Ga0268264_10913705
1224 Ga0268264_12287504
1225 Ga0373949_0041030
1226 Ga0373932_0208314
1227 Ga0373939_0116895
1228 Ga0373941_0082608
1229 Ga0373953_0204188
1230 Ga0373954_0174714
1231 Ga0373956_0341181
1232 Ga0373943_0129826
1233 Ga0373955_0063955
1234 Ga0373924_0262655
1235 Ga0373931_0851440
1236 Ga0373927_0593922
1237 Ga0373947_0092794
1238 Ga0373937_0224097
1239 Ga0439450_013267
1240 Ga0439450_127170
1241 Ga0439435_0013170
1242 Ga0439444_0023486
1243 Ga0439459_0220926
1244 Ga0439460_0048177
1245 Ga0451577_0477327
1246 Ga0439440_0010747
1247 Ga0439440_0085543
1248 Ga0453684_1555988
1249 Ga0451576_0042847
1250 Ga0451576_0047179
1251 Ga0451576_0074726
1252 Ga0451576_2522327
1253 Ga0495592_0146292
1254 Ga0495580_0026535
1255 Ga0495580_0388229
1256 Ga0495585_0434998
1257 Ga0495594_0024070
1258 Ga0495594_0610807
1259 Ga0495616_0324480
1260 Ga0495628_0261753
1261 Ga0495630_0380626
1262 Ga0495663_0298882
1263 Ga0495642_0047562
1264 Ga0495586_0045955
1265 Ga0495586_0115865
1266 Ga0495598_0016860
1267 Ga0495598_0076232
1268 Ga0495598_0275172
1269 Ga0495609_0115170
1270 Ga0495609_0141137
1271 Ga0495621_0002494
1272 Ga0495621_0027251
1273 Ga0495621_0061537
1274 Ga0495621_0183749
1275 Ga0495621_0245323
1276 Ga0495645_0132855
1277 Ga0495633_0140455
1278 Ga0495633_0316846
1279 Ga0495656_0005686
1280 Ga0495656_0039198
1281 Ga0495656_0735896
1282 Ga0495668_0473402
1283 Ga0495634_0054645
1284 Ga0495659_0049688
1285 Ga0495659_0076389
1286 Ga0495659_0117438
1287 Ga0495659_0229565
1288 Ga0495659_0278766
1289 Ga0495588_0027195
1290 Ga0495658_0056413
1291 Ga0495669_0019590
1292 Ga0495669_0265081
1293 Ga0495636_0034268
1294 Ga0495636_0457809
1295 Ga0495677_0237247
1296 Ga0496104_0746493
1297 Ga0496107_1035232
1298 Ga0496108_1132547
1299 Ga0496110_1361624
1300 Ga0496112_0121623
1301 Ga0501031_0724407
1302 Ga0501036_0072561
1303 Ga0501039_0115272
1304 Ga0501040_0010309
1305 Ga0501041_0050733
1306 Ga0501042_0091014
1307 Ga0501048_0030013
1308 Ga0501068_0084208
1309 Ga0501072_0022596
1310 Ga0501075_0014024
1311 Ga0501076_0004266
1312 Ga0501077_1105896
1313 Ga0501081_0082788
1314 Ga0501045_0021954
1315 nmdc:mga05p37_1375000_c1
1316 nmdc:mga05p37_1438872_c1
1317 nmdc:mga05p37_154008_c1
1318 nmdc:mga05p37_21223_c1
1319 nmdc:mga05p37_29823_c2
1320 nmdc:mga05p37_34191_c1
1321 nmdc:mga05p37_441683_c1
1322 nmdc:mga05p37_54512_c1
1323 nmdc:mga05p37_64490_c1
1324 nmdc:mga05p37_66114_c1
1325 nmdc:mga05p37_7726_c1
1326 nmdc:mga05p37_806097_c1
1327 nmdc:mga09592_1940_c1
1328 nmdc:mga09592_27498_c1
1329 nmdc:mga09592_44647_c1
1330 nmdc:mga09592_871586_c1
1331 nmdc:mga0qj67_137361_c1
1332 nmdc:mga0qj67_182334_c1
1333 nmdc:mga0qj67_195645_c1
1334 nmdc:mga0qj67_342223_c1
1335 nmdc:mga0qj67_55661_c1
1336 nmdc:mga06r32_17487_c1
1337 nmdc:mga06r32_17830_c1
1338 nmdc:mga06r32_1786688_c1
1339 nmdc:mga06r32_585720_c1
1340 nmdc:mga06r32_88045_c1
1341 nmdc:mga08y16_41700_c1
1342 nmdc:mga08y16_5624_c1
1343 nmdc:mga08y16_56652_c1
1344 nmdc:mga08y16_57604_c1
1345 nmdc:mga08y16_63846_c1
1346 nmdc:mga08y16_658967_c1
1347 nmdc:mga08y16_684099_c1
1348 nmdc:mga08y16_691486_c1
1349 nmdc:mga0n895_16662_c1
1350 nmdc:mga0n895_213245_c1
1351 nmdc:mga0n895_245971_c1
1352 nmdc:mga0n895_332_c1
1353 nmdc:mga0n895_39770_c1
1354 nmdc:mga0n895_497098_c1
1355 nmdc:mga0n895_5886_c1
1356 nmdc:mga0n895_66854_c1
1357 nmdc:mga0n895_679551_c1
1358 nmdc:mga0n895_8543_c1
1359 nmdc:mga0n895_890532_c1
1360 nmdc:mga0rr50_216120_c1
1361 nmdc:mga0rr50_37487_c1
1362 nmdc:mga0rr50_7058_c1
1363 nmdc:mga08x19_15400_c1
1364 nmdc:mga08x19_295117_c1
1365 nmdc:mga08x19_329325_c1
1366 nmdc:mga0a205_1006966_c1
1367 nmdc:mga0a205_1178032_c1
1368 nmdc:mga0a205_226270_c1
1369 nmdc:mga0a205_3122_c1
1370 nmdc:mga0a205_36178_c1
1371 nmdc:mga0a205_481_c1
1372 nmdc:mga0a205_53479_c1
1373 nmdc:mga0a205_657022_c1
1374 nmdc:mga0a205_983_c1
1375 Ga0501084_0011142
1376 Ga0501082_0078885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

35

135

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8571 42 73
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.8388 42 73
5g3q-assembly2.cif.gz_B crystal structure of a hypothetical domain in wnk1 0.8192 36 73
2jjd-assembly6.cif.gz_F protein tyrosine phosphatase, receptor type, e isoform 0.7986 42 77
2jjd-assembly4.cif.gz_D protein tyrosine phosphatase, receptor type, e isoform 0.7978 42 77
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8609 43 71 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8486 38 76 2.40.50.140
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8334 43 73 2.120.10.80
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8278 42 75 2.130.10.10
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8158 38 98 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1Q7R103-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9628 25 129
AF-A0A2V8GWG2-F1-model_v4 DUF5666 domain-containing protein 0.9616 36 137
AF-A0A424MZW2-F1-model_v4 DUF5666 domain-containing protein 0.9462 25 127
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9441 40 127
AF-A0A381U9S7-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9429 21 127

Map